�ɲɾ�����ӯ�����һ��ˣ��������С���˴��ͣ�������P���ҹ��ñ˽��ά�Բ��������˸߸ԣ�������ơ��ҹ��ñ�����ά�Բ���ˡ���˳^�ӣ������ӡ� ���ͯj�ӣ��ƺ���ӣ� ? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!PK01]U8!m!mLC_MESSAGES/coreutils.monu[V |7,5< #,2 E O[p >4Fc  '' O j $    " !)$!N!k!'! !!!!""="L""_" " """""""## )#4#9# ?#I#8Q#3# ## ## ####$ $ $ $'$,$1$o4$$$2$%$ %1%*D%o%w%|%$%%%,%&% &'5&0]&Y&'&''8'L'&h'''#'&'(".(TQ(("(+() 2)'S) {)')))) ))));*3K*/*+*'*#+'+G+c+s+y+++A++ +,!,8,?,P,a,,",,,,,0,-,]-#--- -..:.X.$w....../(#/L/e/.z/2///003A0u000000!1&151E1Y1j111111%1 2 -2:2M2c2z2222 22 2"23,3=3#C3'g3333$3#3%"4H4!h4-444445545P5m55555;5 6 $6*E6-p666666#7"67 Y7g7"x7!7777 8 +888H8f8"~88 8889%9(B9 k9x9,9999'9: .:-<:&j:$::":#:;4; G;U; m;w; ;&; ;;<< /< :<F<[< n< {<< < <<<<<7=H=O=^=m== ===J= $>2>G>`>?f>=>(>> ?@L??/???0?0$@ U@,`@*@ @ @ @7@ACB*B0*C[C/D>DCDKDPD aD kDwDD'DDDJE!LEnE)E"EE.E! FBFbFuFF6FF+F-GFG_GuG)GG'GG&H@6HwHHHH"H HI I>INIgIyII)I!IIIJ J J J (JC3J>wJ JJ JJ JJJJK K K !K+K0K5Ky8KKK4K*KL9%L*_LLLL)LLL.L-M'=M-eM5MYM.#N,RNN N(N$NO$#O+HO%tO)OZO$P(DP0mP%P&P-P*Q-DQrQ {Q Q QQQQ:Q4R0IR,zR(R$R RS2SDSJSPS!RSOtSS SS+S+T 0T QT'rT)T)T,T+U8GU<U4U8U+VJV&fV V#V"V%V+W#GWkWWW#WW: XDX]X>xX=X!X!Y19Y5kYY'Y,YZ'Z*BZ)mZZZZZZ [";[^[w[[/[[[ \#\B\$`\"\\\ \\\+\&]>]W]-`]4]#]]^(^)D^(n^&^&^-^_-_?_D_`_!t__#___1_'`C`XW``#`/`2"aUaoaaaa"a$ab*b#>b#bbbbbbb c"c?c%Vc&|c&ccccd).dXdld+d9dd+de-e._H&V+ [L(Os2~J5I1S b78RE<KO9Vh,/v)EC>#N4 L584DPNAM#S3r:*ke .9 '@;P\ I$6%^2q{ Glg%x<13,F"tX0B*(a)B!;U$-=?@nju&o WQZz'wC H`=Y}0Q+TKiAy6 With no FILE, or when FILE is -, read standard input. --help display this help and exit --version output version information and exit -t equivalent to -vT -T, --show-tabs display TAB characters as ^I -u (ignored) -v, --show-nonprinting use ^ and M- notation, except for LFD and TAB (backup: %s) TTY groups= old on repetition %s %b %e %Y%b %e %H:%M%s -> %s (unbackup) %s and %s are the same file%s exists but is not a directory%s has unknown file type%s is too large%s: can make relative symbolic links only in current directory%s: cannot overwrite directory%s: cannot rewind%s: cannot seek to offset %s%s: descend into directory %s? %s: error truncating%s: error writing at offset %s%s: expected a numeric value%s: file has negative size%s: file too large%s: file too long%s: file truncated%s: hard link not allowed for directory%s: input contains a loop:%s: input file is output file%s: integer expected after delimiter%s: invalid file type%s: invalid pattern%s: invalid process id%s: invalid regular expression: %s%s: invalid signal%s: line number must be greater than zero%s: line number out of range%s: multiple signals specified%s: no size information for this device%s: number of bytes is too large%s: overwrite %s? %s: pass %lu/%lu (%s)...%s: pass %lu/%lu (%s)...%s%s: pass %lu/%lu (%s)...%s/%s %d%%%s: read error%s: remove %s %s? %s: remove write-protected %s %s? %s: removed%s: removing%s: renamed to %s%s: replace %s? %s: seek failed%s: value not completely converted%s:%lu: unrecognized keyword %s', load average: %.2f??? AvailAvailableCOMMENTCall the unlink function to remove the specified FILE. Compare sorted files FILE1 and FILE2 line by line. Directory: EXITF. PinardFAILEDFilesystemIDLEIdleIn real life: LINELoginLogin name: Mounted onNAMENameOKOutput who is currently logged in according to FILE. If FILE is not specified, use %s. %s as FILE is common. PIDPlan: Print CRC checksum and byte counts of each FILE. Print the name of the current user. Project: Run COMMAND with root directory set to NEWROOT. Set LC_ALL='C' to work around the problem.Shell: SizeTIMEThe strings compared were %s and %s.TypeUnknown system errorUsage: %s COMMAND [ARG]... or: %s OPTION Usage: %s EXPRESSION or: %s OPTION Usage: %s FILE or: %s OPTION Usage: %s FILE1 FILE2 or: %s OPTION Usage: %s FORMAT [ARGUMENT]... or: %s OPTION Usage: %s [-s SIGNAL | -SIGNAL] PID... or: %s -l [SIGNAL]... or: %s -t [SIGNAL]... Usage: %s [FILE]... or: %s [OPTION] Usage: %s [NUMBER]... or: %s OPTION Usage: %s [OPTION] Usage: %s [OPTION] NAME... Usage: %s [OPTION] [COMMAND [ARG]...] Usage: %s [OPTION] [FILE]... Usage: %s [OPTION]... Usage: %s [OPTION]... DIRECTORY... Usage: %s [OPTION]... FILE PATTERN... Usage: %s [OPTION]... FILE... Usage: %s [OPTION]... FILE1 FILE2 Usage: %s [OPTION]... GROUP FILE... or: %s [OPTION]... --reference=RFILE FILE... Usage: %s [OPTION]... NAME... Usage: %s [OPTION]... SET1 [SET2] Usage: %s [OPTION]... [ FILE | ARG1 ARG2 ] Usage: %s [OPTION]... [FILE] Usage: %s [OPTION]... [FILE]... Usage: %s [OPTION]... [INPUT [OUTPUT]] Usage: %s [OPTION]... [USER]... Usage: %s [STRING]... or: %s OPTION Use%UsedValid arguments are:Warning: WhenWhereWritten by %s and %s. Written by %s, %s, %s, %s, %s, %s, %s, %s, %s, and others. Written by %s, %s, %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, and %s. Written by %s, %s, %s, and %s. Written by %s, %s, and %s. Written by %s. ^[nN]^[yY]`ambiguous argument %s for %san input delimiter may be specified only when operating on fieldsappending output to %sbackup typeblock special fileblock special files not supportedblockscannot access %scannot backup %scannot change ownership of %scannot change permissions of %scannot change root directory to %scannot change to directory %scannot chdir to root directorycannot convert U+%04X to local character setcannot convert U+%04X to local character set: %scannot copy a directory, %s, into itself, %scannot copy cyclic symbolic link %scannot create directory %scannot create fifo %scannot create hard link %s to %scannot create link %s to %scannot create regular file %scannot create special file %scannot create symbolic link %scannot create symbolic link %s to %scannot determine hostnamecannot follow %s by namecannot fstat %scannot get current directorycannot get system namecannot lseek %scannot make both hard and symbolic linkscannot make directory %scannot move %s to %scannot move %s to a subdirectory of itself, %scannot move directory onto non-directory: %s -> %scannot open %s for readingcannot open directory %scannot overwrite directory %s with non-directorycannot overwrite non-directory %s with directory %scannot read directory %scannot read realtime clockcannot read symbolic link %scannot remove %scannot set datecannot set permissions of %scannot split in more than one waycannot stat %scannot touch %scannot un-backup %scannot unlink %schanging group of %schanging ownership of %schanging permissions of %scharacter offset is zerocharacter out of rangecharacter special filecharacter special files not supportedclock changeclose failedclosing %s (fd=%d)closing input file %sclosing output file %sclosing standard inputcouldn't get boot timecreated directory %screating directory %sdirectorydivision by zeroempty taberror in regular expression searcherror reading %serror writing %sexit=failed to change group of %s to %s failed to change ownership of %s to %s failed to get attributes of %sfailed to lookup file %sfailed to open %sfailed to preserve authorship for %sfailed to preserve ownership for %sfailed to preserve permissions for %sfailed to preserve times for %sfailed to redirect standard errorfailed to return to initial working directoryfield number %s is too largefield number is zerofifofork system call failedfts_read failedgetting new attributes of %sgroup of %s retained as %s iconv function not availableiconv function not usableid=ignoring non-option argumentsincompatible tabsinput disappearedinter-device move failed: %s to %s; unable to remove targetinvalid argument %s for %sinvalid body numbering style: %sinvalid conversion specifier in suffix: %cinvalid conversion specifier in suffix: \%.3oinvalid date format %sinvalid device %s %sinvalid device type %sinvalid field number: %sinvalid field width: %sinvalid floating point argument: %sinvalid footer numbering style: %sinvalid groupinvalid group %sinvalid header numbering style: %sinvalid line numbering format: %sinvalid line width: %sinvalid major device number %sinvalid maximum depth %sinvalid minor device number %sinvalid modeinvalid mode %sinvalid number at field startinvalid number of bytesinvalid number of bytes to compareinvalid number of bytes to skipinvalid number of fields to skipinvalid number of linesinvalid option -- %cinvalid precision: %sinvalid time style format %sinvalid universal character name \%c%0*xinvalid userinvalid user %sit is dangerous to operate recursively on %sit is dangerous to operate recursively on %s (same as %s)last=line count option -%s%c... is too largememory exhaustedmessage queuemissing %% conversion specification in suffixmissing conversion specifier in suffixmissing hexadecimal number in escapemissing list of fieldsmode of %s retained as %04lo (%s) multiple -l or -t options specifiedmultiple output files specifiedno files remainingno login nameno process ID specifiednot a ttyomitting directory %sonly one device may be specifiedonly one type of list may be specifiedopen failedownership of %s retained as %s page width too narrowpreserving times for %sread errorread failedreading directory %sregular empty fileregular fileremoved %s removing directory, %srun-levelsemaphoreseparator cannot be emptysetting permissions for %ssetting times of %sshared memory objectskipping file %s, as it was replaced while being copiedsocketstandard errorstandard inputstandard input is closedstandard outputstat failedstray character in field specstring comparison failedsuppressing non-delimited lines makes sense only when operating on fieldssymbolic linktab size cannot be 0tab stop is too large %sterm=the --status option is meaningful only when verifying checksumsthe --warn option is meaningful only when verifying checksumsthe delimiter must be a single characterthe options to print and set the time may not be used togetherthe options to specify dates for printing are mutually exclusivetime %s is out of rangetoo many %% conversion specifications in suffixtotalunrecognized prefix: %suse --no-preserve-root to override this failsafewarning: source file %s specified more than onceweird filewill not create hard link %s to directory %swill not overwrite just-created %s with %swrite errorwrite failedwriting to %syou must specify a list of bytes, characters, or fieldsProject-Id-Version: coreutils 5.2.1 Report-Msgid-Bugs-To: bug-coreutils@gnu.org POT-Creation-Date: 2018-07-01 17:59-0700 PO-Revision-Date: 2004-03-17 11:58+0200 Last-Translator: Petri Jooste Language-Team: Afrikaans Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Bugs: Report translation errors to the Language-Team address. Met geen LÊER, of wanneer die LÊER - is, lees standaardtoevoer. --help wys hierdie teks en stop --version wys weergawe-inligting en stop -t ekwivalent aan -vT -T, --show-tabs wys keepkarakters as ^I -u (ignored) -v, --show-nonprinting gebruik ^ and M- notasie, behalwe vir LFD and TAB (rugsteun: %s) TTYgroepe= oudby herhaling %s %b %e %Y%b %e %H:%M%s -> %s (ont-rugsteun) %s en %s is dieselfde lêer%s bestaan maar is nie 'n lêergids nie%s het 'n onbekende lêertipe%s is te groot%s: relatiewe simboliese skakels kan slegs in die huidige gids gemaak word%s: kan nie die gids oorskryf nie%s: kan nie teruggaan nie%s: kan nie skuif tot by uitwyking %s nie%s: wil jy ingaan in lêergids %s?%s: fout tydens afeindiging%s: fout tydens skryfbewerking by uitwyking %s%s: 'n numeriese waarde is verwag%s: lêer het negatiewe grootte%s: lêer te groot%s: lêer te lank%s: lêer is afgekap%s: 'n vaste skakel word nie toegelaat vir 'n gids nie%s: toevoer bevat 'n lus%s: Die toevoerlêernaam is 'n afvoerlêer.%s: 'n heelgetal is verwag na die skeisimbool%s: ongeldige lêertipe:%s: ongeldige patroon%s: ongeldige proses-id%s: ongeldige reëlmatige uitdrukking: %s%s: ongeldige sein%s: reëlnommer moet groter as nul wees%s: reëlnommer buite bereik%s: veelvuldige seine is gespesifiseer%s: geen grootte-inligting is beskikbaar vir hierdie toestel nie%s: aantal grepe is te veel%s: oorskryf %s?%s: pass %lu/%lu (%s)...%s: pass %lu/%lu (%s)...%s%s: pass %lu/%lu (%s)...%s/%s %d%%%s: leesfout%s: verwyder %s %s? %s: verwyder lees-alleen %s %s? %s: is verwyder%s: besig om te verwyder%s: hernoem as %s%s: vervang %s?%s: seek het misluk%s: waarde is nie volledig omgeskakel nie%s:%lu: onbekende sleutelwoord %s', ladinggemiddeld: %.2f??? BeskikbaarBeskikbaarKOMMENTAARRoep die unlink-funksie om die gespesifiseerde LÊER te verwyder. Vergelyk gesorteerde lêers LÊER1 en LÊER2 reël-vir-reël. Lêergids:VERLAATF. PinardGEFAALLêerstelselLUIERLuierIn die regte lewe:LYNAantekenAantekennaam:Geheg aanNAAMNaamOKVertoon wie tans aangeteken is volgens LÊER. As LÊER nie gespesifiseer is nie, gebruik %s. %s vir LÊER is algemeen. PIDPlan: Druk CRC-toetssom en greeptellings van elke LÊER. Druk die naam van die huidige gebruiker. Projek:Loop BEVEL met wortelgids gestel volgens NUWEBEGINPUNT. Stel LC_ALL='C' om die probleem te systapDop:GrootteTYDDie stringe wat vergelyk is, is %s en %s.TipeOnbekende stelselfoutGebruik so: %s BEVEL [ARG]... of: %s OPSIE Gebruik so: %s UITDRUKKING of: %s OPSIE Gebruik so: %s LÊER of: %s OPSIE Gebruik so: %s LÊER1 LÊER2 of: %s OPSIE Gebruik so: %s FORMAAT [ARGUMENT]... of: %s OPSIE Gebruik so: %s [-s SEIN | -SEIN] PID... of: %s -l [SEIN]... of: %s -t [SEIN]... Gebruik so: %s [LÊER]... of: %s [OPSIE] Gebruik so: %s [GETAL]... of: %s OPSIE Gebruik so: %s [OPSIE] Gebruik so: %s [OPSIE] NAAM... Gebruik so: %s [OPSIE] [BEVEL [ARG]...] Gebruik so: %s [OPSIE] [ LÊER]... Gebruik so: %s [OPSIE]... Gebruik so: %s [OPSIE]... GIDS... Gebruik so: %s [OPSIE]... LÊER PATROON... Gebruik so: %s [OPSIE]... LÊER... Gebruik so: %s [OPSIE]... LÊER1 LÊER2 Gebruik so: %s [OPSIE]... GROEP LÊER... of: %s [OPSIE]... --reference=RLÊER LÊER... Gebruik so: %s [OPSIE]... NAAM... Gebruik so: %s [OPSIE]... STEL1 [STEL2] Gebruik so: %s [OPSIE]... [ LÊER | ARG1 ARG2 ] Gebruik so: %s [OPSIE]... [ LÊER ] Gebruik so: %s [OPSIE]... [LÊER]... Gebruik so: %s [OPSIE]... [TOEVOER [AFVOER]] Gebruik so: %s [OPSIE]... [GEBRUIKER]... Gebruik so: %s [STRING]... of: %s OPSIE Gebruik%InGebruikGeldige parameters is soos volg:Waarskuwing: WanneerWaarGeskryf deur %s en %s. Geskryf deur %s, %s, %s, %s, %s, %s, %s %s, %s en ander. Geskryf deur %s, %s, %s, %s, %s, %s, %s, %s en %s. Geskryf deur %s, %s, %s, %s, %s, %s, %s en %s. Geskryf deur %s, %s, %s, %s, %s, %s en %s. Geskryf deur %s, %s, %s, %s, %s en %s. Geskryf deur %s, %s, %s, %s en %s. Geskryf deur %s, %s, %s en %s. Geskryf deur %s, %s en %s. Geskryf deur %s. ^[nN]^[jJ]`dubbelsinnige parameter %s vir %sslegs wanneer velde gebruik word mag 'n toevoer-skeikarakter gespesifiseer wordafvoer word bygevoeg by %srugsteuntipespesiale bloklêerspesiale bloklêers word nie ondersteun nieblokkan nie toegang verkry na %s niekan nie rugsteun neem van %s niekan nie eienaarskap van %s verander niekan nie toegangsregte van %s verander niekan nie wortelgids verander na %s toe niekan nie chdir doen om na gids %s te gaan niekan nie chdir uitvoer na wortelgids toe niekan nie U+%04X omskakel na 'n plaaslike karakterstel niekan nie U+%04X omskakel na 'n plaaslike karakterstel nie: %skan nie 'n lêergids, %s, na homself kopieer nie, %ssikliese simboliese skakel %s kan nie gekopieer word nieKan nie lêergids %s skep nie.kan nie die pyp %s skep niekon nie vaste skakel %s na %s skep niekon nie skakel %s na %s skep niekan nie 'n gewone lêer %s skep niekan nie spesiale lêer %s skep niekon nie simboliese skakel %s skep niekon nie simboliese skakel %s na %s skep niekan die masjiennaam nie vasstel niekan nie %s per naam volg niekan nie fstat op %s uitvoer niekan nie huidige gids verkry niekan nie die stelselnaam vasstel niekan nie lseek op %s doen niekan nie sowel vaste skakels as simboliese skakels maak niekan nie gids %s maak niekan nie %s skuif na %s niekan nie 'n gids %s skuif na 'n kind van dieselfde gids nie, %s'n gids kan nie geskuif word bo-oor 'n nie-gids nie: %s -> %skan nie %s oopmaak om te lees nieKan nie lêergids %s oopmaak nie.gids %s kan nie oorskryf word met 'n nie-gids niedie nie-gids %s kan nie met gids %s oorskryf word niekan nie gids %s lees niekan nie die reëletyd-horlosie lees niesimboliese skakel %s kan nie gelees word niekan nie %s verwyder niekon nie die datum stel niekan nie toegangsregte van %s verander niekan nie verdeel op meer as een manier niekan nie stat %s uitvoer niekan nie %s aanraak niekan nie %s ont-rugsteun niekan nie %s ontkoppel niegroep van %s word verandereienaarskap van %s word verandertoegangsregte van %s word veranderkarakteruitwyking is nulkarakter is buite die grensespesiale karakterlêerspesiale karakterlêers word nie ondersteun niehorlosieverandering'close' het gefaallêer word toegemaak: %s (fd=%d)toevoerlêer %s word toegemaakafvoerlêer %s word toegemaakstandaard-toevoer word nou toegemaakkon nie die herlaaityd vasstel niegids %s is geskepgids %s word geskeplêergidsdeling deur nulleë keepkarakterfout in soektog met reëlmatige uitdrukkingfout met die les van %sfout met die skryf na %sverlaat=groep kon nie van %s na %s verander word nie groep kon nie eienaarskap van %s na %s verander nie kon nie attribute van %s verkry niekon nie lêer %s opspoor niekon nie %s oopmaak nieouteurskap van %s kon nie behou word nieeienaarskap van %s kon nie behou word niemagtigings vir %s kon nie behou word nielêertye van %s kon nie behou word niekon nie standaardfoutafvoer herlei niekon nie na aanvanklike werkgids terugkeer nieveldnommer %s is te grootveldnommer is nulfifofork-stelselroep het gefaalfts_read het misluknuwe attribute van %s word verkrygroep van %s is behou as %s iconv-funksie is nie beskikbaar nieiconv-funksie onbruikbaarid=parameters wat nie opsies is nie word geïgnoreeronversoenbare keepkarakterstoevoer het verdwyninter-toestel verskuiwing het misluk: %s na %s; die bestemming kan nie verwyder word nieongeldige parameter %s vir %songeldige styl vir lyfnommering: %sontbrekende omskakelingaanduider in suffiks: %contbrekende omskakelingaanduider in suffiks: \%.3oongeldige datumformaat %songeldige toestel %s %songeldige toesteltipe %songeldige veldnommer: %songeldige veldwydte: %songeldige wisselpunt parameter: %songeldige styl vir voetnommering: %songeldige groep ongeldige groep %songeldige styl vir kopnommering: %songeldige reëlnommeringformaat: %songeldige reëlwydte: %songeldige hooftoestelnommer %songeldige maksimum diepte %songeldige subtoestelnommer %songeldige modusongeldige modus %songeldige nommer by begin van veldongeldige aantal grepeongeldige aantal grepe om te vergelykongeldige aantal grepe om oor te slaanongeldige aantal velde om oor te slaanongeldige aantal reëlsongeldige opsie -- %congeldige presisie: %songeldige tydformaatstring: %songeldige universele karakternaam \%c%0*xongeldige gebruikerongeldige gebruiker %sdit is gevaarlik om rekursief te werk op %sdit is gevaarlik om rekursief te werk op %s (net soos %s)laaste=opsie om reëls te tel -%s%c... is te grootgeheue uitgeputboodskapwagtouontbrekende %% omskakelingaanduider in suffiksontbrekende omskakelingaanduider in suffiksheksadesimale getal ontbreek in ontsnapkodeontbrekende lys van veldemodus van %s is behou as %04lo (%s) veelvuldige -l of -t opsies is gespesifiseerveelvuldige afvoerlêers is gespesifiseergeen oorblywende lêersgeen gebruikersnaamgeen proses-id is gespesifiseernie 'n tty nielêergids %s word oorgeslaanslegs een toestel mag gespesifiseer wordslegs een soort lys mag gespesifiseer word'open' het gefaaleienaarskap van %s is behou as %s Bladsywydte te noulêertye van %s word behouleesfout'read' het gefaallêergids %s word geleesgewone leë lêergewone lêer%s is verwyder. lêergids word verwyder, %suitvoervlaksemafoorverdeler mag nie leeg wees nietoegangsregte vir %s word gesteldie tyd van %s is verstelgedeeldegeheue-objeklêer %s word oorgeslaan, want dit is vervang tydens kopieëringsokstandaardfout-afvoerstandaardtoevoerstandaardtoevoer is gesluitstandaard-afvoer'stat' het gefaalverdwaalde karakter in veldspesifikasiestringvergelyking het gefaalom nie-afgeslote reëls te onderdruk, maak slegs sin wanneer dit op velde van toepassing gemaak wordsimboliese skakelinkeping mag nie 0 wees nieinkeping is te groot %sterm=die --status opsie is slegs sinvol by die nagaan van toetssommedie --warn opsie is slegs sinvol by die nagaan van toetssommedie verdeler mag net een karakter weesdie opsies om die tyd te vertoon en te stel kan nie saam gebruik word niedie opsies om drukdatums te spesifiseer is onderling uitsluitendtyd %s is buite bereikte veel %% omskakelingaanduiders in suffikstotaalonbekende voorvoegsel: %sgebruik --no-preserve-root om hierdie veiligheidsnet ter syde te stelwaarskuwing: bronlêer %s is meer as een keer gespesifiseervreemde lêersal nie 'n vaste skakel %s skep na gids %s niedie pasgeskepte %s sal nie met %s oorskryf word nieskryffout'write' het gefaalbesig om te skryf na %su moet 'n lys van grepe, karakters of velde spesifiseerPK01]CO*LC_MESSAGES/elinks.monu[/`?Fa??$???@0@L@b@z@@!@@@A!A>ASAcA rAA A A AA AAAABB B +B7BOBbB iBuB B BB B BB B BB,C-C>CUC$mCC CCC CCDD #D .D9D SD ^DiDzDDDD DD DDDDEE +E5EGHH)H=H QH ]HjHyHzHH I)I@I)_IIIIIIII II J/J?JEJ_J~JJ JJ-J K'K;KOKcK&wKKKL$LLL LL M M M 5MAMYMrMMMMMMN)N/>N'nNNNNN N-O.O HO iO vOO O&OO OPP$Pk/*l9Zl0l>l/m=4m-rm;m+m9n BnOnWn_nennn tnnn n.n n#no'oAo [ofonouoo ooo o o oo-op.pWqSXq&q&q=q8r7rr"s$&sKsZsrss s ssss ss s st t#t3tDt_t gtut ttt"t t*t"t"u @uMu\ukuuuuuu u!uu#v)v1vP9vDv v<v-w5Fw.|w*wwww wx xxx "x 0x ;xHxWx oxzxxxxxxxxxxxx yy"y (y3yIYlp ΃؃&.FJ N\y!!݄&C^x ͅ ޅ  'CT]+c  % @&gx ʇۇ iv/-ψ $ . <,Gt z 8Ӊۉ'/&Gn@Ί'59"os# Čь  '@Zq ؍-$!Rt ؎3#1U\ a k%u)*ŏ  : Ye ِ  =)Z:%ܑ" %)F!p7"& 4== { Γٓ   %0CR[ j t"~ <G KV] nyؕ *@HW`q-x  ֖ (Gd{  ʗؗ "',5M ]hx Ƙ ̘֘<Q `l {Ι8J N [gz *=ٚ/6R bmr қ 8C V.` %ʜҜ . 3@Q X dp ǝ?؝)2; LX ]~ )ݞ#B+(n7+  %/E \i{ʠܠ  .@^q(¡ ڡ3N,]*Т=Si(*ã4*#Naq=x4$8,I(v4ϥ-2E%\(  ŦϦԦۦ & +JY0i ɧէ( 1= F!QsǨ Шݨ !)-6 IU [ e r ̩ݩ"(- BP cq..1LS[d }n38ڬ27F8~=57+?cD8=!4_94ί9=QXa gq x3)԰)(AYq б ٱ 2,2ײQ J\,+ԳBC?δ$(9bqĵʵе ص%  ,8Laƶ#Ͷ0)3,]"  " =Jf&u \L Y2e"<'$ EK\b q{  ú ߺ  *>Us  Ż̻ӻֻ ݻ  + ; EPa fq   Ѽۼ    (5> DQW jtz %ݽ  ).7 f p~  þ;־ݾ%* AN]L0d6\- m>\BIF4j`!<[{G Wt$0G841 ;qH}IStW}e _-UP~?(kkY:P F9R 0aSlQ e>)c1n5:N.eK3q%KN'$7,|(r?C|+Ywgsv"zYHS{&foXw~ z , 'C}(Qwu  &U 6MaJ3cX iL&T/DGU2vOI8hjE.l>"s/5]To#!xn^@1[ _9#PpX+fn@H^g7sy3M2h]CV=z"Zpy`/`p!rA'xEg bxZ^cWu@*jFZ Ro=2{):[u\*t;<h,8AiD;Q7E-#$)mVdBJbr.a6BfmMJT|yv<Vq%_K?9l5~b+4kdDL=ORiO This value has been changed since you last saved your configuration.%ld byte%ld bytes%ld byte overhead%ld bytes overhead%ld connecting%ld connecting%ld connection%ld connections%ld file%ld files%ld formatted%ld formatted%ld in use%ld in use%ld loading%ld loading%ld session%ld sessions%ld terminal%ld terminals%ld transferring%ld transferring%u available%u available%u completed%u completed%u connection%u connections%u downloader%u downloaders'%s' is a directory.(default: "%s")(default: %ld)(default: %s)(expand by pressing space)16 colors256 colors88 colorsAbort and delete fileAbort and ~delete fileAboutAccept cookie?Accept policyAccess keysAccess to server deniedAccesskey priorityActionActive linkActive link colors.Add bookmarkAdd folderAdd keybindingAdd optionAdd serverAdd se~paratorAdd ~folderAdd ~serverAnonymous passwordAsk for confirmation when submitting a form.Asynchronous DNSAuthentication managerAuthentication requiredAuthentication required for %s at %sAutomatic links followingAverage speedBackground colorBackground with ~notifyBad FTP loginBad FTP responseBad NNTP responseBad URL syntaxBad numberBad stringBad terminal size: %d, %dBelarusianBitTorrentBitTorrent errorBlock the terminalBoldBookmark managerBookmark options.Bookmark tabsBookmarked-link colorBookmarksBookm~ark documentBooleanBrazilian PortugueseBrowsingBuilt on %s %sBulgarianButtonB~ookmark all tabsCGICacheCache managerCan't write to stdout.Can't write to stdout: %sCannot access the fileCannot add an option here.Cannot create temp fileCannot get file statusCannot move folder inside itselfCannot read the fileCannot rename the fileCannot write the fileCascading Style SheetsCase insensitiveCase sensitiveCase sensitivityCatalanCharsetCharset options.ClearClear all cookiesClear all history entriesClear all itemsClockCloseClose all tabs but the current oneClose tabColorColor mode:Color settingsColor settings for color terminal.Color terminalsColorsCommentCommentsCompress empty linesCompress successive empty lines to only one in displayed text.Configuration optionsConfirm submissionConnecting to peersConnection options.ConnectionsContent typeCookie managerCookiesCookies accepting policy: 0 is accept no cookies 1 is ask for confirmation before accepting cookie 2 is accept all cookiesCookies options.Coo~kiesCould not compile regular expression '%s'Could not create file '%s': %sCould not find a link with the text '%s'.Could not load file %s: %sCroatianCzechC~haracter setC~learC~lose all tabs but the currentDanishData modifiedDateDate formatDate format to use in dialogs. See strftime(3).DebugDefault background color.Default bookmarked link color.Default codepageDefault color settingsDefault document color settings.Default form input sizeDefault form input size if none is specified.Default image link color.Default link color.Default news serverDefault style sheetDefault text color.Default user interface color settings.Default visited link color.Define how to handle links having target=_blank set: 0 means open link in current tab 1 means open link in new tab in foreground 2 means open link in new tab in background 3 means open link in new windowDelete "%s"? %sDelete all cookies from domain "%s"?Delete bookmarkDelete cache entryDelete cookieDelete domain's cookiesDelete errorDelete folderDelete history entryDelete itemDelete marked bookmarksDelete marked bookmarks?Delete marked cache entriesDelete marked cache entries?Delete marked cookiesDelete marked cookies?Delete marked history entriesDelete marked history entries?Delete marked itemsDelete marked items?Delete the folder "%s" and all bookmarks in it?Delete the folder "%s" and its content?Delete this bookmark?Delete this cache entry?Delete this cookie?Delete this history entry?DescriptionDialog shadow colors (see ui.shadows option).Dialog text field colors.Digital clock in the status bar.Directories:DirectoryDirectory colorDisplay URIsDisplay URIs in the document as links.Display access key in link infoDisplay access key in link info.Display framesDisplay frames.Display links to imagesDisplay links to images w/o altDisplay numbers next to the links.Display styleDisplay style for image tagsDisplay subscriptsDisplay subscripts (as [thing]).Display superscriptsDisplay superscripts (as ^thing).Display tablesDisplay tables.Do not send Accept-CharsetDo nothingDo you really want to close all except the current tab?Do you really want to close the current tab?Do you really want to exit ELinks (and terminate all downloads)?Do you really want to exit ELinks?Do you really want to interrupt all downloads?Do you really want to remove all bookmarks?Do you really want to remove all cookies?Do you really want to remove all history entries?Do you really want to remove all items?Do you want to accept a cookie from %s?Do you want to follow the redirect and post form data to URL %s?Do you want to post form data to URL %s?Do you want to repost form data to URL %s?DocumentDocument browsing options (mainly interactivity).Document cacheDocument options.Document ~infoDomainDownloadDownload complete: %sDownload errorDownload ima~geDownload infoDownload managerDownloadingDown~loadDutchECMAScriptECMAScript options.ELinks ~GITWebEditEdit bookmarkElapsed timeEmpty directoryEmpty string not allowedEnableEnable CSSEnable adding of CSS style info to documents.Enable colorEnable global history ("history of all pages visited").EncodingEnglishEnsure contrastEnter URLEnter folder nameEnter link numberErrorError downloading %s: %sError opening fileError reading from socketError while posting formError writing to fileError writing to socketEstonianExit ELinksExmodeExpand itemExpiresExtended regexp searchExtensionExtension(s)External editorE~xitFSPFSP specific options.FTPFTP PORT command failedFTP file errorFTP proxy configuration.FTP service unavailableFTP specific options.Failed to create session.FileFile existsFile formatFile not foundFile uploadFile ~extensionsFilesFiles:Find ~nextFind ~previousFingerFinnishFlagsFolderFolder nameFollow link and r~eloadForm HistoryForm f~ieldsForm historyForm history managerFormatFormsFrame at ~full-screenFrenchGalicianGermanGetting headersGlobal HistoryGlobal historyGlobal history managerGlobal history options.Global ~historyGo for~wardGo to URLGo to linkGo ~backGo ~forwardGopherGreekHTTPHTTP error %03dHTTP proxy configuration.HTTP-specific options.HTTPSHTTPS proxy configuration.HTTPS-specific options.Handling of target=_blankHarmless buttonHeaderHeader infoHistoryHistory options.Host and port-numberHungarianH~eader infoIDIcelandicIgnore charset info from serverIgnore charset info sent by server.ImageImage-link colorImagesImport external style sheetsIncrease contrastIndonesianInfoInformation filesInsert modeIntegerInternal errorInternal header infoInterrupt all downloadsInterrupt downloadInterrupt marked downloadsInterrupt marked downloads?Interrupt this download?InterruptedInvalid keystroke.ItalianJavaScript support is not enabledKeep unhistoryKeep unhistory ("forward history").KeysKeystrokeKeystroke already usedLED indicatorsLED ~indicatorsLEDsLEDs (visual indicators) options.LanguageLast modifiedLast visit timeLinkLink colorLink imageLink last visit timeLink titleLink title (from history)LinksLithuanianLoaded sizeLocal file access is not allowed in anonymous modeLocal filesLogging inLoginLongintLooking up hostMIMEMake the active link text bold.Making connectionMaximum ageMaximum connectionsMaximum connections per hostMaximum length for image filenameMaximum length for image labelMaximum number of concurrent connections to a given host.Maximum number of concurrent connections.Maximum number of entriesMaximum number of entries in the global history.Maximum number of peers to requestMaximum portMemory cacheMemory cache options.Memory cache size (in bytes).Minimum portMissing fragmentNNTPNNTP and news specific options.NameNeed to select an action.Next tabNex~t tabNe~ver for this siteNo URLNo colors (mono)No contentNo documentNo extensionsNo further matches for '%s'.No header info.No historyNo link selectedNo links in current documentNo previous searchNo titleNormal searchNorwegianNothing to moveNumberNumber expected in fieldNumber keys select linksNumber linksNumber should be in the range from %d to %d.OKOnly local connections are permittedOpen a new tabOpen a new tab in the backgroundOpen a new windowOpen authentication managerOpen in new tab in ~backgroundOpen in new ~tabOpen in new ~windowOpen in ~external editorOpen new tab in backgroun~dOpen new ~tabOpen the current link in a new tabOpen the current link in a new tab in the backgroundOpen the current link in a new windowOpen ~new windowOption managerOptionsOptions concerning how to use CSS for styling documents.Options concerning the display of plain text pages.Options for handling of images.Options for handling of links to other documents.Options for handling of the forms interaction.Options for information files in ~/.elinks.Options for searching.Options for the active link.Options regarding files downloading and handling.Options were saved successfully to config file %s.Out of memoryParanoid securityPass link URI to e~xternal commandPass tab URI to e~xternal commandPasswordPassword fieldPathPeersPiecesPolicyPolishPort rangePort range allowed to be used for listening on.PortuguesePress space to expand this folder.Previous tabPre~v tabProgram ('%' will be replaced by the filename)ProtocolProtocol specific options.ProtocolsProxy URLProxy authentication password.Proxy authentication username.Proxy configurationRead errorReceivedRedirectReferencesRegexp searchRegular expressionsRel~oad documentRequest must be restartedRequest sentResavingReset formResize t~erminalResource ~infoResourcesResumingRomanianRussianSSLSSL errorSSL negotiationSSL options.SaveSave URLSave URL asSave UR~L asSave errorSave folder stateSave intervalSave optionsSave to fileSaved sessionSavingSa~veSa~ve formatted documentSa~ve under the alternative nameSearchSearch HistorySearch backwardSearch bookmarksSearch for textSearch historySearch hit bottom, continuing at top.Search hit top, continuing at bottom.Search string '%s' not foundSearch ~backwardSearchingSend Accept-Language headerSend Accept-Language header.SeparatorSerbianServerServer is processing requestServer nameSet window titleShadowSharingShould this login be remembered? Please note that the password will be stored obscured (but unencrypted) in a file on your disk. If you are using a valuable password, answer NO.Show form history dialogShow ~headerSizeSlovakSorry, but cache entry "%s" cannot be deleted.Sorry, but cache entry "%s" is being used by something else.Sorry, but cookie "%s" cannot be deleted.Sorry, but cookie "%s" is being used by something else.Sorry, but cookie domain "%s" cannot be deleted.Sorry, but cookie domain "%s" is being used by something else.Sorry, but download "%s" cannot be interrupted.Sorry, but download "%s" is being used by something else.Sorry, but history entry "%s" cannot be deleted.Sorry, but history entry "%s" is being used by something else.Sorry, but the bookmark "%s" cannot be deleted.Sorry, but the bookmark "%s" is being used by something else.Sorry, but the folder "%s" cannot be deleted.Sorry, but the folder "%s" is being used by something else.Sorry, but the item "%s" cannot be deleted.Sorry, but the item "%s" is being used by something else.Sort entriesSpanishSpecialSpeedStandardStateStatisticsStatusStringSubmit buttonSubmit form and open in new tab in ~backgroundSubmit form and open in new ~tabSubmit form and open in new ~windowSubmit form and rel~oadSubmit form and ~downloadSubmit form automaticallySwarm infoSwedishSystemTerminal optionsTerminal options.TerminalsTextText WWW browserText areaText colorText fieldText field textThe BitTorrent metainfo file contained errorsThe URL you are about to follow might be maliciously crafted in order to confuse you. By following the URL you will be connecting to host "%s" as user "%s". Do you want to go to URL %s?The file will be opened with the program '%s'.The form data you are about to post might be incomplete. Do you want to post to URL %s?The keystroke "%s" is currently used for "%s". Are you sure you want to replace it?The maximum port to try and listen on.The minimum port to try and listen on.This file already exists: %s The alternative filename is: %sThis option cannot be edited. This means that this is some special option like a folder - try to press a space in order to see its contents.This version of ELinks does not contain SSL/TLS supportTitleToggle displaying of links numbersToggle displaying of links to imagesToggle i~magesToggle ~document colorsToggle ~link numberingTransfer failedTransferringTransparencyTurkishTypeT~wtermURI passingURLURL protocol not supported (%s).UkrainianUnable to retrieve %sUnderlineUnderline linksUnderline links.Underline the active link.UnknownUnknown errorUnknown file typeUnknown typeUntitledUploadUsage: elinks [OPTION]... [URL]...Use HTTP/1.0Use HTTP/1.0 protocol instead of HTTP/1.1.Use UI language as Accept-LanguageUse document-specified colorsUse tabindexUseless buttonUser interfaceUser interface options.User-agent identificationUsernameValueViewerVisited-link colorV~iew imageWaiting for redirect confirmationWaiting in queueWarn about maliciously crafted URIsWarningWelcomeWelcome to ELinks! Press ESC for menu. Documentation is available in Help menu.What to display in global history dialog: 0 is URLs 1 is page titlesWhat to do?What would you like to do with the file '%s' (type: %s%s%s)?What would you like to do with the file '%s'?Whether to display a digital clock in the status bar.Whether to sort entries in directory listings.Whether to use asynchronous DNS resolving.WidthWrite config success[0|1]at quit timeaverageaverage speedavgcurcurrent speeddownloadedelapsed timeestimated timeignoring server settingincompleteinvalidmaster terminalmodifiednamenononeofpartialpress %s to editpress %s to navigatepress %s to post to %spress %s to submit to %sread onlyslave terminalspeedtrue coloruploadedvalidvalueyes~Abort~About~Accept~Add~Add link to bookmarks~Authentication~Background~BeOS terminal~Bookmark~Bookmarks~Bugs information~Cache~Cancel~Close tab~Copying~Delete~Display~Do not show anymore~Documentation~Download link~Downloads~ELinks homepage~Edit~File~Follow link~Form history~Full screen~Go to URL~Goto~Help~History~Info~Keybinding manager~Keys~Language~Link~Login~Modify~Move~No~OK~Open~Options manager~Overwrite the original file~Pass frame URI to external command~Reject~Reload~Rerender document~Reset form~Resume download of the original file~Save as~Save options~Search~Setup~Submit form~Terminal options~Toggle display~Tools~Unhistory~View~Wrap text on/off~Xterm~YesProject-Id-Version: 0.12 Report-Msgid-Bugs-To: elinks-users@linuxfromscratch.org POT-Creation-Date: 2012-10-28 14:13+0200 PO-Revision-Date: 2006-09-25 17:13+0200 Last-Translator: Friedel Wolff Language-Team: Language: MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=(n != 1); X-Generator: Pootle 0.10rc4 Hierdie waarde is verander sedert u opstelling laas gestoor is.%ld greep%ld grepe%ld greep oorhoofse koste%ld grepe oorhoofse koste%ld verbind%ld verbind%ld verbinding%ld verbindings%ld lêer%ld lêers%ld geformateer%ld geformateer%ld in gebruik%ld in gebruik%ld laai%ld laai%ld sessie%ld sessies%ld terminaal%ld terminale%ld dra oor%ld dra oor%u beskikbaar%u beskikbaar%u voltooi%u voltooi%u verbinding%u verbindings%u aflaaier%u aflaaiers'%s' is 'n gids.(verstek: "%s")(verstek: %ld)(verstek: %s)(druk spasie om oop te vou)16 kleure256 kleure88 kleureStaak en skrap lêerStaak en s~krap lêerAangaandeAanvaar koekie?AanvaardingsbeleidToegansleutelsToegang tot bediener geweierToegangsleutelprioriteitAksieAktiewe skakelKleure vir aktiewe skakels.Voeg boekmerk byVoeg gids byHeg kortpadsleutelVoeg keuse byVoeg bediener byVoeg ~skeier inVoeg ~gids byVoeg ~bediener byAnonieme wagwoordVra vir bevestiging met die indien van 'n vorm.Asinchrone DNSMagtigingbestuurderMagtiging benodigMagtiging benodig vir %s by %sAutomatiese volg van skakelsGemiddelde spoedAgtergronkleurAgtergrond met ~kennisgewingSlegte FTP-aanmeldingSlegte FTP-antwoordSlegte NNTP-antwoordVerkeerde URL-sintaksSlegte getalSlegte stringSlegte terminaalgrootte: %d, %dBelo-RussiesBitTorrentBitTorrent-foutBlok die terminaalVetBoekmerkbestuurderBoekmerkkeuses.Stoor oortjies in boekmerkeKleur van geboekmerkte skakelsBoekmerke~Boekmerk dokumentBoolsBrasiliaanse PortugeesBlaaiGebou op %s %sBulgaarsKnoppieB~oekmerk alle oortjiesCGIKasKasbestuurderKan nie skryf na stdout nie.Kan nie skryf na stdout nie: %sKan nie toegang kry tot lêer nieKan nie 'n keuse hier byvoeg nie.Kan nie tydelike lêer skep nieKan nie lêerstatus bepaal nieKan nie 'n gids in homself inskuif nieKan nie die lêer lees nieKan nie lêer hernoem nieKan nie die lêer skryf nieCascading Style SheetsNie kassensitief nieKassensitiefKassensitiwiteitKatalaansKarakterstelKarakterstelkeuses.Maak skoonSkrap alle koekiesSkrap alle geskiedenisitemsSkrap alle itemsHorlosieSluitSluit alle oortjies behalwe die huidige eenSluit oortjieKleurKleurmodus:KleurinstellingsKleurinstellings vir kleur terminale.KleurterminaleKleureKommentaarKommentaarPers leë lyne saamPers opeenvolgende leë lyne saam tot een in die vertoonde teks.OpstellingkeusesBevestig indieningVerbind aan eweknieëVerbindingkeuses.VerbindingsInhoudtipeKoekiebestuurderKoekiesKoekieaanvaardingsbeleid: 0 is aanvaar geen koekies nie 1 is vra eers vir bevestiging voor een aanvaar word 2 is aanvaar alle koekiesKoekiekeusesK~oekiesKon nie reguliere uitdrukking '%s' saamstel nieKon nie lêer '%s' skep nie: %sKon nie 'n skakel met die teks '%s' vind nie.Kon nie lêer %s laai nie: %sKroatiesTsjeggies~KarakterstelMaak skoonS~luit alle oortjies behalwe die huidige eenDeensData gewysigDatumDatumformaatDatumformaat om in dialoë te gebruik. Sien strftime(3).OntfoutVerstekagtergrondkleur.Verstek kleur van geboekmerkte skakels.VerstekkarakterstelVerstekkleurinstellingsVerstelinstellings vir dokumentkleure.Verstek invoergrootte in formsVerstek invoergrootte in forms indien geen gespesifiseer is nie.Verstekkleur van prentskakels.Verstekskakelkleur.VersteknuusbedienerVerstek styllêerVerstektekskleur.Verstek-kleurinstellings van die gebruikerkoppelvlak.Verstekkleur van besoekte skakels.Definieer gedrag vir skakels met target=_blank: 0 beteken maak oop in huidige oortjie 1 beteken maak oop in nuwe oortjie in die voorgrond 2 beteken maak oop in nuwe oortjie in die agtergrond3 beteken maak oop in nuwe vensterSkrap "%s"? %sSkrap alle koekies van domein "%s"?Skrap boekmerkSkrap kasitemSkrap koekieSkrap domein se koekiesFout tydens skrapSkrap gidsSkrap geskiedenisitemSkrap itemSkrap gemerkte boekmerkeSkrap gemerkte boekmerke?Skrap gemerkte kasitemSkrap gemerkte kasitem?Skrap gemerkte koekiesSkrap gemerkte koekies?Skrap gemerkte geskiedenisitemsSkrap gemerkte geskiedenisitems?Skrap gemerkte itemsSkrap gemerkte items?Skrap die gids "%s" en alle boekmerke daarin?Skrap die gids "%s" en sy inhoud?Skrap hierdie boekmerk?Skrap hierdie kasitem?Skrap hierdie koekie?Skrap hierdie geskiedenisitem?BeskrywingSkadukleure vir dialoog (sien die ui.shadows-keuse)Teksveldkleur in dialoë.Digitale horlose in die statusbalk.Gidse:GidsGidskleurWys URI'sWys URI's in die dokument as skakels.Vertoon toegangsleutel in skakelinligtingVertoon toegangsleutel in skakelinligting.Wys rameWys rame.Wys skakels na prenteWys skakels na prente sonder altWys nommers langs die skakels.VertoonstylVertoonstyl vir prent-etiketteWys onderskrifWys onderskrif (as [iets]).Wys superskrifWys superskrif (as ^iets).Wys tabelleWys tabelle.Moenie Accept-Charset stuur nieDoen niksWil u regtig al die oortjies behalwe die huidige een toemaak?Wil u regtig die huidige oortjie toemaak?Wil u regtig ELinks verlaat (en alle aflaaie nietig maak)?Wil u regtig ELinks verlaat?Wil u regtig alle aflaaie onderbreek?Wil u regtig alle boekmerke skrap?Wil u regtig alle koekies skrap?Wil u regtig alle geskiedenisitems skrap?Wil u regtig alle items verwyder?Wil u 'n koekie van %s aanvaar?Wil u die aanstuur volg en vormdata instuur aan URL %s?Wil u vormdata instuur aan URL %s?Wil u vormdata oor instuur aan URL %s?DokumentKeuses vir blaai van dokumente (hoofsaaklik interaktiwiteit).DokumentkasDokumentkeuses.Dokument~inligtingDomeinAflaaiAflaai afgehandel: %sAflaaifoutLaai prent ~afAflaai-inligtingAflaaibestuurderAflaai~Laai afNederlandsECMAScriptECMAScript-keuses.ELinks-~GITWebRedigeerWysig boekmerkTyd verbyLeë gidsLeë string word nie toegelaat nieAktiveerAktiveer CSSAktiveer die toevoeging van CSS-stylinligting tot dokumente.Aktiveer kleurAktiveer globale geskiedenis ("geskiedenis van alle besoekte bladsye").EnkoderingEngelsVerseker kontrasTik URL inTik gidsnaam inTik skakelnommer inFoutFout met aflaai van %s: %sKon nie lêer oopmaak nieFout met lees vanaf sokFout met instuur van vormFout met die skryf na die lêerFout met skryf na sokEstniesVerlaat ELinksEx-modusLaat item oopvouVervalSoektog met uitgebreide reguliere uitdrukkingUitbreidingUitbreiding(s)Eksterne redigeerder~Sluit afFSPFSP-spesifieke keuses.FTPFTP PORT-opdrag het gefaalFTP-lêerfoutFTP-instaanbedieneropstelling.FTP-diens nie beskikbaar nieFTP-spesifieke keuses.Kon nie sessie skep nie.LêerLêer bestaanLêerformaatLêer nie gevind nieLêeroplaaier~LêeruitbreidingsLêersLêers:Vind vol~gendeVind vo~rigeFingerFinsVlaeGidsGidsnaamVolg skakel en ~herlaaiVormgeskiedenis~VormveldeVormgeskiedenisVormgeskiedenisbestuurderFormaatVormsRaam in ~volle skermFransGallikaansDuitsKry koppeGlobale geskiedenisGlobale geskiedenisGlobale geskiedenisbestuurderKeuses oor globale geskiedenis.Globale ~geskiedenisGaan ~vorentoeGaan na URLGaan na skakelGaan ~terugGaan ~vorentoeGopherGrieksHTTPHTTP-fout %03dHTTP-instaanbediener.HTTP-spesifieke keuses.HTTPSHTTPS-instaanbediener.HTTPS-spesifieke keuses.Hantering van target=_blankSkadelose knoppieKopKopinligtingGeskiedenisGeskiedeniskeuses.Rekenaar en poortHongaars~KopinligtingIDYslandsIgnoreer die karakterstel van die bedienerIgnoreer die karakterstel wat deur die bediener gestuur word.PrentPrentskakel-kleurPrenteVoer eksterne styllêers inVerhoog kontrasIndonesiesInfoInligtinglêersInvoermodusHeelgetalInterne foutInterne kopinligtingOnderbreek alle aflaaieOnderbreek aflaaiOnderbreek gemerkte aflaaieOnderbreek gemerkte aflaaie?Onderbreek hierdie aflaai?OnderbreekOngeldige sleutel.ItaliaansJavaScript-ondersteuning is nie geaktiveer nieHou toekomsHou toekoms ("vorentoe geskiedenis").SleutelsSleutelSleutel reeds in gebruikLED-aanwysers~LED-aanwysersLED'sLED-opsies (visuele aanwysers).TaalLaas gewysigLaaste besoektydSkakelSkakelkleurSkakelprentSkakel se laaste besoektydSkakeltitelSkakeltitel (vanuit geskiedenis)SkakelsLitousGelaaide groottePlaaslike lêertoegang word nie toegelaat in anonieme modus niePlaaslike lêersMeld aanMeld aanLang heelgegetalKyk naam opMIMEMaak die aktiewe skakelteks vet.Verbinding word gemaakMaksimum ouderdomMaksimum verbindingsMaksimum verbindings per gasheerMaksimum lengte vir 'n prent se lêernaamMaksimum lengte vir 'n prent-etiketMaksimum aantal gelyktydige verbindings aan 'n spesifieke gasheer.Maksimum aantal gelyktydige verbindings.Maksimum aantal inskrywingsMaksimum aantal inskrywings in die globale geskiedenis.Die maksimum aantal eweknieë om aan te vraMaksimumpoortGeheuekasKeuses vir geheuekas.Kasgrootte (in grepe).MinimumpoortVermisde fragmentNNTPNNTP- en nuusspesifieke keuses.NaamMoet 'n aksie kies.Volgende oortjieVol~gende oortjieN~ooit vir hierdie werf nieGeen URLGeen kleure (mono)Geen inhoudGeen dokumentGeen uitbreidings'%s' tref nêrens verder nie.Geen kopinligting.Geen geskiedenisGeen skakel gekies nieGeen skakels in die huidige dokument nieGeen vorige soektog nieGeen titelNormale soektogNoorsNiks om te skuif nieAantalGetal is verwag in die veldSyferknoppies kies skakelsNommer skakelsGetal moet in die omvang van %d tot %d wees.RegsoSlegs plaaslike verbindings word toegelaatOpen 'n nuwe oortjieOpen 'n nuwe agtergrondoortjieOpen 'n nuwe vensterOpen magtigingbestuurderOpen in nuwe ~agtergrondoortjieOpen in nuwe ~oortjieOpen in nuwe ~vensterOpen in eksterne ~redigeerderMaak nuwe oortjie oop in die agtergron~dOpen nuwe ~oortjieOpen die huidige skakel in 'n nuwe oortjieOpen die huidige skakel in 'n nuwe agtergrondoortjieOpen die huidige skakel in 'n nuwe vensterOpen nuwe ~vensterKeusebestuurderKeusesKeuses oor hoe om CSS te gebruik vir stilering van dokumente.Keuses aangaandie die vertoon van gewone teksblaaie.Keuses vir die hantering van prente.Keuses vir die hantering van skakels na ander dokumente.Keuses vir die hantering van vorminteraksie.Keuses vir inligtinglêers in ~/.elinks.Keuses vir soek.Keuses vir die aktiewe skakel.Keuses aangaande die aflaai en hantering van lêers.Keuses is suksesvol gestuur na keuselêer %s.Onvoldoende geheueParanoïese sekuriteitStuur skakel-URI aan ~eksterne opdragStuur oortjie se URI na ~eksterke opdragWagwoordWagwoordveldPadEweknieëDeleBeleidPoolsPoortomvangPoortomvang waarop geluister mag word.PortugeesDruk spasie om hierdie gids te laat oopvou.Vorige oortjieVo~rige oortjieProgram ('%' sal vervang word met die lêernaam)ProtokolProtokolspesifieke keuses.ProtokolleInstaan-URLInstaanmagtigingswagwoordInstaanmagtigingsgebruikernaamInstaanbedieneropstellingLeesfoutHet ontvangAanstuurVerwysingsSoektog met reguliere uitdrukkingReguliere uitdrukkings~Herlaai dokumentVersoek moet herbegin wordVersoek gestuurHerstoorHerstel vormStel t~erminaalgrootte~HulpbroninligtingHulpbronneHervatRomeensRussiesSSLSSL-foutSSL-onderhandelingSSL-keuses.StoorStoor URLStoor URL asStoor UR~L asFout met stoorStoor gidstoestandStoorintervalStoor keusesStoor na lêerGestoorde sessieStoorStoo~rStoor ge~formatteerde teks~Stoor onder die alternatiewe naamSoekDeursoek geskiedenisSoek agteruitDeursoek boekmerkeSoek vir teksDeursoek geskiedenisSoektog het onderkant bereik, gaan nou bo aan.Soektog het bokant bereik, gaan nou onder aan.Soekstring '%s' nie gevind nieSoek ~agtertoeSoekStuur Accept-Language-kopStuur Accept-Language-kop.SkeierSerwiesBedienerBediener hanteer versoekBedienernaamStel venstertitelSkaduDeelMoet hierdie aanmelding onthou word? Let wel: die wagwoord sal in 'n obskure (maar ongeënkripteerde) formaat gestoor word in 'n lêer op u skyf. Indien u 'n kosbare wagwoord gebruik, antwoord NEE.Wys vormgeskiedenisbestuurderWys ~kopGrootteSlowaaksJammer, maar kasitem "%s" kan nie geskrap word nie.Jammer, maar kasitem "%s" word deur iets anders gebruik.Jammer, maar koekie "%s" kan nie geskrap word nie.Jammer, maar koekie "%s" word deur iets anders gebruik.Jammer, maar koekiedomein "%s" kan nie geskrap word nie.Jammer, maar koekiedomein "%s" word deur iets anders gebruik.Jammer, maar aflaai "%s" kan nie onderbreek word nie.Jammer, maar aflaai "%s" word deur iets anders gebruik.Jammer, maar die geskiedenisitem "%s" kan nie geskrap word nie.Jammer, maar die geskiedenisitem "%s" word deur iets anders gebruik.Jammer, maar die boekmerk "%s" kan nie geskrap word nie.Jammer, maar die boekmerk "%s" word deur iets anders gebruik.Jammer, maar die gids "%s" kan nie geskrap word nie.Jammer, maar die gids "%s" word deur iets anders gebruik.Jammer, maar die item "%s" kan nie geskrap word nie.Jammer, maar die item "%s" word deur iets anders gebruik.Sorteer inskrywingsSpaansSpesiaalSpoedStandaardStatusStatistiekStatusStringIndien-knoppieDien vorm in en maak in nuwe ~agtergrondoortjie oopDien vorm in en maak in nuwe ~oorjtie oopDien vorm in en maak in nuwe ~venster oopDien vorm in en herl~aaiDien vorm in en laai afDien vorm outomaties inSwerminligtingSweedsStelselTerminaalkeusesTerminaalkeuses.TerminaleTeksTeks-WWW-blaaierTeksareaTekskleurTeksveldTeksveldteksDie BitTorrent-meta-inligtinglêer het foute bevatDie URL wat u nou gaan volg is dalk kwaadwilliglik saamgestel om u te verwar. As u die URL volg, sal u verbind aan rekenaar "%s" as gebruiker "%s". Wil u gaan na URL %s?Die lêer sal met die program '%s' oopgemaak word.Die vormdata wat u nou gaan instuur is dalk onvolledig. Wil u aan URL %s instuur?Die sleutel "%s" word tans gebruik vir "%s". Is u seker u wil dit vervang?Die maksimumpoort waarop geluister kan word.Die minimumpoort waarop geluister kan word.Hierdie lêer bestaan reeds: %s Die alternatiewe lêernaam is: %sHierdie keuse kan nie gewysig word nie. Dit beteken dat hierdie 'n spesiale keuse is, soos 'n gids - probeer spasie om die inhoud te sien.Hierdie weergawe van ELinks bevat nie SSL/TLS-ondersteuning nieTitelWissel die vertoon van skakelnommersWissel die vertoon van skakels na prenteWissel ~prenteWissel ~dokumentkleureWissel ~skakelnommersOordrag gefaalDra oorDeursigtigheidTurksSoortT~wtermURI-oordragURLURL-protokol nie ondersteun nie (%s).OekraïensKon nie %s kry nieOnderstreepOnderstreep skakelsOnderstreep skakels.Onderstreep die aktiewe skakel.OnbekendOnbekende foutOnbekende lêertipeOnbekende soortNaamloosOplaaiGebruik: elinks [KEUSE]... [URL]...Gebruik HTTP/1.0Gebruik HTTP/1.0-protokol in plaas van HTTP/1.1.Gebruik koppelvlaktaal as Accept-LanguageGebruik kleure gespesifiseer in die dokumentGebruik TABINDEXNuttelose knoppieGebruikerkoppelvlakKeuses oor die gebruikerkoppevlak.Identifiseer gebruikeragentGebruikernaamWaardeBekykprogramKleur van besoekte skakels~Bekyk prentWag vir direkte bevestigingWagtend in touWaarsku oor kwaadwillig gevormde URI'sWaarskuwingWelkomWelkom by ELinks! Druk ESC vir die kieslys. Dokumentasie is beskikbaar in die Hulp-kieslys.Wat om in die globalegeskiedenisdialoog te wys: 0 is URL'e 1 is bladsytitelsHoe gemaak?Wat wil u doen met die lêer '%s' (soort: %s%s%s)?Wat wil u doen met die lêer '%s'?Of 'n digitale horlosie in die statusbalk vertoon moet word.Of gidsinskrywings gesorteer moet word.Of asinchrone DSN gebruik moet word.WydteKeuseskryfsukses[0|1]met afsluitinggemiddeldgemiddelde spoedgemtanshuidige spoedafgelaaityd verbygeskatte tydignoreer bedienerinstellingonvolledigongeldigmeesterterminaalgewysignaamneegeenvangedeeltelikdruk %s om te wysigdruk %s om te navigeerdruk %s om in te stuur aan %sdruk %s om in te stuur aan %sleesalleenslaafterminaalspoedegte kleuropgelaaigeldigwaardeja~Staak~Aangaande~Aanvaar~Voeg byVoeg skakel by ~boekmerke~Magtiging~Agtergrond~BeOS-terminaal~Boekmerk~Boekmerke~Foute-inligting~Kas~Kanseleer~Sluit oortjie~Kopiëring~Skrap~Vertoon~Moet nie meer wys nie~Dokumentasie~Laai skakel af~Afgelaai~ELinks-tuisblad~Redigeer~Lêer~Volg skakel~Vormgeskiedenis~Volle skerm~Gaan na URL~Gaan na~HulpGe~skiedenis~InfoKortpa~dbestuurder~Sleutels~Taal~SkakelMeld aan~Wysig~Skuif~NeeRegs~o~OpenKe~usebestuurder~Oorskryf die oorspronklike naam~Stuur raam se URI na eksterne opdrag~Keur af~Herlaai~Teken dokument oor~Herstel vorm~Hervat die aflaai van die oorspronklike lêer~Stoor as~Stoor keusesSoe~k~Opstelling~Dien vorm inT~erminaalkeuses~Wissel vertoonstyl~Nutsgoed~Toekoms~BekykWissel ~teksomvouing~Xterm~JaPK01]ҒLC_MESSAGES/grep.monu[xy{(0Pbs[]p,%"?V"f    '(standard input)Binary file %s matches Memory exhaustedUnknown system errorUsage: %s [OPTION]... PATTERN [FILE]... `conflicting matchers specifiedinput is too large to countinvalid context length argumentinvalid max countmemory exhaustedrecursive directory loopunknown binary-files typeunknown devices methodProject-Id-Version: grep 2.5g Report-Msgid-Bugs-To: bug-grep@gnu.org POT-Creation-Date: 2017-07-02 13:21-0700 PO-Revision-Date: 2004-03-03 13:33+0200 Last-Translator: Petri Jooste Language-Team: Afrikaans Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=iso-8859-1 Content-Transfer-Encoding: 8bit X-Bugs: Report translation errors to the Language-Team address. '(standaardtoevoer)Binre ler %s pas Geheue uitgeputOnbekende stelselfoutGebruik so: %s [OPSIE]... PATROON [LER]... 'teenstrydige passers is gespesifiseertoevoer is te veel om te telongeldige konteks-lengte-parameterongeldige maks-tellinggeheue uitgeputrekursiewe lus van gidsinskrywingsonbekende binre-lertipeonbekende metode vir toestellePK01]ۍy)LC_MESSAGES/sysstat.monu[%P)Q){ ".-5'c-'8 F#a+ G_d|j ~ $ $9 ^ %h + 3 3 4C @x  (  @ W ,w 0  ie,L"    -f and -o options are mutually exclusive -x and -p options are mutually exclusive Average:Cannot append data to that file Cannot handle so many processors! Cannot open %s: %s Cannot write data to system activity file: %s Cannot write system activity file header: %s End of system activity file unexpected Error while reading system activity file: %s Invalid data format Invalid system activity file: %s (%#x) Not an SMP machine... Not reading from a system activity file (use -f option) Not that many processors! Requested activities not available Requested activities not available in file Time: %s Usage: %s [ options... ] [ [ ] ] Options are: [ -A ] [ -b ] [ -B ] [ -c ] [ -C ] [ -d ] [ -i ] [ -p ] [ -q ] [ -r ] [ -R ] [ -t ] [ -u ] [ -v ] [ -V ] [ -w ] [ -W ] [ -y ] [ -I { | SUM | ALL | XALL } ] [ -P { | ALL } ] [ -n { DEV | EDEV | NFS | NFSD | SOCK | ALL } ] [ -o [ ] | -f [ ] ] [ -s [ ] ] [ -e [ ] ] Usage: %s [ options... ] [ [ ] ] Options are: [ -C ] [ -d ] [ -I ] [ -r ] [ -t ] [ -u ] [ -V ] [ -w ] [ -p { | SELF | ALL } ] [ -T { TASK | CHILD | ALL } ] Usage: %s [ options... ] [ [ ] ] Options are: [ -P { | ALL } ] [ -V ] Usage: %s [ options... ] [ [ ] ] Options are: [ -c ] [ -d ] [ -N ] [ -n ] [ -k | -m ] [ -t ] [ -V ] [ -x ] [ [ ... ] | ALL ] [ -p [ | ALL ] ] Usage: %s [ options... ] [ [ ] ] [ ] Options are: [ -d | -D | -H | -p | -x ] [ -t ] [ -V ] [ -P { | ALL } ] [ -s [ ] ] [ -e [ ] ] [ -- ] Usage: %s [ options... ] [ [ ] ] [ ] Options are: [ -C ] [ -d ] [ -F ] [ -I ] [ -V ] sysstat version %s Project-Id-Version: sysstat 3.0 Report-Msgid-Bugs-To: sysstat orange.fr POT-Creation-Date: 2007-12-19 14:02+0100 PO-Revision-Date: 2000-01-12 20:17 Last-Translator: Gert Brits Language-Team: LANGUAGE X-Bugs: Report translation errors to the Language-Team address. MIME-Version: 1.0 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 8bit Opsies -f en -o is beide uitgesluit Opsies -x en -p is beide uitgesluit Gemideld:Kan nie data byskryf by die file nie Kan nie soveel proseseerders hanteer nie ! Probleem met oopmaak van %s: %s Probleem met skryf van sisteem aktiviteit leer: %s Probleem met skryf van sisteem aktiviteit hoof: %s Einde van sisteem aktiviteit leer onbeplan geeindig Probleem gekry met die lees van die sisteem aktiviteit leer: %s Verkeerde data formaat Ongemagtige aktiviteit proses: %s (%#x) Nie 'n SMP rekenaar nie... Kan nie van sisteem aktiviteit leer lees nie (gebruik opsie -f) Nie soveel proseseerders nie ! Aangevraagte aktiviteite nie beskikbaar nie Aangevraagte data is nie beskikbaar in leer nie Tyd: %s Gebruik: %s [ opsies... ] [ [ ] ] Opsies moontlik: [ -A ] [ -b ] [ -B ] [ -c ] [ -C ] [ -d ] [ -i ] [ -p ] [ -q ] [ -r ] [ -R ] [ -t ] [ -u ] [ -v ] [ -V ] [ -w ] [ -W ] [ -y ] [ -I { | SUM | ALL | XALL } ] [ -P { | ALL } ] [ -n { DEV | EDEV | NFS | NFSD | SOCK | ALL } ] [ -o [ ] | -f [ ] ] [ -s [ ] ] [ -e [ ] ] Gebruik: %s [ opsies... ] [ [ ] ] Opsies moontlik: [ -C ] [ -d ] [ -I ] [ -r ] [ -t ] [ -u ] [ -V ] [ -w ] [ -p { | SELF | ALL } ] [ -T { TASK | CHILD | ALL } ] Gebruik: %s [ opsies... ] [ [ ] ] Opsies moontlik: [ -P { | ALL } ] [ -V ] Gebruik: %s [ opsies... ] [ [ ] ] Opsies moontlik: [ -c ] [ -d ] [ -N ] [ -n ] [ -k | -m ] [ -t ] [ -V ] [ -x ] [ [ ... ] | ALL ] [ -p [ | ALL ] ] Gebruik: %s [ opsies... ] [ [ ] ] [ ] Opsies moontlik: [ -d [ -D | -H | -p | -x ] [ -t ] [ -V ] [ -P { | ALL } ] [ -s [ ] ] [ -e [ ] ] [ -- ] Gebruik: %s [ opsies... ] [ [ ] ] [ ] Opsies moontlik: [ -C ] [ -d ] [ -F ] [ -I ] [ -V ] sysstat weergawe %s PK01]6Ƙ  LC_MESSAGES/Linux-PAM.monu[$,89Project-Id-Version: Linux-PAM Report-Msgid-Bugs-To: http://sourceforge.net/projects/pam POT-Creation-Date: 2018-05-18 12:58+0200 PO-Revision-Date: 2011-11-30 06:56-0500 Last-Translator: FULL NAME Language-Team: Afrikaans (http://www.transifex.com/projects/p/fedora/language/af/) Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=(n != 1); X-Generator: Zanata 3.8.3 PK01]uuLC_MESSAGES/iso_639-2.monu[  H I S X b g p x           *3;BJS\bix '.5 ; E O Zdlrz     ,7 =GOTZb r|   %  #+BJPX_e nx~   #+19AGMSZ_gov}     #(1 :F NX`iz        " ( 3=O V`imrx     *4=E NY _kt}      # - 9 DNafnv |!     )2; B P ]g nx      $ * 6@ HRX^fnOZ|#n{J20FL]53SMsb7a?Y'!%og=qNEH&$rx:"UAuDe( ,lm T\KG} 8)Q@C >hzP6dI^wjc[kvWBf<1~.9VX-` ;y*t /iR+4p_AbkhazianAfarAfrikaansAkanAlbanianAmharicApache languagesArabicAragoneseArmenianAssameseAustralian languagesAymaraAzerbaijaniBasqueBelarusianBengaliBislamaBosnianBretonBulgarianBurmeseCatalan; ValencianCherokeeChineseCopticCornishCorsicanCroatianCzechDanishDutch; FlemishEastern FrisianEgyptian (Ancient)EnglishEsperantoEstonianEweFangFantiFaroeseFijianFinnishFonFrenchGalicianGeorgianGermanGothicGuaraniGujaratiHausaHawaiianHebrewHereroHindiHungarianIcelandicIndonesianInuktitutInupiaqIrishItalianJapaneseJavaneseKannadaKashmiriKashubianKazakhKinyarwandaKoreanKurdishLaoLatinLatvianLimburgan; Limburger; LimburgishLingalaLithuanianLuxembourgish; LetzeburgeschMacedonianMalayMalayalamMalteseManxMaoriMarathiMayan languagesMongolianMultiple languagesNauruNdongaNepaliNorse, OldNorthern FrisianNorthern SamiNorwegianNorwegian Nynorsk; Nynorsk, NorwegianOriyaOromoPersianPolishPortugueseQuechuaReserved for local useRomanshRundiRussianSamoanSangoSanskritSardinianScotsSerbianShonaSicilianSign LanguagesSindhiSinhala; SinhaleseSlovakSlovenianSomaliSorbian languagesSotho, SouthernSouthern SamiSpanish; CastilianSundaneseSwahiliSwatiSwedishTagalogTajikTamilTatarTeluguThaiTibetanTokelauTsongaTswanaTurkishTurkmenTwiUgariticUighur; UyghurUkrainianUrduUzbekVendaVietnameseWalloonWelshWestern FrisianWolofXhosaYiddishYorubaZuluProject-Id-Version: iso_639-2 Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues POT-Creation-Date: 2018-01-17 22:10+0100 PO-Revision-Date: 2017-12-25 21:46+0000 Last-Translator: Chris Leonard Language-Team: Afrikaans Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=n != 1; X-Generator: Weblate 2.19-dev AbgasiesAfarAfrikaansAkanAlbaneesAmhariesApache-taleArabiesAragoneesArmeensAssameseAustraliese taleAymaraAzerbaidjansBaskiesBelo-RussiesBengaleesBislameesBosniesBretonsBulgaarsBurmeesKatalaansTjerokeesSjineesKoptiesKorniesKorsikaansKroatiesTsjeggiesDeensNederlandsOos-FriesEgipties (antiek)EngelsEsperantoEstlandsEweFangFantiFaroeesFidjiesFinsFonFransGalisiesGeorgiesDuitsGotiesGuaraniGoedjaratiHausaHawaisHebreeusHereroHindiHongaarsYslandsIndonesiesInnuïtiesInupiakIersItaliaansJapanneesJavaneesKannadaKasjmiriKasjoebiesKazakKinyarwandaKoreaansKoerdiesLaoLatynLettiesLimburgsLingaleesLitausLuxemburgsMasedoniesMaleisMalabaarsMalteesManxMaoriMarafiMajataleMongoolsVeelvuldige taleNauruNdongaNepaleesOud-NoorsNoord-FriesNoord-SamiNoorweegsNoorweegse NynorskOriaOromeesPersiesPoolsPortugeesQuechuaGereserveer vir plaaslike gebruikReto-RomaansRundiRussiesSamoaansSangroSanskritSardiniesSkotsSerwiesShonaSisiliaansGebaretaleSindhiSingaleesSlowaaksSloweensSomaliSorbiese taleSotho, Suid-Suid-SamiSpaansSoedaneesSwahiliSwatiSweedsTagalogTadjikistansTamilTartaarsTeloegoeThaiTibettaansTokelauTsongaTswanaTurksTurkmeensTwiOegaritiesOeigoersOekraïensOerdoeOezbekiesVendaViëtnameeswalloonseWalliesWes-FriesWolofXhosaJiddisjJoroebaZoeloePK01]6uXLC_MESSAGES/iso_3166-3.monu[ l '<R)d ak/  East TimorGerman Democratic RepublicJohnston IslandNetherlands AntillesSerbia and MontenegroSouthern RhodesiaUSSR, Union of Soviet Socialist RepublicsUpper Volta, Republic ofZaire, Republic ofProject-Id-Version: iso_3166-3 Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues POT-Creation-Date: 2018-01-17 22:10+0100 PO-Revision-Date: 2007-11-17 11:40+0200 Last-Translator: Friedel Wolff Language-Team: Afrikaans Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Oos-TimorDuitse Demokratiese RepubliekJohnston-EilandeNederlands-AntilleSerwië en MontenegroSuid-RhodesiëUSSR, Unie van Sowiët Sosialistiese RepubliekeBo-VoltaZaïrePK01]V@)m)mLC_MESSAGES/authselect.monu[{{JQbx|"-1!Sd-yD'V#k+2 )?iB&(#;$_P%"0>o-.! +/Aq 0!O<*+* "! ,D Aq ( $ !!"+!"N!$q! !!!!""7"O"d"#i"""#"""$#5;#%q##D#-#4$N$i$$$$$$ %#%>%[%u%"%%%-%& "&!C& e&&;&&&'S%'Xy'7' ( (&(;(S(i((((((2(2)ZJ)()()A)@9*Dz*?*1**1+\+<y+++1+-%,,S,,-,$,(,!-0=-(n-&-"-*-) ."6."Y.4|.'...&/ =/2^///'/)/0&-0#T0!x0,0)0,041(S11|1(1#1"1(2%G2$m2!2 2)2$2$3,C3/p3383(3/4*N4'y4*44!4& 5 15$R5)w5!5-5526#D6&h6!6&6!6 6#7?7)\7$7!7-7$7& 8"G8&j8&88'8+9',9'T9|9!9-969( :%I:%o:&:":/:,; <;6];;";;;0<7<L<7a<<<<)<,=)B=,l====#= >(>2E>)x>>>#>> ??0%?;V?4???AAvB }BBBBBBBBB B C+'C/SCCC6CMC$3DbXDD)D/E2EAEREdE#}EEEME,F"FFiF#yFFTF G-+G(YG)GG3G;G 1HRHiH~H@HHHII'I0>IoI IhI'J'@J-hJJ#J+JEJ0@K)qKKKKK'L0LLLdLLLLLLL%M&M0FM.wMMM'M?M&>NeNAwN0N9N$O@O\OrOO!OOOO" P0PIP"^PPP+PP'P#Q">QaQGQQQQ] RUjR:RR SS5SIS`SuS,S SS7S4TcLT.T(TNULWUPULU@BV4VVCV"W#8WB\W2W.W)X5+X&aX*X1X=X/#Y(SY&|Y0Y,Y$Z7&Z7^Z,Z#Z)Z&["8[/[[,[&[5[\'0\$X\!}\8\)\0]C3],w]1]&](]&&^0M^'~^&^ ^^' _)5_"__/_5__<`,B`+o`"`)`)`a).a(Xa!a&a)a$a4b$Nb-sb(b'b'b(c#Cc(gc%cc,c'd$*d/Od"d/d&d)d-#e!Qe1se-e)e,e"*fMf/mf6f-f)g*,g'Wg$g5g.g- h97hqh h hh2hi?i@Uiiii+i/j-?j-mjj j%j'j $k<1k)nk k"kk*kl4lKl+\lAl:l#m&f vRxNY7b):pnP("Uzi_BDS  AV^34T *-#E2KQ=%[?C+ruyFX /hk9{qH ,\J>8e06]L5sIg OG.aZ<m `}' jo@~tM W;1w| l$d!c %s Some unexpected changes to the configuration were detected. Use --force parameter if you want to overwrite these changes. None does not exist.%-*s (created at %s) %s %s update failed: %d- %s <0=Lock|1=Ignore>At least one option is required! Backup [%s] contains authselect configurationBackup [%s] contains non-authselect configurationBackup commands:Backup stored at %s Backup system files before activating profileBackup system files before activating profile (generate unique name)Backup was successfully created at [%s]Base new profile on a default profile even if vendor profile with the same name existsChanges were successfully applied. Check if the current configuration is validChecking if all required directories are writable.Command options:Common options:Common options: Comparing content against [%s]Comparing content against current profileCopying [%s] to [%s/%s]Create new authselect profileCreate new profile as a vendor profile instead of a custom profileCreating empty profile at [%s]Creating new profile from "%s" at [%s]Creating path [%s]Creating symbolic link [%s] to [%s]Creating temporary directory at [%s]Current configuration is not valid. It was probably modified outside authselect.Current configuration is valid.Dconf is not installed on your systemDefault profile can not be createdDirectory [%s] does not exist, please create it!Directory [%s] is missing!Disable feature in currently selected profileDo not backup system files when --force is setDo not print profile requirementsEnabled features:Enforce changesEnforcing activation!Error while trying to access file [%s] [%d]: %sFeature to disable.Feature to enable.File %s: %s File %s: Empty File [%s] does not existFile [%s] exists but it needs to be overwritten!File [%s] is bigger than %uKiB!File [%s] is still presentFile [%s] should exist but is missing. It is not safe to delete [%s]. Aborting.File [%s] was modified outside authselect!File that needs to be overwritten was foundFound default selinux context for [%s]: %sFound profile [%s]Found selinux context for [%s]: %sGet identifier of currently selected profileID of a profile that should be used as a base for the new profileInternal error: filepath cannot be NULL!Internal error: stat cannot be NULL!Invalid operator!Invalid option %s: %s Kerberos authentication by defaultLDAP for authentication by defaultLDAP for user information by defaultLink [%s] does not point to [%s]Link [%s] points to [%s]List available backupsList available profile featuresList available profilesLocations array is NULLLooking up profile [%s]Missing option: %s NAMENIS for user information by defaultName can not be emptyName of the backup to remove.Name of the backup to restore from.New profile name.New profile was created at %s No existing configuration detected. Omitting [%s] since it does not exist in base profileOnly one free argument is expected! Out of memory!Print backup names without any formatting and additional informationPrint changes that would be otherwise writtenPrint command parameters instead of formatted outputPrint content of all filesPrint dconf database contentPrint dconf lock contentPrint error messagesPrint fingerprint-auth contentPrint nsswitch.conf contentPrint password-auth contentPrint postlogin contentPrint profile requirementsPrint smartcard-auth contentPrint system-auth contentPrint trace messagesProfile "%s" already exist at [%s]Profile "%s" was selected. Profile ID: %s Profile [%s] does not contain a name in [%s]!Profile [%s] found at [%s]Profile [%s] is a custom profileProfile [%s] is a default profileProfile [%s] is a vendor profileProfile [%s] was not foundProfile feature [%s] is no longer supported, removing it...Profile identifier.Reading file [%s/%s]Reading profile directory [%s]Refusing to activate profile unless this file is removed or overwrite is requested.Refusing to activate profile unless those changes are removed or overwrite is requested.Regenerate configuration for currently selected commandRemove backupRemoving [%s]Removing backup [%s]Removing directory [%s]Removing file [%s/%s]Renaming [%s] to [%s]Restore from backupRestoring configuration from backup [%s]Select profileShow profile informationSkipping [%s] because it is not an authselect fileSome directories are not accessible by authselect!Some unexpected changes to the configuration were detected. Use 'select' command instead. Symbolic link [%s] to [%s] still exists!Symbolic links were successfully removedSymlink dconf files from the base profile instead of copying themSymlink meta files from the base profile instead of copying themSymlink nsswitch files from the base profile instead of copying themSymlink pam files from the base profile instead of copying themSymlink specific file (can be set multiple times)System was not configured with authselect.Temporary file is named [%s]The following nsswitch maps are overwritten by the profile: There is no filename in [%s]Trying to activate profile [%s]Trying to backup authselect configuration to [%s]Trying to backup system configuration to [%s]Trying to uninstall authselect configurationUnable to access [%s] [%d]: %sUnable to access directory [%s] in [WX] mode!Unable to activate profile [%d]: %s Unable to activate profile [%s] [%d]: %sUnable to apply changes [%d]: %s Unable to backup current configuration [%d]: %s Unable to backup current configuration! Unable to check configuration [%d]: %sUnable to check file [%s] [%d]: %sUnable to check file mode of [%s] [%d]: %sUnable to check presence of [%s] [%d]: %sUnable to chmod file [%s] [%d]: %sUnable to chown file [%s] [%d]: %sUnable to compile regular expression: regex error %dUnable to copy [%s] to [%s/%s] [%d]: %sUnable to copy files [%d]: %sUnable to create [%s] [%d]: %sUnable to create array (out of memory)Unable to create backup [%d]: %sUnable to create backup directory [%s/%s] [%d]: %sUnable to create backup directory [%s] [%d]: %sUnable to create empty profile [%d]: %sUnable to create file name: out of memoryUnable to create message!Unable to create new profile [%d]: %s Unable to create path [%s] [%d]: %sUnable to create profile [%d]: %sUnable to create profile path: out of memoryUnable to create selabel context [%d]: %sUnable to create symbolic link [%s] [%d]: %sUnable to create symbolic link [%s] to [%s] [%d]: %sUnable to create symbolic links [%d]: %sUnable to create temporary file for [%s] [%d]: %sUnable to delete directory [%s] [%d]: %sUnable to disable feature [%d]: %s Unable to enable feature [%d]: %s Unable to find new match: regex error %dUnable to find nsswitch maps [%d]: %sUnable to find profile [%s] [%d]: %sUnable to generate files [%d]: %sUnable to generate nsswitch.confUnable to generate nsswitch.conf [%d]: %sUnable to generate template [%d]: %sUnable to get basename of [%s]Unable to get current configuration [%d]: %sUnable to get current fscreate selinux context!Unable to get current time!Unable to get default selinux context for [%s] [%d]: %s!Unable to get generated content [%d]: %sUnable to get parent directory of [%s] [%d]: %sUnable to get path to %s parent directory!Unable to get profile features [%d]: %sUnable to get profile information [%d]: %sUnable to get profile list!Unable to list available backups!Unable to list directory [%s] [%d]: %sUnable to list profiles [%d]: %sUnable to load profile [%s] [%d]: %sUnable to lookup selinux context [%d]: %sUnable to make path [%s] [%d]: %sUnable to obtain feature list (out of memory)Unable to obtain nsswitch maps!Unable to obtain selinux context for [%s] [%d]: %sUnable to obtain supported featuresUnable to open directory [%s] [%d]: %sUnable to open file [%s] [%d]: %sUnable to overwrite file [%s] [%d]: %sUnable to parse command argumentsUnable to process match [%d]: %sUnable to process operator [%d]: %sUnable to read [%s] [%d]: %sUnable to read base profile [%s] [%d]: %sUnable to read file [%s/%s] [%d]: %sUnable to read file [%s] [%d]: %sUnable to read link destination [%s] [%d]: %sUnable to read profile requirements!Unable to remove backup [%s] [%d]: %s Unable to remove symlinks [%d]: %sUnable to rename [%s] to [%s] [%d]: %sUnable to resolve symbolic links namesUnable to restore [%s] [%d]: %sUnable to restore backup [%s] [%d]: %s Unable to restore fscreate selinux context!Unable to search string: regex error %dUnable to set fscreate selinux context!Unable to stat [%s] [%d]: %sUnable to stat directory [%d]: %sUnable to test current configuration [%d]: %sUnable to uninstall authselect configuration [%d]: %s Unable to update dconf database [%d]: %sUnable to validate file [%s] [%d]: %sUnable to validate link [%s] [%d]: %sUnable to write configuration [%d]: %sUnable to write data [%s] [%d]: %sUnable to write generated system files [%d]: %sUnable to write temporary file [%s] [%d]: %sUnable to write to [%s] [%d]: %sUnexpected changes to the configuration were detected.Unexpected parameter: %s Uninstall authselect configurationUnknown file name [%s]Unknown profile feature [%s]Unknown profile feature [%s], did you mean [%s]?Validating file [%s]Validating link [%s]Value AUTHSELECT_PROFILE_ANY is invalid in this contextWriting temporary file for [%s][%s] does not exist![%s] has unexpected content![%s] has wrong group [%u], expected [%u]![%s] has wrong mode [%.4o], expected [%.4o]![%s] has wrong owner [%u], expected [%u]![%s] has wrong type [%.7o], expected [%.7o]![%s] is not a directory![%s] is not a regular file![%s] is not a symbolic link![%s] was not created by authselect![OPTIONS...]action to be taken on smart card removalauthentication with fingerprint readers by defaultauthentication with smart card by defaultautomatic per-user ecryptfsdefault LDAP base DNdefault LDAP server hostname or URIdefault NIS domaindefault NIS servernot setrequire smart card for authentication by defaultuse of RFC-2307bis schema for LDAP user information lookupsuse of TLS for identity lookups with LDAP (RFC-2830)use of TLS with LDAP (RFC-2830)Project-Id-Version: authselect 1.2.5 Report-Msgid-Bugs-To: https://github.com/authselect/authselect POT-Creation-Date: 2022-12-01 13:40+0100 PO-Revision-Date: 2023-08-01 12:17+0000 Last-Translator: Dewald Gerber Language-Team: Afrikaans Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=n != 1; X-Generator: Weblate 4.18.2 %s Enkele onverwagte veranderinge aan die konfigurasie is opgemerk. Gebruik --force parameter as u hierdie veranderinge wil oorskryf. Geen bestaan nie.%-*s (geskep by %s) %s %s se opdatering het misluk: %d-%s <0=Sluit|1=Ignoreer>AdministrateurTen minste een opsie is nodig! Rugsteun [%s] bevat authselect-konfigurasieRugsteun [%s] bevat non-authselect-konfigurasieRugsteun opdragte:Rugsteun gestoor by %s Rugsteun stelsellêers voordat profiel geaktiveer wordRugsteun stelsellêers voordat profiel geaktiveer word (genereer unieke naam)Rugsteun is suksesvol gemaak by [%s]Baseer nuwe profiel op 'n standaardprofiel, selfs al bestaan 'n verkoperprofiel met dieselfde naamVeranderinge was suksesvol. Kyk of die huidige konfigurasie geldig isInspekteer of alle nodige adresse skryfbaar is.Opdrag keuses:Algemene keuses:Algemene opsies: Vergelyk inhoud met [%s]Vergelyk inhoud met huidige profielKopieer tans [%s] na [%s/%s]Skep 'n nuwe authselect-profielSkep nuwe profiel as 'n verskafferprofiel in plaas van 'n pasgemaakte profielSkep leë profiel by [%s]Skep nuwe profiel met "%s" by [%s]Skep adres [%s]Skep simboliese skakel [%s] na [%s]Skep tydelike adres [%s]Huidige konfigurasie is nie geldig nie. Dit is waarskynlik buite authselect gewysig.Huidige konfigurasie is geldig.Dconf is nie op jou stelsel geïnstalleer nieStandaardprofiel kan nie geskep word nieAdres %s bestaan nie, skep dit asseblief!Adres [%s] ontbreek!Deaktifeer funksie in huidige geselekteerde profielMoenie stelsellêers rugsteun wanneer --force gestel is nieMoenie profielvereistes druk nieGeaktiveerde funksies:Forseer veranderingeAktivering geforseer!Fout tydens die poging om toegang tot lêer [%s] [%d] te kry: %sFunksie om te deaktiveer.Kenmerk om te aktiveer.Lêer %s: %s Lêer %s: leeg Lêer [%s] bestaan nieLêer [%s] bestaan, maar dit moet oorskryf word!Lêer [%s] is groter as %uKiB!Lêer [%s] is steeds teenwoordigLêer [%s] behoort te bestaan maar ontbreek. Dit is nie veilig om [%s] uit te vee nie. Staak transaksie.Lêer [%s] is buite authselect gewysig!Lêer wat oorskryf moet word, is gevindStandaard selinux-konteks gevind vir [%s]: %sProfiel gevind [%s]Selinux-konteks gevind vir [%s]: %sKry identifiseerder van die huidige profielID van 'n profiel wat as basis vir die nuwe profiel gebruik moet wordInterne fout: lêer adres kan nie NULL wees nie!Interne fout: stat kan nie NULL wees nie!Ongeldige operator!Ongeldige opsie %s: %s Kerberos-verifikasie by verstekLDAP vir verifikasie by verstekLDAP vir gebruikersinligting by verstekSkakel [%s] wys nie na [%s]Skakel [%s] wys na [%s]Lys beskikbare argiefkopieëLys beskikbare profielkenmerkeLys beskikbare profieleLiggingsreeks is NULLSoek profiel [%s] opOntbrekende opsie: %s NAAMNIS vir gebruikersinligting standaardNaam kan nie oningevul wees nieNaam van die argiefkopie wat verwyder moet word.Naam van die argiefkopie om van te restoureer.Nuwe profielnaam.Nuwe profiel is geskep by %s Geen bestaande opstelling bespeur nie. Los [%s] uit aangesien dit nie in die basis profiel bestaan nieSlegs een vrye argument word verwag! Geheue opgebruik!Druk rugsteunname sonder enige formatering en bykomende inligtingDruk veranderinge wat andersins geskryf sou wordDruk opdragparameters in plaas van geformateerde leweringDruk inhoud van alle lêersDruk dconf databasis inhoudDruk dconf-slotinhoudDruk foutboodskappeDruk vingerafdruk-auth-inhoudDruk die inhoud van nsswitch.confDruk wagwoord-auth inhoudDruk postlogin-inhoudDruk profiel vereistesDruk slimkaart-bekragtiging inhoudDruk stelsel-auth inhoudDruk spoorboodskappeProfiel "%s" bestaan reeds by [%s]Profiel "%s" is gekies. Profiel-ID: %s Profiel [%s] bevat nie 'n naam in [%s] nie!Profiel [%s] gevind by [%s]Profiel [%s] is 'n doelgemaakte profielProfiel [%s] is 'n standaardprofielProfiel [%s] is 'n verkoperprofielProfiel [%s] is nie gevind nieProfieleienskap [%s] word nie meer gebruik nie, en dit word verwyder...Profiel identifiseerder.Lees lêer [%s/%s]Lees profiel adres [%s]Weiering om profiel te aktiveer tensy hierdie lêer verwyder word of vervanging versoek word.Weier om profiel te aktiveer, tensy die veranderinge verwyder word of geforseer word.Hergenereer konfigurasie vir tans geselekteerde instruksieVerwyder argiefkopieVerwyder [%s]Verwyder rugsteun [%s]Verwyder adres [%s]Verwyder lêer [%s/%s]Hernoem [%s] na [%s]Restoureer met argiefkopieHerstel van konfigurasie vanaf rugsteun [%s]Kies profielWys profielinligtingSlaan [%s] oor omdat dit nie 'n authselect-lêer is nieParty adresse is nie toeganklik deur authselect nie!Paar onverwagte veranderinge aan die konfigurasie is opgemerk. Gebruik eerder 'select' instruksie. Simboliese skakel [%s] na [%s] bestaan steeds!Simboliese skakels is suksesvol verwyderSymlink dconf-lêers vanaf die basisprofiel in plaas daarvan om dit te kopieerSymlink-metalêers vanaf die basisprofiel in plaas daarvan om dit te kopieerSymlink-nsswitchlêers vanaf die basisprofiel in plaas daarvan om dit te kopieerSymlink pam-lêers vanaf die basisprofiel in plaas daarvan om dit te kopieerSymlink spesifieke lêer (kan verskeie kere geimplementeer word)Die stelsel is nie met authselect gekonfigureer nie.Tydelike lêer heet [%s]Die volgende nsswitch-adrestabel word deur die profiel oorgeskryf: Daar is geen lêernaam in [%s] nieProbeer om profiel [%s] te aktiveerProbeer om 'n rugsteun van authselect-konfigurasie na [%s] te maakProbeer om stelselkonfigurasie na [%s] te rugsteunProbeer om authselect-konfigurasie te verwyderKan nie toegang tot [%s] [%d] kry nie: %sKan nie toegang tot adres [%s] in [WX]-modus kry nie!Kan nie profiel [%d] aktiveer nie: %s Kan nie profiel [%s] [%d] aktiveer nie: %sKan nie veranderinge, [%d], implementeer nie: %s Kan nie huidige konfigurasie, [%d], argiefkopie maak nie: %s Kan nie die huidige konfigurasie rugsteun nie! Kan nie konfigurasie [%d] nagaan nie: %sKan nie lêer [%s] [%d] nagaan nie: %sKan nie modus van lêer [%s] [%d] nagaan nie: %sKan nie vasstel of [%s] [%d] daar is nie: %sKan nie lêer [%s][%d] chmod nie: %sKan nie lêer [%s] [%d] se eienaarskap verander nie: %sKan nie gewone uitdrukking kompileer nie: regex-fout %dKan nie [%s] na [%s/%s] [%d] kopieer nie: %sKan nie lêers [%d] kopieer nie: %sNie moontlik om [%s] [%d] te skep nie: %sKan nie reeks skep nie (te min geheue)Kan nie rugsteun [%d] skep nie: %sKan nie rugsteunadres skep nie [%s/%s] [%d]: %sKan nie rugsteunadres skep nie [%s] [%d]: %sKan nie leë profiel [%d] skep nie: %sKan nie lêernaam skep nie: geheue te vol of te kleinKan nie boodskap skep nie!Kan nie nuwe profiel skep nie [%d]: %s Kan nie adres [%s] [%d] skep nie: %sKan nie profiel [%d] skep nie: %sKan nie profieladres skep nie: geheue te vol of te kleinKan nie selabel-konteks skep nie [%d]: %sKan nie simboliese skakel [%s] [%d] skep nie: %sNie in staat om simboliese skakel [%s] na [%s] [%d] te skep nie: %sKan nie simboliese skakels [%d] skep nie: %sKan nie tydelike lêer vir [%s] [%d] skep nie: %sKan nie adres [%s] [%d] uitvee nie: %sKan nie funksie [%d] deaktiveer nie: %s Kan nie funksie [%d] aktiveer nie: %s Kan nie nuwe vergelyking vind nie: regex-fout %dKan nie nsswitch-maps vind nie [%d]: %sKan nie profiel [%s] [%d] vind nie: %sKan nie lêers skep nie [%d]: %sKan nie nsswitch.conf skep nieKan nie nsswitch.conf [%d] skep nie: %sKan nie profielvorm [%d] genereer nie: %sKan nie basisnaam van [%s] kry nieKan nie huidige konfigurasie, [%d], kry nie: %sKan nie die huidige fscreate selinux-konteks kry nie!Kan nie huidige tyd kry nie!Kan nie standaard selinux-konteks vir [%s] [%d] kry nie: %s!Kan nie gegenereerde inhoud kry nie [%d]: %sKan nie oueradres van [%s] [%d] kry nie: %sKan nie moederadres na %s kry nie!Kan nie profielkenmerke, [%d] kry nie: %sKan nie profielinligting kry nie [%d]: %sKan nie profiellys kry nie!Kan nie beskikbare argiefkopieë lys nie!Kan nie inhoud van [%s] [%d] lys nie: %sKan nie profiel [%d] vind nie: %sKan nie profiel [%s] [%d] laai nie: %sKan nie selabel-konteks skep nie [%d]: %sKan nie adres [%s] [%d] skep nie: %sKan nie eienskaplys kry nie (geheue vol of te klein)Kan nie nsswitch-adrestabel kry nie!Kan nie selinux-konteks kry vir [%s] [%d]: %sKan nie ondersteunde funksies verkry nieKan nie adres [%s] [%d] oopmaak nie: %sKan nie lêer [%s] [%d] oopmaak nie: %sKan nie lêer [%s] [%d] oorskryf nie: %sKan nie beheerargumente ontleed nieKan nie vergelyking [%d] verwerk nie: %sKan nie operator [%d] verwerk nie: %sKan nie [%s] [%d] lees nie: %sKan nie basis profiel [%s] [%d] lees nie: %sKan nie lêer [%s/%s] [%d] lees nie: %sKan nie lêer [%s] [%d] lees nie: %sKan nie skakelbestemming [%s] [%d] lees nie: %sKan nie profielvereistes lees nie!Kan nie argiefkopie [%s] [%d] verwyder nie: %s Kan nie symlinks [%d] verwyder nie: %sKan nie [%s] hernoem na [%s] [%d] nie: %sKan nie simboliese skakels se name op los nieKan nie [%s] [%d] herstel nie: %sKan nie argiefkopie [%s] [%d] restoureer nie: %s Kan nie fscreate selinux-konteks herstel nie!Kan nie in string soek nie: regex-fout %dKan nie fscreate selinux konteks opstel nie!Kan nie [%s] [%d] verklaar nie: %sKan nie adres [%d] stat nie: %sKan nie huidige konfigurasie, [%d]toets nie: %sKan nie authselect-konfigurasie [%d] verwyder nie: %s Kan nie dconf-databasis [%d] opdateer nie: %sKan nie lêer [%s] [%d] bekragtig nie: %sKan nie skakel [%s] [%d] bekragtig nie: %sKan nie konfigurasie [%d] skryf nie: %sKan nie data [%s] [%d] skryf nie: %sKan nie gegenereerde stelsellêers [%d] skryf nie: %sKan nie tydelike lêer [%s] [%d] skryf nie: %sNie in staat om na [%s] [%d] te skryf nie: %sOnverwagte veranderinge aan die konfigurasie is opgemerk.Onverwagte parameter: %s Verwyder authselect-konfigurasieDie lêernaam, [%s], is onbekendOnbekende profielkenmerk [%s]Onbekende profielkenmerk [%s], het jy bedoel [%s]?Toets geldigheid van lêer [%s]Bekragtig skakel [%s]Waarde AUTHSELECT_PROFILE_ANY is ongeldig in hierdie konteks nieSkryf tydelike lêer vir [%s][%s] bestaan nie![%s] het onvoorsiene inhoud![%s] het verkeerde groep [%u], verwag [%u]![%s] het verkeerde modus [%.4o], verwag [%.4o]![%s] het verkeerde eienaar [%u], verwag [%u]![%s] is verkeerde tipe [%.7o], verwag [%.7o]![%s] is nie 'n adres nie![%s] is nie 'n gewone lêer nie![%s] is nie 'n simboliese skakel nie![%s] is nie deur authselect geskep nie![KEUSES ...]aksie wat geneem moet word met die verwydering van slimkaartstawing met vingerafdruklesers by verstekstawing met slimkaart by verstekoutomatiese ecryptfs per gebruikerstandaard LDAP-basis DNstandaard LDAP-bediener gasheernaam of URIstandaard NIS domeinstandaard NIS-bedienernie ingestel nievir verifikasie vereis slimkaart by verstekgebruik van RFC-2307bis-skema vir LDAP-gebruikerinligting-opsoekegebruik van TLS vir identiteitsopsoeke met LDAP (RFC-2830)gebruik van TLS met LDAP (RFC-2830)PK01] %LC_MESSAGES/policycoreutils.monu[,<P Q[ Password:Project-Id-Version: PACKAGE VERSION Report-Msgid-Bugs-To: POT-Creation-Date: 2023-02-15 12:35+0100 PO-Revision-Date: 2015-03-23 02:49-0400 Last-Translator: Copied by Zanata Language-Team: Afrikaans Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=(n != 1) X-Generator: Zanata 4.6.2 Wagwoord:PK01]dJVJVLC_MESSAGES/iso_3166-1.monu[ `! a!m!u!}!!!! !!! !!!! "" """*" 2"="F"N"V"]"c"k"r" z""" """"## !#.#6#?#H#O#^#w#|#######%# # #$$$$#$2$:$%I$,o$"$*$$$$%%3%;% A%M%_%g%o%x% %'%$%% &'&C&b&&&& &&&&&&&&& &'' #'-' 5'@' E'O'X' _'m't'!z''' '0''(%(4(O( U(_(y(~(((((( )&)-)>)D)L)R)Y) `)k)q))))))))* *1*F*X*l*}**&**** **+++&+.+ 4+ B+ L+,W++ +++++++ + + ++, ,,, ", -,8, @,K,S,[,a, g, s, , ,,,,,,,,,,,,-'-6-V-q- v------- --..,.@.T.k..".....//*/?/V/j/{//////00-0A0S0i0|0000000 1141F1[1n111111112$2;2O2c2u222222233'3>3W3m33333334&494P4d4v444 44455%585?5Q5Z5,l55 55 55 56 6*626 96 D6 Q6[6k6t6}666 6,6 66 7 77*797?7H7 _7i7p7 7777 7777 8 88#8+818E8M8 T8a8z888884888 9$)9N9g9 o9z9 999#9999::::%:::I: I<U<^<g<y<<< <<< <<<< < = ==&= .=9= B=N=V=]=c=l=t=}=== = ===>> >%>->6>?>F>V>t>z>> > > >>>)> > >>>? ?? )?3?%?V,)AqT5r`tD%^HNh_p^JmwcTp&9M'-rHJ8 A%yhZN -Fz  =lQiu9k u\m>L2MLIF\?Rog Yj+t|<R6(3!P*:) f4U;@_{].B&{@ }KWyXGvdv]zGiEO"['QE4s(B q*.s:~[w/ j/xl~6}7e$P0nS SCXUaaVoZ!#b$ #IK"g1fnW2,xOc0+1ebDCd73;<|`=k58YAfghanistanAlbaniaAlgeriaAmerican SamoaAndorraAngolaAnguillaAntarcticaAntigua and BarbudaArab Republic of EgyptArgentinaArgentine RepublicArmeniaArubaAustraliaAustriaAzerbaijanBahamasBahrainBangladeshBarbadosBelarusBelgiumBelizeBeninBermudaBhutanBoliviaBonaire, Sint Eustatius and SabaBosnia and HerzegovinaBotswanaBouvet IslandBrazilBritish Indian Ocean TerritoryBritish Virgin IslandsBrunei DarussalamBulgariaBurkina FasoBurundiCambodiaCameroonCanadaCayman IslandsCentral African RepublicChadChileChinaChristmas IslandCocos (Keeling) IslandsColombiaComorosCongoCongo, The Democratic Republic of theCook IslandsCosta RicaCroatiaCubaCuraçaoCyprusCzech RepublicCzechiaCôte d'IvoireDemocratic People's Republic of KoreaDemocratic Republic of Sao Tome and PrincipeDemocratic Republic of Timor-LesteDemocratic Socialist Republic of Sri LankaDenmarkDjiboutiDominicaDominican RepublicEastern Republic of UruguayEcuadorEgyptEl SalvadorEquatorial GuineaEritreaEstoniaEthiopiaFalkland Islands (Malvinas)Faroe IslandsFederal Democratic Republic of EthiopiaFederal Democratic Republic of NepalFederal Republic of GermanyFederal Republic of NigeriaFederal Republic of SomaliaFederated States of MicronesiaFederative Republic of BrazilFijiFinlandFranceFrench GuianaFrench PolynesiaFrench RepublicGabonGabonese RepublicGambiaGeorgiaGermanyGhanaGibraltarGrand Duchy of LuxembourgGreeceGreenlandGrenadaGuadeloupeGuamGuatemalaGuernseyGuineaGuinea-BissauGuyanaHaitiHeard Island and McDonald IslandsHoly See (Vatican City State)HondurasHong KongHong Kong Special Administrative Region of ChinaHungaryIcelandIndependent State of Papua New GuineaIndependent State of SamoaIndiaIndonesiaIran, Islamic Republic ofIraqIrelandIslamic Republic of AfghanistanIslamic Republic of IranIslamic Republic of MauritaniaIslamic Republic of PakistanIslamic Republic of the GambiaIsle of ManIsraelItalian RepublicItalyJamaicaJapanJerseyJordanKazakhstanKenyaKingdom of BahrainKingdom of BelgiumKingdom of BhutanKingdom of CambodiaKingdom of DenmarkKingdom of LesothoKingdom of MoroccoKingdom of NorwayKingdom of Saudi ArabiaKingdom of SpainKingdom of SwazilandKingdom of SwedenKingdom of ThailandKingdom of TongaKingdom of the NetherlandsKiribatiKorea, Democratic People's Republic ofKorea, Republic ofKuwaitKyrgyz RepublicKyrgyzstanLatviaLebanese RepublicLebanonLesothoLiberiaLibyaLiechtensteinLithuaniaLuxembourgMacao Special Administrative Region of ChinaMacedonia, Republic ofMadagascarMalawiMalaysiaMaldivesMaliMaltaMarshall IslandsMartiniqueMauritaniaMauritiusMayotteMexicoMoldovaMonacoMongoliaMontenegroMontserratMoroccoMozambiqueMyanmarNamibiaNauruNepalNetherlandsNew CaledoniaNew ZealandNicaraguaNigerNigeriaNiueNorfolk IslandNorthern Mariana IslandsNorwayOmanPakistanPalauPanamaPapua New GuineaParaguayPeople's Democratic Republic of AlgeriaPeople's Republic of BangladeshPeople's Republic of ChinaPeruPhilippinesPolandPortugalPortuguese RepublicPrincipality of AndorraPrincipality of LiechtensteinPrincipality of MonacoPuerto RicoQatarRepublic of AlbaniaRepublic of AngolaRepublic of ArmeniaRepublic of AustriaRepublic of AzerbaijanRepublic of BelarusRepublic of BeninRepublic of Bosnia and HerzegovinaRepublic of BotswanaRepublic of BulgariaRepublic of BurundiRepublic of CameroonRepublic of ChadRepublic of ChileRepublic of ColombiaRepublic of Costa RicaRepublic of CroatiaRepublic of CubaRepublic of CyprusRepublic of Côte d'IvoireRepublic of DjiboutiRepublic of EcuadorRepublic of El SalvadorRepublic of Equatorial GuineaRepublic of EstoniaRepublic of FijiRepublic of FinlandRepublic of GhanaRepublic of GuatemalaRepublic of GuineaRepublic of Guinea-BissauRepublic of GuyanaRepublic of HaitiRepublic of HondurasRepublic of IcelandRepublic of IndiaRepublic of IndonesiaRepublic of IraqRepublic of KazakhstanRepublic of KenyaRepublic of KiribatiRepublic of LatviaRepublic of LiberiaRepublic of LithuaniaRepublic of MadagascarRepublic of MalawiRepublic of MaldivesRepublic of MaliRepublic of MaltaRepublic of MauritiusRepublic of MoldovaRepublic of MozambiqueRepublic of MyanmarRepublic of NamibiaRepublic of NauruRepublic of NicaraguaRepublic of PalauRepublic of PanamaRepublic of ParaguayRepublic of PeruRepublic of PolandRepublic of San MarinoRepublic of SenegalRepublic of SerbiaRepublic of SeychellesRepublic of Sierra LeoneRepublic of SingaporeRepublic of SloveniaRepublic of South AfricaRepublic of South SudanRepublic of SurinameRepublic of TajikistanRepublic of Trinidad and TobagoRepublic of TunisiaRepublic of TurkeyRepublic of UgandaRepublic of UzbekistanRepublic of VanuatuRepublic of YemenRepublic of ZambiaRepublic of ZimbabweRepublic of the CongoRepublic of the Marshall IslandsRepublic of the NigerRepublic of the PhilippinesRepublic of the SudanRomaniaRussian FederationRwandaRwandese RepublicRéunionSaint BarthélemySaint Helena, Ascension and Tristan da CunhaSaint Kitts and NevisSaint LuciaSaint Pierre and MiquelonSaint Vincent and the GrenadinesSamoaSan MarinoSao Tome and PrincipeSaudi ArabiaSenegalSerbiaSeychellesSierra LeoneSingaporeSlovak RepublicSlovakiaSloveniaSocialist Republic of Viet NamSolomon IslandsSomaliaSouth AfricaSouth Georgia and the South Sandwich IslandsSouth SudanSpainSri LankaState of IsraelState of KuwaitState of QatarSudanSurinameSvalbard and Jan MayenSwazilandSwedenSwiss ConfederationSwitzerlandSyrian Arab RepublicTaiwanTaiwan, Province of ChinaTajikistanTanzaniaTanzania, United Republic ofThailandTimor-LesteTogoTogolese RepublicTokelauTongaTrinidad and TobagoTunisiaTurkeyTurkmenistanTurks and Caicos IslandsTuvaluUgandaUkraineUnited Arab EmiratesUnited KingdomUnited Kingdom of Great Britain and Northern IrelandUnited Mexican StatesUnited Republic of TanzaniaUnited StatesUnited States Minor Outlying IslandsUnited States of AmericaUruguayUzbekistanVanuatuVenezuelaViet NamVietnamVirgin Islands of the United StatesVirgin Islands, BritishVirgin Islands, U.S.Wallis and FutunaWestern SaharaYemenZambiaZimbabwethe State of EritreaÅland IslandsProject-Id-Version: iso_3166-1 Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues POT-Creation-Date: 2018-01-17 22:10+0100 PO-Revision-Date: 2017-12-25 21:47+0000 Last-Translator: Chris Leonard Language-Team: Afrikaans Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=n != 1; X-Generator: Weblate 2.19-dev AfghanistanAlbaniëAlgeriëAmerikaanse SamoaAndorraAngolaAnguillaAntarktikaAntigue en BarbudaArabiese Republiek van EgipteArgentiniëArgentynse RepubliekArmeniëArubaAustraliëOostenrykAzerbaidjanBahamasBahreinBangladesjBarbadosWit-RuslandBelgiëBelizeBeninBermundaBhoetanBoliviëBonaire, Sint Eustatius en SabaBosnië en HerzegowinaBotswanaBouvet-eilandBrasiliëBritse Indiese OseaangebiedBritse Maagde-eilandeBroeneiBulgaryeBurkina FasoBurundiKambodjaKameroenKanadaKaaimanseilandeSentraal-Afrikaanse RepubliekTsjadChiliSjinaKerseilandKokoseilandeColombiëComoreKongoKongo, Die Demokratiese Republiek van dieCookeilandeCosta RicaKroasiëKubaCuraçaoSiprusTsjeggiese RepubliekTsjeggiëIvoorkusDemokratiese Volksrepubliek van KoreaDemokratiese Republiek van Sao Tomé en PrincipeDemokratiese Republiek van Oos-TimorDemokratiese Sosialistiese Republek van Sri LankaDenemarkeDjiboetiDominicaDominikaanse RepubliekOostelike Republiek van UruguayEcuadorEgipteEl SalvadorEkwatoriaal-GuineeEritreëEstlandEtiopiëFalklandeilande (Malvinas)FaroëreilandeFederale Demokratiese Republiek van EtiopiëFederale Demokratiese Republiek van NepalFederale Republiek van DuitslandFederale Republiek van NigeriëFederale Republiek van SomaliaMikronesiëFederale Republiek van BrasiliëFidjiFinlandFrankrykFrans-GuyanaFrans-PolinesiëFranse RepubliekGaboenGaboenese RepubliekGambiëGeorgiëDuitslandGhanaGibraltarGroothertogdom LuxemburgGriekelandGroenlandGrenadaGuadeloupeGuamGuatemalaGuernseyGuineeGuinee-BissauGuyanaHaïtiHeard- en McDonaldeilandeVatikaanHondurasHongkongHongkong SAS SjinaHongaryeYslandOnafhanklike Staat van Papoea-Nieu-GuineeOnafhanklike Staat van SamoaIndiëIndonesiëIran, Islamitiese Republiek vanIrakIerlandIslamitiese Republiek van AfghanistanIslamitiese Republiek van IranIslamitiese Republiek van MouritaniëIslamitiese Republiek van PakistanIslamitiese Republiek van die GambiëEiland ManIsraelItaliaanse RepubliekItaliëJamaikaJapanJerseyJordaniëKazakstanKeniaKoninkryk van BahreinKoninkryk van BelgiëKoninkryk van BhoetanKoninkryk van KambodjaKoninkryk van DenemarkeKoninkryk van LesothoKoninkryk van MarokkoKoninkryk van NoorweëKoninkryk van Saoedi-ArabiëKoninkryk van SpanjeKoninkryk van SwazilandKoninkryk van SwedeKoninkryk van ThailandKoninkryk van TongaKoninkryk van die NederlandeKiribatiNoord-KoreaSuid-KoreaKoeweitKirgiese RepubliekKirgisiëLetlandLibanese RepubliekLibanonLesothoLiberiëLibiëLiechtensteinLitoueLuxenburgMacau SAS SjinaMasedoniëMadagaskarMalawiMaleisiëMalediveMaliMaltaMarshall-eilandeMartiniqueMouritaniëMauritiusMayotteMeksikoMoldawiëMonacoMongoliëMontenegroMontserratMarokkoMosambiekMianmarNamibiëNaoeroeNepalNederlandNieu-KaledoniëNieu-SeelandNicaraguaNigerNigeriëNiueNorfolk EilandNoordelike Mariana-eilandeNoorweëOmanPakistanPalauPanamaPapoea-Nieu-GuineeParaguayDemokratiese Volksrepubliek van AlgeriëVolksrepubliek van BangladesjVolksrepubliek van SjinaPeruFilippynePolePortugalPortugese RepublicVorstedom van AndorraVorstedom van LiechtensteinVorstedom van MonacoPuerto RicoKatarRepubliek van AlbaniëRepubliek van AngolaRepubliek van ArmeniëRepubliek van OostenrykRepubliek van AzerbaidjanRepubliek van Wit-RuslandRepubliek van BeninRepubliek van Bosnië en HerzegowinaRepubliek van BotswanaRepubliek van BulgaryeRepubliek van BurundiRepubliek van KameroenRepubliek van TsjadRepubliek van ChiliRepubliek van ColombiëRepubliek van Costa RicaRepubliek van KroasiëRepubliek van KubaRepubliek van SiprusRepubliek van die IvoorkusRepubliek van DjiboetiRepubliek van EcuadorRepubliek van El SalvadorRepubliek van Ekwatoriaal-GuineeRepubliek van EstlandRepubliek van FidjiRepubliek van FinlandRepubliek van GhanaRepubliek van GuatemalaRepubliek van GuineeRepubliek van Guinee-BissauRepubliek van GuyanaRepubliek van HaïtiRepubliek van HondurasRepubliek van YslandRepubliek van IndiëRepubliek van IndonesiëRepubliek van IrakRepubliek van KazakstanRepubliek van KeniaRepubliek van KiribatiRepubliek van LetlandRepubliek van LiberiëRepubliek van LitoueRepubliek van MadagaskarRepubliek van MalawiRepubliek van die MaledivesRepubliek van MaliRepubliek van MaltaRepubliek van MauritiusRepubliek van MoldawiëRepubliek van MosambiekRepubliek van MianmarRepubliek van NamibiëRepubliek van NaoeroeRepubliek van NicaraguaRepubliek van PalauRepubliek van PanamaRepubliek van ParaguayRepubliek van PeruRepubliek van PoleRepubliek van San MarinoRepubliek van SenegalRepubliek van SerwiëRepubliek van SeychelleRepubliek van Siërra LeoneRepubliek van SingapoerRepubliek van SloweniëRepubliek van Suid-AfrikaRepubliek van Suid-SoedanRepubliek van SurinameRepubliek van TadjikistanRepubliek van Trinidad en TobagoRepubliek van TunisiëRepubliek van TurkyeRepubliek van UgandaRepubliek van OesbekistanRepubliek van VanuatuRepubliek van JemenRepubliek van ZambiëRepubliek van ZimbabweRepubliek van die KongoRepubliek van die Marshall-eilandeRepubliek van NigerRepubliek van die FilippyneRepubliek van SoedanRoemeniëRussiese FederasieRwandaRwandese RepubliekRéunionSint BarthélemySint Helena, Ascension en Tristan da CunhaSt. Kitts en NevisSt. LuciaSt. Pierre en MiquelonSt. Vincent en die GrenadineSamoaSan MarinoSao Tomé en PrincipeSaoedi-ArabiëSenegalSerwiëSeychelleSiërra LeoneSingapoerSlowaakse RepubliekSlowakyeSloweniëSosialistiese Republek van ViëtnamSolomon EilandeSomaliëSuid-AfrikaSuid-Georgië en die Suidelike SandwicheilandeSuid-SoedanSpanjeSri LankaStaat van IsraelStaat van KoeweitStaat van KatarSoedanSurinameSvalbard en Jan MayenSwazilandSwedeSwitserse KonfederasieSwitserlandSiriese Arabiese RepubliekTaiwanTaiwan, Provinsie van SjinaTadjikistanTanzaniëTanzanië, Verenigde Republiek vanThailandOos-TimorTogoTogolese RepubliekTokelauTongaTrinidad en TobagoTunisiëTurkyeToerkmeniëTurks- en Caicos-eilandeToewaloeUgandaOekraïneVerenigde Arabiese EmirateVerenidge KoninkrykVerenigde Koninkryk van Groot-Brittanje en Noord-IerlandVerenigde Meksikaanse StateVerenigde Republiek van TanzaniëVerenigde StateKlein afgeleë eilande van die Verenigde State van AmerikaVerenigde State van AmerikaUruguayOesbekistanVanuatuVenezuelaViëtnamViëtnamVSA se Maagde-eilandeMaagde-eilande, BritseMaagde-eilande, VSAWallis en FutunaWes-SaharaJemenZambiëZimbabwedie State van EritreëÅlandeilandePK01]f)$$LC_MESSAGES/glib20.monu[l          + K ` #|   #  , H _ ~ !    (D[w! :Y!v) *1Dc v  22Bu!  /P bo v $?Zu####2#V#z#### #.#Rv$A_u*C[u!! 7Ut! ")D]x  &/Vh'"%".Qp#*'!>&Q#x "7Z+y"% +* V q  2       !!8!L!c!{!,!!?!"+">"R"*a"""&"""## '#2#6#:#>#B#F#J#N#R#V#Z#^#b#f#j#n#r#v#z#~############ #### ###$$ $$$ !$+$1$:$ C$M$V$\$b$h$l$u$ }$$$$$ $$$U-S` q!J +/$o& lN.n9i|%x"u(0,^1@4Fkemgtvfh[{G}rCyQ3R2w> Ej67PA]H5 ?_p\8;:BWX)Y~'* Da=Tzd<LZ#MbKcsIVO (invalid encoding)%.1f EB%.1f GB%.1f KB%.1f MB%.1f PB%.1f TB%s filetype%s type'%s' is not a valid name '%s' is not a valid name: '%c' Application Options:Backup file creation failedCan't copy directory over directoryCan't copy over directoryCan't copy special fileCan't move directory over directoryCan't open directoryCan't recursively copy directoryCan't rename root directoryError closing file: %sError creating backup copy: %sError creating directory: %sError getting filesystem info: %sError making symbolic link: %sError moving file: %sError on line %d: %sError opening directory '%s': %sError opening file '%s': %sError opening file: %sError reading file '%s': %sError reading from file: %sError removing file: %sError removing old file: %sError removing target file: %sError renaming file: %sError renaming temporary file: %sError writing to file: %sFailed to create file '%s': %sFailed to open file '%s': %sFailed to read from file '%s': %sFailed to read the symbolic link '%s': %sFile "%s" is too largeFile is emptyFile names cannot contain '%c'Filesystem does not support symbolic linksGDateTime%H:%M:%SGDateTime%a %b %e %H:%M:%S %YGDateTime%m/%d/%yGDateTimeAMGDateTimePMHelp Options:Internal error: %sInvalid compressed dataInvalid filenameInvalid filename %sInvalid group name: %sInvalid hostnameInvalid symlink value givenNeed more inputNo application is registered as handling this fileNot a regular fileNot enough memoryShow all help optionsShow help optionsSymbolic links not supportedTarget file existsTarget file is a directoryTarget file is not a regular fileThe file was externally modifiedUnknown option %sUnknown typeUsage:[OPTION...]abbreviated month nameAprabbreviated month nameAugabbreviated month nameDecabbreviated month nameFebabbreviated month nameJanabbreviated month nameJulabbreviated month nameJunabbreviated month nameMarabbreviated month nameMayabbreviated month nameNovabbreviated month nameOctabbreviated month nameSepabbreviated month name with dayAprabbreviated month name with dayAugabbreviated month name with dayDecabbreviated month name with dayFebabbreviated month name with dayJanabbreviated month name with dayJulabbreviated month name with dayJunabbreviated month name with dayMarabbreviated month name with dayMayabbreviated month name with dayNovabbreviated month name with dayOctabbreviated month name with daySepabbreviated weekday nameFriabbreviated weekday nameMonabbreviated weekday nameSatabbreviated weekday nameSunabbreviated weekday nameThuabbreviated weekday nameTueabbreviated weekday nameWedempty names are not permittedfull month nameAprilfull month nameAugustfull month nameDecemberfull month nameFebruaryfull month nameJanuaryfull month nameJulyfull month nameJunefull month nameMarchfull month nameMayfull month nameNovemberfull month nameOctoberfull month nameSeptemberfull month name with dayAprilfull month name with dayAugustfull month name with dayDecemberfull month name with dayFebruaryfull month name with dayJanuaryfull month name with dayJulyfull month name with dayJunefull month name with dayMarchfull month name with dayMayfull month name with dayNovemberfull month name with dayOctoberfull month name with daySeptemberfull weekday nameFridayfull weekday nameMondayfull weekday nameSaturdayfull weekday nameSundayfull weekday nameThursdayfull weekday nameTuesdayfull weekday nameWednesdayProject-Id-Version: glib master Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?product=glib&keywords=I18N+L10N&component=general POT-Creation-Date: 2011-09-04 23:56-0400 PO-Revision-Date: 2011-03-30 18:52+0200 Last-Translator: F Wolff Language-Team: translate-discuss-af@lists.sourceforge.net Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=(n != 1); X-Generator: Virtaal 0.7.0-beta4 (ongeldige enkodering)%.1f EG%.1f GG%.1f KG%.1f MG%.1f PG%.1f TG%s-lêertipe%s-tipe'%s' is nie 'n geldige naam nie '%s' is nie 'n geldige naam nie: '%c' Toepassingkeuses:Kon nie rugsteunlêer skep nieKan nie 'n gids oor 'n gids kopieer nieKan nie oor 'n gids kopieer nieKan nie spesiale lêer kopieer nieKan nie 'n gids oor 'n gids skuif nieKan nie gids open nieKan nie gids rekursief kopieer nieKan nie wortelgids hernoem nieFout met toemaak van lêer: %sFout met skep van rugsteunkopie: %sFout met skep van gids: %sFout met kry van lêerstelselinligting: %sFout met maak van simboliese skakel: %sFout met skuif van lêer: %sFout op lyn %d: %sFout met oopmaak van die gids '%s': %sFout met oopmaak van lêer '%s': %sFout met oopmaak van lêer: %sFout met lees van lêer '%s': %sFout met lees vanaf lêer: %sFout met skrap van lêer: %sFout met skrap van ou lêer: %sFout met skrap van teikenlêer: %sFout met hernoem van lêer: %sFout met hernoeming van tydelike lêer: %s Fout met skryf na lêer: %sKon nie lêer '%s' skep nie: %sKon nie lêer '%s' oopmaak nie: %sKon nie lees vanaf lêer '%s' nie: %sKon nie simboliese skakel '%s' lees nie: %sDie lêer "%s" is te grootLêer is leegLêernaam kan nie '%c' bevat nieLêerstelsel ondersteun nie simboliese skakels nie%H:%M:%S%a %d %b %Y %T %Z%y-%m-%dvm.nm.Hulpkeuses:Interne fout: %sOngeldige saamgepersde dataOngeldige lêernaamOngeldige lêernaam %sOngeldige groepnaam: %sOngeldige gasheernaamOngeldige waarde vir simboliese skakel gegeeBenodig meer toevoerGeen toepassing is geregistreer om hierdie lêer te hanteer nieNie 'n gewone lêer nieOnvoldoende geheueWys alle hulpkeusesWys hulpkeusesSimboliese skakels word nie ondersteun nieTeiken lêer bestaanTeikenlêer is 'n gidsTeikenlêer is nie 'n gewone lêer nieDie lêer is ekstern gewysigOnbekende keuse %sOnbekende tipeGebruik:[KEUSE...]AprAugDesFebJanJulJunMrtMeiNovOktSepAprAugDesFebJanJulJunMrtMeiNovOktSepVr.Ma.Sa.So.Do.Di.Wo.leë name word nie toegelaat nieAprilAugustusDesemberFebruarieJanuarieJulieJunieMaartMeiNovemberOktoberSeptemberAprilAugustusDesemberFebruarieJanuarieJulieJunieMaartMeiNovemberOktoberSeptemberVrydagMaandagSaterdagSondagDonderdagDinsdagWoensdagPK01]ĿQ%%LC_MESSAGES/iso_639-3.monu[$,       $ + 7 > I Q Y ` j r z                    # * 2 ; A J Q W a k v                  ) . 6 ; A I S f l w                *08@FLRY^fnu|   "+ 2? D Q [elu }       "&,5;B JU[bkq z       $. 5 @JOW\bir    (5 <FLS [hnw      0 ,E9_A Vw*M}#{d)\2?x8=LJq ]1("Y$Sj<P l^if>.3%Qy;vH4OI-/7GNg6pmZ+u!@za :h|K~ nkse[&WcroXtRCUD`F'5BTbAbkhazianAfarAfrikaansAlbanianAmharicArabicArmenianAssameseAymaraAzerbaijaniBasqueBelarusianBengaliBislamaBretonBulgarianBurmeseCatalanCherokeeChineseCopticCornishCorsicanCroatianCzechDanishDutchEgyptian (Ancient)EnglishEsperantoEstonianEweFaroeseFijianFinnishFonFrenchGeorgianGermanGothicGuaraniGujaratiHausaHawaiianHebrewHindiHungarianIcelandicIndonesianInterlingueInuktitutInupiaqIrishItalianJapaneseJavaneseKannadaKashmiriKazakhKinyarwandaKirghizKoreanKurdishLaoLatinLatvianLingalaLithuanianMacedonianMalayalamMaliMalteseManxMaoriMarathiMongolianMultiple languagesNauruNorse, OldNorwegianOromoPolishPortuguesePushtoQuechuaRundiRussianSamoanSangoSanskritSerbianSerbo-CroatianShonaSindhiSlovakSlovenianSomaliSotho, SouthernSpanishSundaneseSwatiSwedishTagalogTajikTamilTatarTeluguThaiTibetanTokelauTsongaTswanaTurkishTurkmenTwiUgariticUighurUrduUzbekVendaVietnameseWalloonWelshWolofXhosaYiddishYorubaZuluProject-Id-Version: iso_639-3 Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues POT-Creation-Date: 2018-01-17 22:10+0100 PO-Revision-Date: 2017-12-25 21:47+0000 Last-Translator: Chris Leonard Language-Team: Afrikaans Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=n != 1; X-Generator: Weblate 2.19-dev AbgasiesAfarAfrikaansAlbaneesAmhariesArabiesArmeensAssameseAymaraAzerbaidjansBaskBelo-RussiesBengaleesBislameesBretonBulgaarsBurmeesKateloniesTjerokeesSjineesKoptiesKorniesKorsikaansKroatiesTsjeggiesDeensNederlandsEgipties (antiek)EngelsEsperantoEstoniaansEweFäröersFidjiesFinsFonFransGeorgiesDuitsGotiesGuaraniGoedjaratiHausaHawaisHebreeusHindiHongaarsYslandiesIndonesiesInterlingueInnuïtiesInupiakIersItaliaansJapaneesJavaneesKannadaKasjmiriKazakKinyarwandaKirgisiesKoreaansKoerdiesLaotiesLatynLettiesLingaleesLitausMasedoniesMalabaarsMaliMalteesMansMaoriMarafiMongoolsVeelvuldige taleNauruOud-NoorsNoorsOromeesPoolsPortugeesPasjtoeQuechuaRundiRussiesSamoaansSangroSanskritSerwiesSerwieskroatiesShonaSindhiSlowaaksSloveensSomaleesSotho, Suid-SpaansSoedaneesSwatiSweedsTagalogTadjikistansTamilTartaarsTeloegoeTaisTibetaansTokelauTsongaTswanaTurksTurkmeensTwiOegaritiesOeigoersOerdoeOezbekiesVendaViëtnameeswalloonseWalliesWolofXhosaJiddisjJoroebaZoeloePK01]FLC_MESSAGES/man-db-gnulib.monu[Dl--NAMEUnknown system errorfailed to return to initial working directorymemory exhaustedProject-Id-Version: coreutils 5.2.1 Report-Msgid-Bugs-To: bug-gnulib@gnu.org POT-Creation-Date: 2016-12-12 12:10+0000 PO-Revision-Date: 2004-03-17 11:58+0200 Last-Translator: Petri Jooste Language-Team: Afrikaans Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=iso-8859-1 Content-Transfer-Encoding: 8bit X-Bugs: Report translation errors to the Language-Team address. NAAMOnbekende stelselfoutkon nie na aanvanklike werkgids terugkeer niegeheue uitgeputPK01]}LC_MESSAGES/xkeyboard-config.monu[jl   3 < Q X a m v         $ + 0 @ F V _ o w        "  % E e y           #/ !S u +     % 7 #Q u        %-ASem t~   !  #09 OY b l w    !,<DIOg"8LUfz   #!& H+i   + KUp  -?GPY`gnw~   ,1h%!)S "9^UT>8JQ<(?Y#AcBG=XeiCHN.5MOf`&aZ_* +/P 3 Lg[R@\]KF: Vb6d-4 ;DE'W07j$I2Acer AirKey VAdvance Scorpius KIAlbanianAlt/Win key behaviorArabicArmenianAzerbaijaniBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 9000BTC 9000ABTC 9001AHBelarusianBelgianBosnianBulgarianBurmeseCherry Blue Line CyBo@rdChicony KB-9885CloGaelachCroatianCzechDanishDellDell 101-key PCDutchEnnyah DKB-1008EstonianEverex STEPnoteFaroeseFinnishFrenchGeneric 101-key PCGeneric 104-key PCGermanGreekGujaratiHewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Honeywell EuroboardHungarianIBM Rapid AccessIBM Rapid Access IIIBM ThinkPad 560Z/600/600E/A22EIcelandicInuktitutIrishItalianJapaneseKannadaKeytronic FlexProLatvianLogitech Cordless DesktopLogitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech iTouchMacedonianMacintoshMacintosh OldMalayalamMalteseMemorex MX1998Memorex MX2750Microsoft NaturalMicrosoft Office KeyboardMiscellaneous compatibility optionsMongolianNorthern Saami (Finland)Northern Saami (Norway)Northern Saami (Sweden)Northgate OmniKey 101NorwegianOghamOriyaPolishPortugueseQTronix Scorpius 98N+RomanianRussianSVEN Ergonomic 2500Samsung SDM 4500PSamsung SDM 4510PSerbianSlovakSlovenianSpanishSwedishSyriacTajikTeluguThai (Pattachote)Thai (TIS-820.2538)Toshiba Satellite S3000TurkishTurkish (F)UkrainianUzbekVietnameseWinbook Model XP5Project-Id-Version: xfree86_xkb_xml 4.4pre1 Report-Msgid-Bugs-To: svu@users.sourceforge.net POT-Creation-Date: 2019-10-19 21:52+0100 PO-Revision-Date: 2004-03-18 00:17+0200 Last-Translator: Petri Jooste Language-Team: Afrikaans Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Bugs: Report translation errors to the Language-Team address. Acer AirKey VAdvance Scorpius KIAlbaniesAlt/Win-sleutel gedragArabiesArmeensAzerbaijaansBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 9000BTC 9000ABTC 9001AHBelarussiesBelgiesBosniesBulgaarsBurmeesCherry Blue Line CyBo@rdChicony KB-9885CloGaelachKroatiesTsjeggiesDeensDellDell 101-key PCNederlandsEnnyah DKB-1008EstoniaansEverex STEPnoteFaroeesFinsFransGeneries 101-sleutel PCGeneries 104-sleutel PCDuitsGrieksGujaratiHewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Honeywell EuroboardHongaarsIBM Rapid AccessIBM Rapid Access IIIBM ThinkPad 560Z/600/600E/A22EYslandiesInuktitutIersItaliaansJapaneesKannadaKeytronic FlexProLatviesLogitech Cordless DesktopLogitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech iTouchMasedoniesMacintoshMacintosh (oud)MalayalamMalteesMemorex MX1998Memorex MX2750Microsoft NatuurlikMicrosoft Office sleutelbordVerskeie versoenbaarheid-opsiesMongoleesNoordelike Saami (Finland)Noordelike Saami (Noorweë)Noordelike Saami (Swede)Northgate OmniKey 101NoorweegsOghamOriyaPoolsPortugeesQTronix Scorpius 98N+RomeensRussiesSVEN Ergonomic 2500Samsung SDM 4500PSamsung SDM 4510PSerbiesSlovaaksSloveensSpaansSweedsSiriesTajikeesTeluguThai (Pattachote)Thai (TIS-820.2538)Toshiba Satellite S3000TurksTurks (F)UkraïniesUzbekViëtnameesWinbook Model XP5PK01]ЉZLC_MESSAGES/atk10.monu[m@ A X i y    #   8 T m C~ - 4 / ? : <9 7v 4 ,  B" e 5s " ( =6?*v         + 9FKR an w       !- 6D J T b m z          &7JS Xfox }^'8IYr U f3s9>b9;6@N5 O#0; l!y/?: /Fv|     " 1 =IXho       (7I P Zg w      % 5B \f kv   WN*49i[h,?/=XD@aGgbL(_"8A0^d<`f5C2 T+l: VJH317.Z-6&>%Pc)S\ Oe!'jmk$MIBE UF]#R;QYKAccessible DescriptionAccessible LayerAccessible NameAccessible ParentAccessible RoleAccessible Table CaptionAccessible Table Caption ObjectAccessible Table Column DescriptionAccessible Table Column HeaderAccessible Table Row DescriptionAccessible Table Row HeaderAccessible Table SummaryAccessible ValueDescription of an object, formatted for assistive technology accessEnd indexIs used to notify that the parent has changedIs used to notify that the table caption has changedIs used to notify that the table caption has changed; this property should not be used. accessible-table-caption-object should be used insteadIs used to notify that the table column description has changedIs used to notify that the table column header has changedIs used to notify that the table row description has changedIs used to notify that the table row header has changedIs used to notify that the table summary has changedIs used to notify that the value has changedNumber of AnchorsObject instance’s name formatted for assistive technology accessSelected LinkSpecifies whether the AtkHyperlink object is selectedStart indexThe accessible role of this objectThe end index of the AtkHyperlink objectThe number of anchors associated with the AtkHyperlink objectThe number of links which the current AtkHypertext hasThe start index of the AtkHyperlink objectalertanimationapplicationarrowautocompletecalendarcanvascheck boxcheck menu itemcolor choosercolumn headercombo boxdateeditordesktop framedesktop icondialdialogdirectory panedrawing areaedit barfile chooserfillerfontchooserfooterframeglass paneheaderhtml containericonimageinternal frameinvalidlabellayered panelistlist itemmenumenu barmenu itemoption panepage tabpage tab listpanelparagraphpassword textpopup menuprogress barpush buttonradio buttonradio menu itemroot panerow headerscroll barscroll paneseparatorsliderspin buttonsplit panestatusbartabletable celltable column headertable row headertear off menu itemterminaltexttoggle buttontool bartool tiptreetree tableunknownviewportwindowProject-Id-Version: atk cvs Report-Msgid-Bugs-To: POT-Creation-Date: 2009-12-21 15:05+0800 PO-Revision-Date: 2002-12-05 16:08+0100 Last-Translator: Stefan Lubbersen Language-Team: Afrikaans Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Toeganklike beskrywingToeganklike laagToeganklike naamToeganklike ouerToeganklike rolToegankelijke tabeltitelToeganklik tabeltitelobjekToeganklike kolombeskrywingtabelkolomtitelToeganklike rybeskrywingtabelrytitelToeganklike tabelsamenvattingToeganklike waardeBeskrywing van die objek, spesiaal opgemaak vir toegang van ondersteunende tegnologieEinde indeksWord gebruik om aan te gee dat die ouer is veranderWord gebruik om aan te gee dat die tabeltitel is veranderWord gebruik om aan te gee dat die tabeltitel is verander (nie gebruik nie). U kan beter accessible-table-caption-objek gebruik.Word gebruik om aan te gee dat die kolombeskrywing is veranderWord gebruik om aan te gee dat die kolomtitel is veranderWord gebruik om aan te gee dat die rybeskrywing is veranderWord gebruik om aan te gee dat die rytitel is veranderWord gebruik om aan te gee dat die tabelsamenvatting is veranderWord gebruik om aan te gee dat die waarde is veranderAantal ankersNaam van die objek, spesiaal opgemaak vir toegang van ondersteunende tegnologieGeselekteerde verwysingGee aan of die AtkHyperLink objek geselekteer isBegin indeksDie toeganklike rol van die objekEinde van die indeks van die AtkHyperlink objekDie aantal ankers wat met die AtkHyperlink objek is geassosieerDie huidige aantal verwysings van die huidige AtkHypertextBegin van die indeks van die AtkHyperlink objekalarmanimasieprogrampyloutkompleetkalenderkanvasaankruisvakkieaankruis-spyskaart-itemkleurkieserkolomtitelkeusevakdatum bewerkburoblad-frameburobladikoonbeldialoogvenstermappepaneeltekengebiedspyskaart-balkbestands-kieservullerlettertiepe-kieservoetframeglaspaneelkophtml-houerikoonafbeeldinginterne frameongeldiglabelgelaagde paneellyslys-itemspyskaartspyskaart-balkspyskaart-itemopsies-paneelbladsy-tabbladbladsy-tabbladlyspaneelparagraafwagwoordtekspopop-spyskaartvoorgangsbalkdrukknopradioknopradio-spyskaart-itemhoofpaneelrytitelskuifbalkskuifpaneelskeidingskuiweromhoog/omlaag-knopgedeelde paneelstatusbalktabeltabel-seltabelkolomtiteltabelrytitelafneembaar spyskaart-itemterminaalteksskakelknopwerkbalkhulpballonboomboomtabelonbekendblikveldvensterPK01]6? LC_MESSAGES/sed.monu[!$/,\%Fl $"GYt# +8Rq##&,?XmR,* - H d {         ) < &J q   ) ) + 3; !o      !   -R, --regexp-perl use Perl 5's regular expressions syntax in the script. %s: -e expression #%lu, char %lu: %s %s: can't read %s: %s %s: file %s line %lu: %s : doesn't want any addressesInvalid back referenceInvalid character class nameInvalid collation characterInvalid content of \{\}Invalid preceding regular expressionInvalid range endInvalid regular expressionMemory exhaustedNo matchNo previous regular expressionPremature end of regular expressionRegular expression too bigSuccessTrailing backslashUnmatched ( or \(Unmatched ) or \)Unmatched \{`e' command not supported`}' doesn't want any addresseserror in subprocessexpected newer version of sedmultiple `g' options to `s' commandmultiple `p' options to `s' commandmultiple number options to `s' commandnumber option to `s' command may not be zerooption `e' not supportedread error on %s: %sProject-Id-Version: sed 4.0.9 Report-Msgid-Bugs-To: bug-gnu-utils@gnu.org POT-Creation-Date: 2018-03-31 18:40-0700 PO-Revision-Date: 2004-01-11 21:06+0000 Last-Translator: Ysbeer Language-Team: Afrikaans Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Bugs: Report translation errors to the Language-Team address. Plural-Forms: nplurals=2; plural=n!=1; -R, --regexp-perl gebruik Perl 5 se regexsintaks in die skrip. %s: -e uitdrukking #%lu, karakter %lu: %s %s: Kan nie %s lees nie: %s %s: lêer %s lyn %lu: %s : soek nie 'n adres nieOngeldige terugverwysingOngeldige karakterklasnaamOngeldige kollasiekarakterOngeldige inhoud binne \{\}Ongeldige vorige regexOngeldige bereikseindeOngeldige regexGeheue uitgeputGeen paringGeen vorige regex niePremature einde vir regexRegex te grootSuksesSleep terugstreepOngepaarde ( or \(Ongepaarde ) of \)Ongepaarde \{`e' instruksie word nie ondersteun nie`}' soek nie 'n adres niefout in subproseshet nuwer sed-weergawe verwagmeervoudige `g' opsies vir `s' instruksiemeervoudige `p' opsies vir `s' instruksiemeervoudige nommeropsies vir `s' instruksienommeropsie vir `s' instruksie mag nie nul wees nieopsie `e' word nie ondersteun nieleesfout op %s: %sPK01]AyCCLC_MESSAGES/gtk20.monu[:pMqM MM MM M MM=MNNN4NHN'WN$N(N)NN OO O $O"2O#UO!yO O O O OOO%OP*P3P):P-dPP PPPPQQ Q)Q1Q :Q!HQ!jQ Q"Q(Q*Q-$R,RR,RR'R/R"SBSZSsSSS SS SVS2TTTT T T$U %U2U KU"YU |UUUUUUUUUVV0VNVcVVV*W)EW+oWWW!W)WX3X$IXnX1X-XX!Y%Y"9Y*\Y+Y#Y&Y.Y*-Z,XZ#Z-ZZZ ["[7[6N[ [[[[[[\ \ (\5\ D\P\j\ r\\ \\!\"\\\ ]$],],E]%r]+];]^^#^B^_^|^'^^^ ^#_,_;_$X_}____ _``N`&m``R`aaJ3a#~aaaaa"b7bQbkbbbbb8b80cic!c"c&cc cc%d5dId OdYdbdxddddd dBdNe0fe.e&e eeff7f"?fbfff,ffffg g 'gHg%]gg-gggg h"$h Gh"hhhh$hi7.ifili${i.i$i*iOj*oj%j/jej%Vkr|kk l l$l5lHlelllll llmJ,mOwmm m mm2mHnennn nn nnnoo4o=oRoVo^owooooo>o$.p,Spp pppp pp ppppq4qCq#Lqpqq-qhq)r?rDr`r |rr"r"r#r# s&/sVsus ss s s s s s st t t #t/1tatetQtVt!.u Pu&qu-u4u2u.v6v >v LvWvgvmv}vvvv v v v vv v w w!w(w @w MwYw`wiw w!w w w wwww w x xx2x:x#Zx2~x!xxx2y!Bydy"yyy y+y*y&(zOzozzzzzAz#{A{Z{ w{{{#{{{{ || (| 2|=|O| `|n||||||||| ||} } }w}(}%}}}~-~?~R~j~|~~~!~~+~/~Ljy 9QgĀ,@Uk~ˁ߁-@Ug{҂ "8J\oσ0@Re~̈́ /HZpą1Je~چ 8U q ʇև߇ 3I^y')@Vke"!7YKD-pr*.GŒ! ,GG#`Eʎ "?'\*-Cݏ)! K lz Őϐ$!3+U03 (, I"j,Β֒ !1S"n!ɓٓ G2O %ה ޔ"A%_)k˕7Nj  Ԗ    *7?H!Npw   —З ߗ  $,> FS\e mz  ˜ʘҘژޘ 5M c oz͙"8L_uȚܚ $9Ndyӛ !9Qi˜ܜ6N gu  ҝ 2BRbr ĞԞ " 6 D R ` n | ßџ    . <J Y g u   Ϡ ݠ1J_zǡס"1@Ol{ɢ4 FS j w ģݣ(AZs(z*ä&$):d#ǥץ'APXxW o|  9¨  $&4#[,-ک  "#7"[ ~ )Ѫ+7I' Ы  ".>!Z)|&+ͬ02*0]0)ޭ>+Gs#Ԯ' !Z17? E P Z,f *а  /F]f nzݱ}3/..?V"v(³'!8A)z! *+D!p%1,1$I0nض 8(as ̷׷  /C_ gt ,!̸ $ 3(;5d'1¹7$,QVv!/˺(1+Z +#& /P nzU*R9Ký'7 St%ھ.Nl==޿!5'W+ #  '; AL_z Fa/H3x% "!) 2Sp1##%I&_/('&P&wk. 9;O'2',&fS-(7|I#k   "B\ sWYn s~6L7Okt { *Hc=&-MT]fk p} %! 0,=j7oEe j) ***?)j/&&  '&0W j t  3WYm"!+ 189j; %-=M_ry  #*2 L$W|    )1J-|"0,!K*m /3(+To>#$A f!# ,: Q \fz   !&, 3wA$#0GWn #%4-Iw    !/5I \f w     % 0: @ J V `kqw     $ .:@ GR X box |  !%A `nw'<(Qz.wJ" EHy' G#L X$HOm *2E/x3J.',V !   %=$c)/-.".Q#!1:If&})& 0@IXMt5  &.U ]j z(; Xfsv '>GZ `nu}     ; C MW_ fq v     $ -; BPb r~#   %* 2? CMSX_bfmrx    ! -8>DJPV\b f r ~    !$'*-047:= @JMSVY\_bfiloru{~   #';?CGLQ Vai q }   ;APcx  "9> }*Oc SRB{a*M()`z,mSr-LQNKc;Z=<[oStB/ggOPU2GrW ?@><at qV}U5CM}Hy'MVR_c nZoNjklumn^ipwWRkYfi_ =3qv#qNU5:6CI18,df6jj&JxKuvw@jEGIJLNy" ]*5gw0B\` mO{x=m}Q!%M]9tD F" y#)ZA u/ z,7i dO<19hk 3RJA]-4~86 2Ybp qs{"39in3&`d v__es:`&.|Dv/Q~-Y$Hl#@e1.>$CH^7F>:0!+SLxbpVW^+\\8+sfV9;w=kU%h[a[ 6>XD ,Z' YoaL5gGQl7~;0 Py2EEHA1P^J#?4s)b;Whb'2AXEzrnCd)&I{7G|4Kt(:.Xp ~Tf ]%-BDe/(e"0*'(%cxurFoT!@ $|ITTPz??\|F<!Xh+K8[l.$4"Deepness" of the color.%1$s on %2$s%H:%M%s job #%d(None)(disabled)(unknown)--- No Tip ---A file named "%s" already exists. Do you want to replace it?A_t:About %sAcceleratorDisabledAcceleratorInvalidAdd Cover PageAdd the current folder to the bookmarksAdd the folder '%s' to the bookmarksAdd the selected folder to the BookmarksAdd the selected folders to the bookmarksAdjusts the volumeAdvancedAfterAll sheetsAmharic (EZ+)Amount of blue light in the color.Amount of green light in the color.Amount of red light in the color.Any PrinterApplicationArtwork byAuto SelectAxesBMP image has bogus header dataBMP image has unsupported header sizeBad code encounteredBe_fore:BeforeBits per channel of PNG image is invalid.Bits per channel of transformed PNG is not 8.Bookmark '%s' cannot be removedBottom to topBottom to top, left to rightBottom to top, right to leftBrightness of the color.CLASSCOLORSC_ollateC_reateC_reditsC_urrent PageCache file created successfully. Cannot allocate TGA header memoryCannot allocate colormap entriesCannot allocate colormap structureCannot allocate memory for IOBuffer dataCannot allocate memory for IOBuffer structCannot allocate memory for TGA context structCannot allocate memory for loading PNM imageCannot allocate memory for loading XPM imageCannot allocate new pixbufCannot allocate temporary IOBuffer dataCannot change to folder because it is not localCannot end process with pid %d: %sCannot open display: %sCannot read XPM colormapCannot realloc IOBuffer dataCaps Lock is onCedillaCircular table entry in GIF fileCl_earClassifiedClick the eyedropper, then click a color anywhere on your screen to select that color.Click this palette entry to make it the current color. To change this entry, drag a color swatch here or right-click it and select "Save color here."Co_nnectColorColor SelectionColor WheelColor _name:Color profile has invalid length %d.Command LineComplete, but not uniqueCompleting...Compressed icons are not supportedConfidentialConnect _anonymouslyConnect as u_ser:Convert to PS level 1Convert to PS level 2Copie_s:CopiesCopy URLCopy _Link AddressCopy _LocationCould not add a bookmarkCould not allocate memory: %sCould not clear listCould not create stream: %sCould not decode ICNS fileCould not find the icon '%s'. The '%s' theme was not found either, perhaps you need to install it. You can get a copy from: %sCould not get image height (bad TIFF file)Could not get image width (bad TIFF file)Could not get information for file '%s': %sCould not mount %sCould not read from stream: %sCould not read the contents of %sCould not read the contents of the folderCould not remove bookmarkCould not remove itemCould not rename %s back to %s: %s. Could not rename %s to %s: %s Could not rename %s to %s: %s, removing %s then. Could not retrieve information about the fileCould not select fileCould not send the search requestCould not show linkCould not start the search processCouldn't allocate memory for color profileCouldn't allocate memory for context bufferCouldn't allocate memory for headerCouldn't allocate memory for line dataCouldn't allocate memory for loading JPEG fileCouldn't allocate memory for paletted dataCouldn't allocate memory for saving BMP fileCouldn't allocate memory for streamCouldn't allocate memory to buffer image dataCouldn't convert filenameCouldn't create new pixbufCouldn't decode imageCouldn't load bitmapCouldn't load metafileCouldn't recognize the image file format for file '%s'Couldn't saveCouldn't save the restCouldn't write to BMP fileCouldn't write to TIFF fileCreate Fo_lderCreate in _folder:CreditsCursor hotspot outside imageCustom %sx%sCustom Size %dCustom sizeCyrillic (Transliterated)DISPLAYDe_lete FileDecreases the volumeDelete FileDesktopDidn't get all lines of PCX imageDimensions of TIFF image too largeDisabledDo use the Wintab API [default]Documented byDomain:Don't batch GDI requestsDon't check for the existence of index.themeDon't include image data in the cacheDon't use the Wintab API for tablet supportDuplicate object id '%s' on line %d (previously on line %d)Embed GhostScript fonts onlyEmptyError creating folder '%s': %sError creating print previewError deleting file '%s': %sError from StartDocError interpreting JPEG image file (%s)Error launching previewError loading icon: %sError parsing option --gdk-debugError parsing option --gdk-no-debugError printingError reading ICNS image: %sError renaming file "%s" to "%s": %sError renaming file "%s": %sError renaming file to "%s": %sError writing to image file: %sError writing to image streamEven sheetsExcess data in fileFLAGSFailed to close '%s' while writing image, all data may not have been saved: %sFailed to load RGB data from TIFF fileFailed to load TIFF imageFailed to load animation '%s': reason not known, probably a corrupt animation fileFailed to load iconFailed to load image '%s': %sFailed to load image '%s': reason not known, probably a corrupt image fileFailed to open '%s' for writing: %sFailed to open TIFF imageFailed to open file %s : %s Failed to open file '%s': %sFailed to open temporary fileFailed to read from temporary fileFailed to rewrite header Failed to save TIFF imageFailed to write TIFF dataFailed to write cache file: %s Failed to write folder index Failed to write hash table Failed to write header Failed to write to temporary file when loading XBM imageFailed to write to temporary file when loading XPM imageFailure reading GIF: %sFatal error in PNG image file: %sFatal error reading PNG image fileFatal error reading PNG image file: %sFileFile SystemFile System RootFile does not appear to be a GIF fileFile not found: %s FilesFinishingFol_dersFolder unreadable: %sFoldersFontFont SelectionFor portable documentsForget password _immediatelyFull VolumeGIF file was missing some data (perhaps it was truncated somehow?)GIF image has no global colormap, and a frame inside it has no local colormap.GIF image is corrupt (incorrect LZW compression)GIF image loader cannot understand this image.GIF image was truncated or incomplete.GTK+ OptionsGTK+ debugging flags to setGammaGdk debugging flags to setGeneralGetting printer information failedGetting printer information...GhostScript pre-filteringHighHold the job until it is explicitly releasedIPAIcon '%s' not present in themeIcon has zero heightIcon has zero widthImage QualityImage file '%s' contains no dataImage format unknownImage has invalid width and/or heightImage has unsupported bppImage has unsupported number of %d-bit planesImage has zero heightImage has zero widthImage header corruptImage pixel data corruptImage too large to be saved as ICOImage type '%s' is not supportedImage type currently not supportedImage-loading module %s does not export the proper interface; perhaps it's from a different GTK version?Incomplete hostname; end it with '/'Increases the volumeIncremental loading of image type '%s' is not supportedInputInput _MethodsInsufficient memory to load PNG fileInsufficient memory to load PNM context structInsufficient memory to load PNM fileInsufficient memory to load XBM image fileInsufficient memory to load image, try exiting some applications to free memoryInsufficient memory to open JPEG 2000 fileInsufficient memory to open TIFF fileInsufficient memory to save image into a bufferInsufficient memory to store a %ld by %ld image; try exiting some applications to reduce memory usageInternal error in the GIF loader (%s)Internal error: Image loader module '%s' failed to complete an operation, but didn't give a reason for the failureInuktitut (Transliterated)Invalid URIInvalid UTF-8Invalid XBM fileInvalid XPM headerInvalid argument to CreateDCInvalid argument to PrintDlgExInvalid file nameInvalid handle to PrintDlgExInvalid header in animationInvalid header in iconInvalid pathInvalid pointer to PrintDlgExInvalid root element: '%s'JPEG quality must be a value between 0 and 100; value '%d' is not allowed.JPEG quality must be a value between 0 and 100; value '%s' could not be parsed.JobJob DetailsJob PriorityKeysKeys for PNG text chunks must be ASCII characters.Keys for PNG text chunks must have at least 1 and at most 79 characters.LRE Left-to-right _embeddingLRM _Left-to-right markLRO Left-to-right _overrideLandscapeLayoutLeft to rightLeft to right, bottom to topLeft to right, top to bottomLicenseLoad additional GTK+ modulesLocationLong Edge (Standard)LowMODULESMake X calls synchronousMake all warnings fatalMalformed chunk in animationManage Custom SizesManage Custom Sizes...Margins from Printer...Margins: Left: %s %s Right: %s %s Top: %s %s Bottom: %s %sMaximum color value in PNM file is 0Maximum color value in PNM file is too largeMediumMiscellaneousModifiedNAMENameName too longNeed user interventionNew FolderNew accelerator...No XPM header foundNo extended input devicesNo item for URI '%s' foundNo items foundNo matchNo palette found at end of PCX dataNo pre-filteringNo printer foundNo recently used resource found with URI `%s'No theme index file in '%s'. If you really want to create an icon cache here, use --ignore-theme-index. No theme index file. NoneNot a valid icon cache: %s Not a valid page setup fileNot availableNot enough free memoryNot enough memory to load GIF fileNot enough memory to load ICO fileNot enough memory to load RAS imageNot enough memory to load animationNot enough memory to load bitmap imageNot enough memory to load iconNot enough memory to load imageOdd sheetsOn _holdOne SidedOnly local files may be selectedOp_acity:Open '%s'Opening %sOr_ientation:Other...Out of paperOutput TrayOutput t_ray:Overwrite an existing cache, even if up to datePDFPDF _Pop directional formattingPNG compression level must be a value between 0 and 9; value '%d' is not allowed.PNG compression level must be a value between 0 and 9; value '%s' could not be parsed.PNM file has an image height of 0PNM file has an image width of 0PNM file has an incorrect initial bytePNM file is not in a recognized PNM subformatPNM image loader does not support this PNM subformatPNM loader expected to find an integer, but didn'tPag_es:Page %uPage OrderingPage SetupPage or_dering:PagesPages Per SheetPages per SheetPages per _sheet:Pages per _side:PaperPaper MarginsPaper SizePaper SourcePaper TypePaper _source:Paper _type:Password:Path does not existPausedPaused ; Rejecting JobsPick a ColorPick a FontPlacesPortraitPosition on the color wheel.PostscriptPremature end-of-file encounteredPreparingPreparing %dPri_ority:PrintPrint DocumentPrint atPrint at timePrint to FilePrint to LPRPrint to Test PrinterPrinterPrinter '%s' has no toner left.Printer '%s' is currently off-line.Printer '%s' is low on at least one marker supply.Printer '%s' is low on developer.Printer '%s' is low on paper.Printer '%s' is low on toner.Printer '%s' is out of at least one marker supply.Printer '%s' is out of developer.Printer '%s' is out of paper.Printer '%s' may not be connected.Printer DefaultPrinter offlinePrinting %dProgram class as used by the window managerProgram name as used by the window managerProvides visual indication of progressRAS image has bogus header dataRAS image has unknown typeRLE Right-to-left e_mbeddingRLM _Right-to-left markRLO Right-to-left o_verrideRangeRaw PNM formats require exactly one whitespace before sample dataRaw PNM image type is invalidReally delete file "%s"?Received invalid color data Recently UsedRejecting JobsRemember _foreverRemember password until you _logoutRemoveRemove the bookmark '%s'Remove the selected bookmarkRename FileRename file "%s" to:Rename...ResolutionReverse landscapeReverse portraitRight to leftRight to left, bottom to topRight to left, top to bottomSCREENSVGSame as --no-wintabSans 12Save in _folder:Sc_ale:ScreenSe_lectionSearchSearch:SecretSelect A FileSelect the color you want from the outer ring. Select the darkness or lightness of that color using the inner triangle.Select which type of documents are shownSelect which types of files are shownShort Edge (Flip)Shortcut %s already existsShortcut %s does not existShow GTK+ OptionsShow _Hidden FilesShow _Private ResourcesShow _Size ColumnSi_ze:SimpleSizeSize of the palette in 8 bit modeSole completionSome of the settings in the dialog conflictSpecify one or more page ranges, e.g. 1-3,7,11Specify the time of print, e.g. 15:30, 2:35 pm, 14:15:20, 11:46:30 am, 4 pmStack overflowStandardStarting %sStatusStock labelBest _FitStock labelC_onnectStock labelCu_tStock labelDecrease IndentStock labelErrorStock labelFind and _ReplaceStock labelIncrease IndentStock labelInformationStock labelLandscapeStock labelPage Set_upStock labelPortraitStock labelPrint Pre_viewStock labelQuestionStock labelReverse landscapeStock labelReverse portraitStock labelSave _AsStock labelSelect _AllStock labelWarningStock labelZoom _InStock labelZoom _OutStock label_AboutStock label_AddStock label_ApplyStock label_AscendingStock label_BoldStock label_CD-RomStock label_CancelStock label_CenterStock label_ClearStock label_CloseStock label_ColorStock label_ConvertStock label_CopyStock label_DeleteStock label_DescendingStock label_DiscardStock label_DisconnectStock label_EditStock label_FindStock label_FloppyStock label_FontStock label_FullscreenStock label_HarddiskStock label_HelpStock label_HomeStock label_IndexStock label_InformationStock label_ItalicStock label_Jump toStock label_Leave FullscreenStock label_LeftStock label_NetworkStock label_NewStock label_NoStock label_Normal SizeStock label_OKStock label_OpenStock label_PasteStock label_PreferencesStock label_PrintStock label_PropertiesStock label_QuitStock label_RedoStock label_RefreshStock label_RemoveStock label_RevertStock label_RightStock label_SaveStock label_Spell CheckStock label_StopStock label_UndeleteStock label_UnderlineStock label_UndoStock label_YesStock label, mediaP_auseStock label, mediaPre_viousStock label, mediaR_ewindStock label, media_ForwardStock label, media_NextStock label, media_PlayStock label, media_RecordStock label, media_StopStock label, navigation_BackStock label, navigation_BottomStock label, navigation_DownStock label, navigation_FirstStock label, navigation_ForwardStock label, navigation_LastStock label, navigation_TopStock label, navigation_UpTGA image has invalid dimensionsTGA image type not supportedTIFFClose operation failedT_wo-sided:Thai-LaoThe ANI image formatThe BMP image formatThe EMF image formatThe GIF image formatThe ICNS image formatThe ICO image formatThe JPEG 2000 image formatThe JPEG image formatThe PCX image formatThe PNG image formatThe PNM/PBM/PGM/PPM image format familyThe QTIF image formatThe Sun raster image formatThe TIFF image formatThe Targa image formatThe WBMP image formatThe WMF image formatThe XBM image formatThe XPM image formatThe color you've chosen.The color you've chosen. You can drag this color to a palette entry to save it for use in the future.The cover is open on printer '%s'.The door is open on printer '%s'.The file "%s" resides on another machine (called %s) and may not be available to this program. Are you sure that you want to select it?The file already exists in "%s". Replacing it will overwrite its contents.The filename "%s" contains symbols that are not allowed in filenamesThe filename "%s" couldn't be converted to UTF-8. (try setting the environment variable G_FILENAME_ENCODING): %sThe folder contents could not be displayedThe folder could not be createdThe folder could not be created, as a file with the same name already exists. Try using a different name for the folder, or rename the file first.The folder name "%s" contains symbols that are not allowed in filenamesThe generated cache was invalid. The license of the programThe most probable reason is that a temporary file could not be created.The previously-selected color, for comparison to the color you're selecting now. You can drag this color to a palette entry, or select this color as current by dragging it to the other color swatch alongside.There is a problem on printer '%s'.This build of gdk-pixbuf does not support saving the image format: %sTigrigna-Eritrean (EZ+)Tigrigna-Ethiopian (EZ+)Time of printTop SecretTop to bottomTop to bottom, left to rightTop to bottom, right to leftTopdown BMP images cannot be compressedTransformed JPEG has zero width or height.Transformed JPEG2000 has zero width or heightTransformed PNG has unsupported number of channels, must be 3 or 4.Transformed PNG has zero width or height.Transformed PNG not RGB or RGBA.Translated byTransparency of the color.Turn off verbose outputTurns volume down or upTwo SidedType a file nameType name of new folderUnable to end processUnable to find an item with URI '%s'Unable to find include file: "%s"Unable to load image-loading module: %s: %sUnable to locate image file in pixmap_path: "%s"Unable to locate theme engine in module_path: "%s",UnclassifiedUnexpected bitdepth for colormap entriesUnexpected character data on line %d char %dUnexpected end of PNM image dataUnexpected icon chunk in animationUnexpected start tag '%s' on line %d char %dUnhandled tag: '%s'UnknownUnknown Application (pid %d)Unknown itemUnrecognized image file formatUnspecified errorUnsupported JPEG color space (%s)Unsupported animation typeUnsupported depth for ICO file: %dUnsupported icon typeUnsupported image format for GDI+Untitled filterUrgentUsername:Validate existing icon cacheValue for PNG text chunk %s cannot be converted to ISO-8859-1 encoding.Version %s of the GIF file format is not supportedVietnamese (VIQR)VolumeVolume DownVolume UpWidth or height of TIFF image is zeroWindowWritten byX Input MethodX _tilt:X display to useX screen to useXPM file has image height <= 0XPM file has image width <= 0XPM file has invalid number of colorsXPM has invalid number of chars per pixelY t_ilt:Yesterday at %H:%MYou can enter an HTML-style hexadecimal color value, or simply a color name such as 'orange' in this entry.ZWJ Zero width _joinerZWNJ Zero width _non-joinerZWS _Zero width space_Add_Add to Bookmarks_After:_All Pages_Blue:_Bottom:_Browse for other folders_Clear List_Device:_Domain:_End Process_Family:_Files_Folder name:_Format for:_Gamma value_Green:_Height:_Hue:_Insert Unicode Control Character_Left:_License_Location:_Mode:_Name:_New Folder_Now_Only print:_Open Link_Orientation:_Output format_Palette:_Paper size:_Password:_Places_Pressure:_Preview:_Red:_Remove_Remove From List_Rename_Rename File_Replace_Reverse_Right:_Saturation:_Save color here_Save in folder:_Selection: _Style:_Top:_Username:_Value:_Wheel:_Width:_X:_Y:abcdefghijk ABCDEFGHIJKcalendar year format%Ycalendar:MYcalendar:day:digits%dcalendar:week:digits%dcalendar:week_start:0default:LTRdefault:mminchinput method menuNoneinput method menuSysteminput method menuSystem (%s)keyboard labelAltkeyboard labelBackSpacekeyboard labelBeginkeyboard labelCtrlkeyboard labelDeletekeyboard labelDownkeyboard labelEndkeyboard labelEscapekeyboard labelHomekeyboard labelHyperkeyboard labelInsertkeyboard labelLeftkeyboard labelMetakeyboard labelNum_Lockkeyboard labelPage_Downkeyboard labelPage_Upkeyboard labelPausekeyboard labelPrintkeyboard labelReturnkeyboard labelRightkeyboard labelScroll_Lockkeyboard labelShiftkeyboard labelSpacekeyboard labelSuperkeyboard labelSys_Reqkeyboard labelTabkeyboard labelUpmmnoneoutput.%spaper size#10 Envelopepaper size#11 Envelopepaper size#12 Envelopepaper size#14 Envelopepaper size#9 Envelopepaper size10x11paper size10x13paper size10x14paper size10x15paper size11x12paper size11x15paper size12x19paper size5x7paper size6x9 Envelopepaper size7x9 Envelopepaper size9x11 Envelopepaper sizeA0paper sizeA0x2paper sizeA0x3paper sizeA1paper sizeA10paper sizeA1x3paper sizeA1x4paper sizeA2paper sizeA2x3paper sizeA2x4paper sizeA2x5paper sizeA3paper sizeA3 Extrapaper sizeA3x3paper sizeA3x4paper sizeA3x5paper sizeA3x6paper sizeA3x7paper sizeA4paper sizeA4 Extrapaper sizeA4x3paper sizeA4x4paper sizeA4x5paper sizeA4x6paper sizeA4x7paper sizeA4x8paper sizeA4x9paper sizeA5paper sizeA5 Extrapaper sizeA6paper sizeA7paper sizeA8paper sizeA9paper sizeB0paper sizeB1paper sizeB10paper sizeB2paper sizeB3paper sizeB4paper sizeB5paper sizeB5 Extrapaper sizeB6paper sizeB6/C4paper sizeB7paper sizeB8paper sizeB9paper sizeC0paper sizeC1paper sizeC10paper sizeC2paper sizeC3paper sizeC4paper sizeC5paper sizeC6paper sizeC6/C5paper sizeC7paper sizeC7/C6paper sizeC8paper sizeC9paper sizeFoliopaper sizeIndex 3x5paper sizeIndex 4x6 (postcard)paper sizeIndex 4x6 extpaper sizeIndex 5x8paper sizeInvite Envelopepaper sizeInvoicepaper sizeItalian Envelopepaper sizeJB0paper sizeJB1paper sizeJB10paper sizeJB2paper sizeJB3paper sizeJB4paper sizeJB5paper sizeJB6paper sizeJB7paper sizeJB8paper sizeJB9paper sizePersonal Envelopepaper sizeRA0paper sizeRA1paper sizeRA2paper sizeSRA0paper sizeSRA1paper sizeSRA2paper sizeSmall Photopaper sizeSuper Apaper sizeSuper Bpaper sizeWide Formatpaper sizea2 Envelopepaper sizeb-pluspaper sizecpaper sizec5 Envelopepaper sizedpaper sizeepaper sizefpaper sizeprc1 Envelopepaper sizeprc10 Envelopepaper sizeprc2 Envelopepaper sizeprc3 Envelopepaper sizeprc4 Envelopepaper sizeprc5 Envelopepaper sizeprc6 Envelopepaper sizeprc7 Envelopepaper sizeprc8 Envelopepausedprint operation statusBlocking on issueprint operation statusFinishedprint operation statusFinished with errorprint operation statusGenerating dataprint operation statusInitial stateprint operation statusPreparing to printprint operation statusPrintingprint operation statusSending dataprint operation statusWaitingprinter offlineprocessing jobprogress bar label%d %%ready to printrecent menu label%d. %srecent menu label_%d. %stest-output.%sunknownunsupported RAS image variationvolume percentage%d %%year measurement template2000Project-Id-Version: gtk+ 2.6-branch Report-Msgid-Bugs-To: POT-Creation-Date: 2010-06-10 11:56-0400 PO-Revision-Date: 2010-02-26 21:10+0200 Last-Translator: F Wolff Language-Team: translate-discuss-af@lists.sourceforge.net MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Language: af Plural-Forms: nplurals=2; plural=(n != 1); X-Generator: Virtaal 0.5.2 "Diepte" van die kleur.%1$s op %2$s%H:%M%s: taak #%d(geen)(gedeaktiveer)(onbekend)--- Geen wenk ---'n Lêer genaamd "%s" bestaan reeds. Wil jy dit vervang?_Om:Aangaande %sGedeaktiveerOngeldigVoeg dekblad byVoeg die huidige gids by die boekmerkeVoeg die gids '%s' by die boekmerkeVoeg die geselekteerde gids by die boekmerkeVoeg die geselekteerde gidse by die boekmerkeStel die volumeGevorderdNáAlle bladsyeAmharies (EZ+)Hoeveelheid blou lig in die kleur.Hoeveelheid groen lig in die kleur.Hoeveelheid rooi lig in die kleur.Enige drukkerToepassingKuns deurKies outomatiesAsseBMP-beeld het vals kopdataBMP-beeld het nie-ondersteunde kopgrootteSlegte kode teëgekom_Voor:VoorBisse per kanaal van PNG-beeld is ongeldig.Bisse per kanaal van getransformeerde PNG is nie 8 nie.Boekmark '%s' kan nie verwyder word nieOnder na boOnder na bo, links na regsOnder na bo, regs na linksHelderheid van die kleur.KLASKLEUREIns_orteerS_kep_BedankingsH_uidige bladsyKaslêer suksesvol geskep. Kan nie TGA-kop-geheue toewys nieKan nie kleurkaart-inskrywings toewys nieKan nie kleurkaartstruktuur toewys nieKan nie geheue vir IOBuffer-data toewys nieKan nie geheue vir IOBuffer-struktuur toewys nieKan nie geheue vir TGA-konteksstruktuur toewys nieKan nie geheue toewys vir laai van PNM-beeld nieKan nie geheue toewys vir laai van XPM-beeld nieKan nie nuwe pixbuf toewys nieKan nie tydelike IOBuffer-data toewys nieKan nie verander na die gids nie omdat dit nie plaaslik is nieKan nie proses met pid %d beëindig nie: %sKan nie vertoon open nie: %sKan nie XPM-kleurkaart lees nieKan nie IOBuffer-data hertoewys nieCaps-lock is aanCedillaSirkulêre tabelinskrywing in GIF-lêer_Maak skoonGeklassifiseerdKliek die oogdrupper, kliek dan 'n kleur enige plek op die skerm om daardie kleur te kies.Klik hierdie paletinskrywing om dit die huidige kleur te maak. Om hierdie inskrywing te verander, sleep 'n kleurmonster hier of klik regs en selekteer "Stoor kleur hier".K_oppelKleurKleurkeuseKleurwielKleur_naam:Kleurprofiel het 'n ongeldige lengte van %d.OpdraglynVolledig, maar nie uniek nieProbeer te voltooi...Saamgepersde ikone word nie ondersteun nieKonfidensieelKoppel _anoniemKoppel as _gebruiker:Skakel om na PS-vlak 1Skakel om na PS-vlak 2Kopi_eëKopieëKopieer URLKopieer _skakeladresKopieer _liggingKon nie 'n boekmerk byvoeg nieKon nie geheue toewys nie: %sKon nie lys skoonmaak nieKon nie stroom skep nie: %sKon nie ICNS-lêer dekodeer nieKon nie ikoon '%s' vind nie. Die '%s'-tema is ook nie gevind nie; miskien moet jy dit installeer. Jy kan 'n kopie kry by: %sKon nie beeldhoogte kry nie (slegte TIFF-lêer)Kon nie beeldwydte kry nie (slegte TIFF-lêer)Kon nie inligting bekom vir lêer '%s' nie: %sKon nie %s monteer nieKon nie van stroom lees nie: %sKon nie die inhoud van %s lees nieKon nie die inhoud van die gids lees nieKon nie boekmerk verwyder nieKon nie item skrap nieKon nie %s terug hernoem na %s nie: %s Kon nie %s hernoem na %s nie: %s Kon nie %s hernoem na %s nie: %s, verwyder nou maar %s. Kon nie inligting oor die lêer bekom nieKon nie die lêer kies nieKon nie die soekversoek stuur nieKon nie skakel wys nieKon nie die soekproses begin nieKon nie geheue toewys vir kleurprofiel nieKon nie geheue vir konteksbuffer toewys nieKon nie geheue vir kop toewys nieKon nie geheue vir lyndata toewys nieKon nie geheue toewys vir laai van JPEG-lêer nieKon nie geheue gepaletteerde-data toewys nieKon nie geheue toewys vir stoor van BMP-lêer nieKon nie geheue vir stroom toewys nieKon nie geheue toewys om beelddata te buffer nieKon nie lêernaam omsit nieKon nie nuwe pixbuf skep nieKon nie beeld dekodeer nieKon nie biskaart laai nieKon nie metalêer laai nieKon nie die beeldlêer-formaat vir lêer '%s' herken nieKon nie stoor nieKon nie die res stoor nieKon nie na BMP-lêer skryf nieKon nie skryf na TIFF-lêer nieSkep _gidsSkep in _gids:BedankingsWyser-responskol buite beeldEie %sx%sPasgemaakte grootte %dPasgemaakte grootteCyrillies (getranslitereer)VERTOONSkr_ap LêerVerminder die volumeSkrap lêerWerkskermHet nie al die lyne van PCX-beeld gevind nieDimensies van TIFF-beeld te grootGedeaktiveerGebruik wel die Wintab API [verstek]Gedokumenteer deurDomein:Moenie GDI-navrae in bondels verwerk nieMoenie kontroleer vir die bestaan van index.theme nieMoenie beelddata insluit in die kas nieMoenie die Wintab API vir tabletsteun gebruik nieDuplikaat objek-ID '%s' op lyn %d (vantevore op lyn %d)Bed slegs GhostScript-lettertipes inLeegFout met skep van gids '%s': %sFout met skep van drukvoorskouFout met skrap van lêer '%s': %sFout vanaf StartDocFout met interpretasie van JPEG-beeldlêer (%s)Fout met wys van voorskouFout met laai van ikoon: %sFout met ontleding van opsie --gdk-debugFout met ontleding van opsie --gdk-no-debugFout tydens drukFout met lees van ICNS-beeld: %sFout met hernoem van lêer "%s" na "%s": %sFout met hernoem van lêer "%s": %sFout met hernoem van lêer na "%s": %sFout met skryf na beeldlêer: %sFout met skryf na beeldstroomEwe bladsyeOortollige data in lêerVLAGGIESKon nie '%s' sluit terwyl beeld geskryf is nie, alle data is dalk nie gestoor nie: %sKon nie RGB-data laai vanaf TIFF-lêer nieKon nie TIFF-beeld laai nieKon nie animasie '%s' laai nie: rede onbekend, moontlik 'n korrupte animasie-lêerKon nie ikoon laai nieKon nie beeld '%s' laai nie: %sKon nie beeld '%s' laai nie: rede onbekend, moontlik 'n korrupte beeldlêerKon nie '%s' open vir skryfwerk nie: %sKon nie TIFF-beeld open nieKon nie lêer '%s' open nie: %s Kon nie lêer '%s' open nie: %sKon nie tydelike lêer open nieKon nie vanaf tydelike lêer lees nieKon nie kop herskryf nie Kon nie TIFF-beeld stoor nieKon nie TIFF-beeld skryf nieKon nie kaslêer skryf nie: %s Kon nie gidsindeks skryf nie Kon nie hutstabel skryf nie Kon nie kop skryf nie Kon nie na tydelike lêer skryf tydens laai van XBM-beeld nieKon nie na tydelike lêer skryf tydens laai van XPM-beeld nieKon nie GIF lees nie: %sFatale fout in PNG-beeldlêer: %sFatale fout met lees van PNG-beeldlêerFatale fout met lees van PNG-beeldlêer: %sLêerLêerstelselLêerstelselwortelLêer blykbaar nie 'n GIF-lêer nieLêer nie gevind nie: %s LêersAfwerkingGi_dseGids onleesbaar: %sGidseLettertipeLettertipeseleksieVir oordraagbare dokumenteVergeet wagwoord _dadelikVol volumeGIF-lêer het sommige data gekort (dalk is dit op 'n manier afgeknot?)GIF-beeld het geen globale kleurkaart nie, en 'n raam binne-in het geen plaaslike kleurkaart nie.GIF-beeld is korrup (verkeerde LZW-saampersing)GIF-beeldlaaier kan nie hierdie beeld verstaan nie.GIF-beeld was afgeknot of onvolledig.GTK+-keusesGTK+-ontfoutvlaggies om te gebruikGammaGdk-ontfoutvlaggies om te gebruikAlgemeenKon nie drukkerinligting kry nieKry tans drukkerinligting...GhostScript-voor-filtreringHoogHou die taak totdat dit eksplisiet vrygestel wordIPAIkoon '%s' nie aanwesig in tema nieIkoon het zero hoogteIkoon het zero wydteBeeldkwaliteitBeeldlêer '%s' bevat geen data nieBeeldformaat onbekendBeeld het ongeldige wydte en/of hoogteBeeld het nie-ondersteunde bppBeeld het nie-ondersteunde aantal %d-bis-vlakkeBeeld het zero hoogteBeeld het zero wydteBeeldkop korrupBeeld-pixeldata korrupBeeld te groot om as ICO gestoor te wordBeeldtipe '%s' word nie ondersteun nieBeeldtipe word nie tans ondersteun nieBeeldlaai-module %s voer nie die regte koppelvlak uit nie; miskien is dit van 'n verskillende GTK-weergawe?Onvolledige gasheernaam; beëindig dit met '/'Vermeerder die volumeStuksgewyse laai van beeldtipe '%s' word nie ondersteun nieToevoerToevoer_metodesOnvoldoende geheue om PNG-lêer te laaiOnvoldoende geheue om PNM-konteksstruktuur te laaiOnvoldoende geheue om PNM-lêer te laaiOnvoldoende geheue om XBM-beeldlêer te laaiOnvoldoende geheue om beeld te laai. Probeer om sommige toepassings af te sluit om geheue vry te stel.Onvoldoende geheue om JPEG 2000-lêer te openOnvoldoende geheue om TIFF-lêer te openOnvoldoende geheue om beeld binne in 'n buffer te stoorOnvoldoende geheue om 'n %ld by %ld beeld te stoor; probeer om sommige toepassings af te sluit om geheuegebruik te verminderInterne fout in die GIF-laaier (%s)Interne fout: Beeldlaaier-module '%s' het misluk om 'n bewerking te voltooi, maar het nie 'n rede verskaf vir die mislukking nieInuktitut (getranslitereer)Ongeldige URIOngeldige UTF-8Ongeldige XBM-lêerOngeldige XBM-kopOngeldige argument na CreateDCOngeldige argument na PrintDlgExOngeldige lêernaamOngeldige handvatsel na PrintDlgExOngeldige kop in animasieOngeldige kop in ikoonOngeldige padOngeldige wyser na PrintDlgExOngeldige wortel-element: %sJPEG-kwaliteit moet 'n waarde tussen 0 en 100 wees; waarde '%d' word nie toegelaat nie.JPEG-kwaliteit moet 'n waarde tussen 0 en 100 wees; waarde '%s' kon nie ontleed word nie.TaakTaakdetailTaakprioriteitSleutelsSleutels vir PNG-teksbrokke moet ASCII karakters wees.Sleutels vir PNG-teksbrokke moet ten minste 1 en hoogstens 79 karakters hê.LRE Links-na-regs-_inbeddingLRM _Links-na-regs-merkLRO Links-na-regs-_oorheersLandskapUitlegLinks na regsLinks na regs, onder na boLinks na regs, bo na onderLisensieLaai addisionele GTK+-modulesLiggingLang kant (standaard)LaagMODULESMaak X-roepe sinchroniesMaak alle waarskuwings fataalMisvormde brok in animasieBestuur pasgemaakte groottesBestuur pasgemaakte groottes...Kantlyne vanaf drukker...Kantlyne: Links: %s %s Regs: %s %s Bo: %s %s Onder: %s %sMaksimum kleurwaarde in PNM-lêer is 0Maksimum kleurwaarde in PNM-lêer is te grootMediumAllerleiVeranderNAAMNaamNaam te lankBenodig gebruiker se aandagNuwe gidsNuwe kortpadsleutel...Geen XPM-kop gevind nieGeen uitgebreide toevoertoestelle nieGeen item vir URI '%s' gevind nieGeen items gevind nieNiks wat pasGeen palet gevind aan einde van PCX-data nieGeen filtrering vooraf nieGeen drukker gevind nieGeen onlangs gebruikte hulpbron gevind met URI `%s' nieGeen indekslêer vir tema in '%s' nie. As u definitief 'n ikoonkas hier wil skep, gebruik --ignore-theme-index Geen indekslêer vir tema nie. GeenNie 'n geldige ikoonkas nie: %s Nie 'n geldige bladsyopstellingslêer nieNie beskikbaar nieNie genoeg beskikbare geheue nieNie genoeg geheue om GIF-lêer te laai nieNie genoeg geheue om ICO-lêer te laai nieNie genoeg geheue om RAS-beeld te laai nieNie genoeg geheue om animasie te laai nieNie genoeg geheue om biskaart-beeld te laai nieNie genoeg geheue om ikoon te laai nieNie genoeg geheue om beeld te laai nieOnewe bladsye_LaterEen kantSlegs plaaslike lêers kan gekies word_Ondeursigtigheid:Open '%s'Open tans %sOr_iëntasie:Ander...Papier is opAfvoerrakkieAfvoer_rakkie:Oorskryf 'n bestaande kas, selfs as dit op datum isPDFPDF _Pop rigtingformateringPNG-saampersvlak moet 'n waarde tussen 0 en 9 wees; waarde '%d' word nie toegelaat nie.PNG-saampersvlak moet 'n waarde tussen 0 en 9 wees; waarde '%s' kon nie ontleed word nie.PNM-lêer het 'n beeldhoogte van 0PNM-lêer het 'n beeldwydte van 0PNM-lêer het 'n foutiewe aanvanklike greepPNM-lêer is nie in 'n erkende PNM-subformaat niePNM-beeldlaaier ondersteun nie hierdie PNM-subformaat niePNM-laaier het verwag om 'n heelgetal te vind, maar het nieBladsy_e:Bladsy %uBladsyvolgordeBladsyopstellingBladsy_volgorde:BladsyeBladsye per velBladsye per velBladsye per _vel:Bladsye per _kant:PapierPapierkantlynepapiergroottePapierbronPapiertipePapier_bron:Papier_tipe:Wagwoord:Pad bestaan nieWagtendWagtend ; weier tans takeKies 'n kleurKies 'n lettertipePlekkePortretPosisie op die kleurwiel.PostscriptVoortydige einde-van-lêer teëgekomBerei tans voorBerei tans %d voorPri_oriteit:DrukDruk dokumentDruk omDruk om tydDruk na lêerDruk na LPRDruk na toetsdrukkerDrukkerDie drukker '%s' se ink is op.Die drukker '%s' is tans vanlyn.Ten minste een van drukker '%s' se kleure is min.Die drukker '%s' se foto-ontwikkelaar is min.Die drukker '%s' se papier is min.Die drukker '%s' se ink is min.Ten minste een van drukker '%s' se kleure is op.Die drukker '%s' se foto-ontwikkelaar is op.Die drukker '%s' se papier is op.Die drukker '%s' is dalk nie gekoppel nie.Drukker se verstekDrukker vanlynDruk tans %dProgramklas soos deur vensterbestuurder gebruikProgramnaam soos deur die vensterbestuurder gebruikVerskaf visuele aanduiding van vorderingRAS-beeld het vals kopdataRAS-beeld het onbekende tipeRLE Regs-na-links-i_nbeddingRLM _Regs-na-links-merkRLO Regs-na-links-oo_rheersOmvangRou PNM-formaat vereis presies een witspasie voor monster-dataRou PNM-beeldtipe is ongeldigMoet lêer "%s" rêrig geskrap word?Het ongeldige kleurdata ontvang Onlangs gebruikWeier tans takeOnthou wagwoord vir _altydOnthou wagwoord tot by _afmeldingVerwyderVerwyder die boekmerk '%s'Verwyder die geselekteerde boekmerkHernoem lêerHernoem lêer "%s" na:Hernoem...ResolusieOmgekeerde landskapOmgekeerde portretRegs na linksRegs na links, onder na boRegs na links, bo na onderSKERMSVGSelfde as --no-wintabSans 12Stoor in _gids:Sk_aal:SkermSe_leksieSoekSoek:GeheimKies 'n lêerKies die gewenste kleur uit die buitenste sirkel. Kies hoe donker of lig die kleur moet wees met die binneste driehoek.Kies watter dokumenttipes gewys wordKies watter lêertipes vertoon wordKort kant (swaai om)Kortpad %s bestaan reedsKortpad %s bestaan nieWys GTK+-keusesWys _versteekte lêersWys _privaat hulpbronneWys kolom met _groottes_Grootte:EenvoudigGrootteGrootte van die palet in 8-bismodusEnigste passingSommige instellings weerspreek mekaarSpesifiseer een of meer bladsyomvange, bv. 1-3,7,11Spesifiseer die druktyd, bv. 15:30, 14:15:20Stapel oorloopStandaardBegin tans %sStatusBeste _passingK_oppelK_nipVerklein keepFoutVind en _vervangVergroot keepInligtingLandskapBladsy_opstellingPortretDruk_voorskouVraagOmgekeerde landskapOmgekeerde portretStoor _asSelekteer _allesWaarskuwingZoem _inZoem _uit_Aangaande_Voeg byP_as toe_Stygend_Vetdruk_CD-Rom_Kanselleer_Middel_Maak skoon_Sluit_KleurOmskakel_Kopieer_Skrap_Dalend_VerwerpO_ntkoppelR_edigeer_Vind_Slapskyf_Lettertipe_Volskerm_Hardeskyf_Hulp_Tuis_Indeks_Inligting_Skuins_Spring naVer_laat volskerm_Links_Netwerk_Nuwe_Nee_Normale grootte_OK_Open_Plak_Voorkeure_Druk_Eienskappe_Sluit afHe_rdoenVe_rfrisVe_rwyderKeer te_rug_Regs_Stoor_Speltoets_Stop_Ontskrap_Onderstreep_Ontdoen_JaLaat w_ag_VorigeDraai t_erug_VorentoeVo_lgendeS_peel_Neem op_Stop_Terug_Onder_Af_Eerste_Vorentoe_Laaste_Bo_OpTGA-beeld het ongeldige dimensiesTGA-beeldtipe word nie ondersteun nieTIFFClose-bewerking het misluk_Albei kante:Thai-LaoDie ANI-beeldformaatDie BMP-beeldformaatDie EMF-beeldformaatDie GIF-beeldformaatDie ICNS-beeldformaatDie ICO-beeldformaatDie JPEG 2000-beeldformaatDie JPEG-beeldformaatDie PCX-beeldformaatDie PNG-beeldformaatDie PNM/PBM/PGM/PPM-beeldformaat-familieDie QTIF-beeldformaatDie Sun raster-beeldformaatDie TIFF-beeldformaatDie Targa-beeldformaatDie WBMP-beeldformaatDie WMF-beeldformaatDie XBM-beeldformaatDie XPM-beeldformaatDie kleur wat u gekies het.Die kleur wat geselekteer is. Sleep hierdie kleurmonster na 'n paletinskrywing om dit vir toekomstige gebruik te stoor.Die deksel is oop op drukker '%s'.Die deur is oop op drukker '%s'.Die lêer "%s" is op 'n ander masjien (genoem %s) en is moontlik nie beskikbaar vir hierdie program nie. Wil u dit definitief selekteer?Die lêer bestaan reeds in "%s". Vervanging sal die inhoud oorskryf.Die lêernaam "%s" bevat simbole wat nie toegelaat word in lêername nieDie lêernaam "%s" kon nie omgesit word na UTF-8 nie. (probeer die omgewings-veranderlike G_FILENAME_ENCODING instel): %sDie gidsinhoud kon nie vertoon word nieDie gids kon nie geskep word nieDie gids kon nie geskep word nie omdat 'n lêer met die selfde naam reeds bestaan. Probeer om 'n ander naam vir die gids te gebruik, of hernoem die lêer eers.Die gidsnaam "%s" bevat simbole wat nie toegelaat word in lêername nieDie gegenereerde kas was ongeldig. Die lisensie van die programDie mees waarskynlike rede is dat 'n tydelike lêer nie geskep kon word nie.Die voorheen geselekteerde kleur, vir vergelyking met die kleur wat nou geselekteer word. Hierdie kleur kan na 'n paletinskrywing gesleep word, of as huidige kleur geselekteer word deur dit te sleep na die ander kleurmonster hier langsaan.Daar is 'n probleem by drukker '%s'.Hierdie bou van gdk-pixbuf ondersteun nie die stoor van die beeldformaat %s nieTigrinya-Eritrees (EZ+)Tigrinya-Ethiopies (EZ+)DruktydHoogs geheimBo na onderBo na onder, links na regsBo na onder, regs na linksBo-na-onder BMP-beelde kan nie saamgepers word nieGetransformeerde JPEG het zero wydte of hoogte.Getransformeerde JPEG2000 het zero wydte of hoogte.Getransformeerde PNG het nie-ondersteunde aantal kanale, moet 3 of 4 wees.Getransformeerde PNG het zero wydte of hoogte.Getransformeerde PNG is nie RGB of RGBA nie.Vertaal deurDeursigtigheid van die kleur.Skakel spraaksame afvoer afDraai die volume harder of sagterAlbei kanteTik 'n lêernaamTik naam van nuwe gidsKon nie proses beëindig nieKon nie 'n item vind met URI '%s' nieKon nie insluit-lêer: "%s" vind nieKan nie beeldlaai-module laai nie: %s: %sKon nie beeldlêer in pixmap_pad: "%s" vind nieKan nie tema-enjin vind in module _pad: "%s",OngeklassifiseerdOnverwagte bisdiepte vir kleurkaartinskrywingsOnverwagte karakter-data op lyn %d karakter %dOnverwagte einde van PNM-beeld-dataOnverwagte ikoon-brok in animasieOnverwagte beginetiket '%s' op lyn %d karakter %dNie-hanteerde etiket: '%s'OnbekendOnbekende toepassing (pid %d)Onbekende itemOnbekende beeldlêer-formaatOngespesifiseerde foutNie-ondersteunde JPEG-kleurspasie (%s)Nie-ondersteunde animasie-tipeNie-ondersteunde diepte vir ICO-lêer: %dNie-ondersteunde ikoon-tipeNie-ondersteunde beeldformaat vir GDI+Naamlose filterDringendGebruikernaam:Valideer bestaande ikoonkasWaarde vir PNG-teksbrok %s kan nie omgesit word na ISO-8859-1 enkodering nie.Weergawe %s van die GIF-lêer word nie ondersteun nieViëtnamees (VIQR)VolumeVolume sagterVolume harderWydte of hoogte van TIFF-beeld is zeroVensterGeskryf deurX-toevoermetodeX-_kanteling:X-vertoon om te gebruikX-skerm om te gebruikXPM-lêer het beeldhoogte <= 0XPM-lêer het beeldwydte <= 0XPM-lêer het 'n ongeldige aantal kleureXPM het 'n ongeldige hoeveelheid aantal karakters per pixelY-k_anteling:Gister om %H:%MJy kan 'n HTML-styl heksadesimale kleurwaarde intik, of slegs 'n kleurnaam soos bv. 'oranje' in hierdie inskrywing.ZWJ Zero wydte _samesmelterZWNJ Zero wydte _nie-samesmelterZWS _Zero wydte spasie_Voeg by_Voeg by boekmerke_Ná:_Alle bladsye_Blou:_Onder:_Blaai vir ander gidse_Maak lys skoon_Toestel:_Domein:B_eëindig proses_Familie:_Lêers_Gidsnaam:_Formateer vir:_Gammawaarde_Groen:_Hoogte:_Tint:_Voer Unicode-beheerkarakter in_Links:_Lisensie_Ligging:_Modus:_Naam:_Nuwe gids_Nou_Druk slegs:_Open skakel_Oriëntasie:Afv_oerformaat_Palet:_Papiergrootte:_Wagwoord:_Plekke_Druk:_Voorskou:_Rooi:Ve_rwyderSk_rap vanaf lysHe_rnoemHe_rnoem LêerVe_rvangAgterstevoo_r_Regs:_Versadiging:_Stoor kleur hier_Stoor in gids:_Seleksie: _Styl:_Bo:Gebr_uikernaam:_Waarde:_Wiel:_Wydte:_X:_Y:abcdeêëéfghijk ABCDEÊËÉFGHIJK%Ycalender:MY%d%dcalendar:week_start:1default:LTRdefault:mmduimGeenStelselStelsel (%s)AltBackspaceBeginCtrlDeleteAfEndEscapeTuisHiperInsertLinksMetaNum_LockBladsy_afBladsy_opPauseDrukEnterRegsScroll_LockShiftSpasieSuperSys_ReqTabOpmmgeenafvoer.%s#10-koevert#11-koevert#12-koevert#14-koevert#9-koevert10x1110x1310x1410x1511x1211x1512x195x76x9-koevert7x9-koevert9x11-koevertA0A0x2A0x3A1A10A1x3A1x4A2A2x3A2x4A2x5A3A3 ekstraA3x3A3x4A3x5A3x6A3x7A4A4 ekstraA4x3A4x4A4x5A4x6A4x7A4x8A4x9A5A5 ekstraA6A7A8A9B0B1B10B2B3B4B5B5 ekstraB6B6/C4B7B8B9C0C1C10C2C3C4C5C6C6/C5C7C7/C6C8C9FolioIndeks 3x5Indeks 4x6 (poskaart)Indeks 4x6 extIndeks 5x8UitnodigingskoevertFaktuurItaliaanse koevertJB0JB1JB10JB2JB3JB4JB5JB6JB7JB8JB9Persoonlike koevertRA0RA1RA2SRA0SRA1SRA2Klein fotoSuper ASuper BWye formaata2-koevertb-pluscc5-koevertdefprc1-koevertprc10-koevertprc2-koevertprc3-koevertprc4-koevertprc5-koevertprc6-koevertprc7-koevertprc8-koevertwagtendGeblok tans weens probleemKlaarKlaar met foutGenereer tans dataAanvanklike toestandBerei tans voor om te drukDruk tansStuur tans dataWag tansdrukker vanlynverwerk tans taak%d%%gereed om te druk%d. %s_%d. %stoets-afvoer.%sonbekendnie-ondersteunde RAS-beeldvariasie%d%%2000PK01]Lb>>&>->?,7?*d?*?*?)?/@&?@&f@W@Y@"?A!bA+A1A9A;B$XB}BB>BBC!!C%CCiCCCCCCCD"D8DMD(bDDDDDDEE*EO?E2E/E3EJ&F.qF,F)F.F#&G!JGlG&GG)GG&HM5~\@ MtcoBfbYJO:p7m8{=sewDLKzh'qCa X/[0S;&]3(kUlI^4 d_.W|En*T+u1r 2G<j QiH`Zg}yBMP image has bogus header dataBMP image has unsupported header sizeBad code encounteredBits per channel of PNG image is invalid.Bits per channel of transformed PNG is not 8.Cannot allocate TGA header memoryCannot allocate colormap entriesCannot allocate colormap structureCannot allocate memory for IOBuffer dataCannot allocate memory for IOBuffer structCannot allocate memory for TGA context structCannot allocate memory for loading PNM imageCannot allocate memory for loading XPM imageCannot allocate new pixbufCannot allocate temporary IOBuffer dataCannot read XPM colormapCannot realloc IOBuffer dataCircular table entry in GIF fileColor profile has invalid length %d.Compressed icons are not supportedCould not allocate memory: %sCould not create stream: %sCould not decode ICNS fileCould not get image height (bad TIFF file)Could not get image width (bad TIFF file)Could not read from stream: %sCouldn't allocate memory for color profileCouldn't allocate memory for context bufferCouldn't allocate memory for headerCouldn't allocate memory for line dataCouldn't allocate memory for loading JPEG fileCouldn't allocate memory for saving BMP fileCouldn't allocate memory for streamCouldn't allocate memory to buffer image dataCouldn't create new pixbufCouldn't decode imageCouldn't load bitmapCouldn't load metafileCouldn't recognize the image file format for file '%s'Couldn't saveCouldn't save the restCouldn't write to BMP fileCouldn't write to TIFF fileCursor hotspot outside imageDidn't get all lines of PCX imageDimensions of TIFF image too largeError interpreting JPEG image file (%s)Error reading ICNS image: %sError writing to image file: %sError writing to image streamExcess data in fileFailed to close '%s' while writing image, all data may not have been saved: %sFailed to load RGB data from TIFF fileFailed to load TIFF imageFailed to load animation '%s': reason not known, probably a corrupt animation fileFailed to load image '%s': %sFailed to load image '%s': reason not known, probably a corrupt image fileFailed to open '%s' for writing: %sFailed to open TIFF imageFailed to open file '%s': %sFailed to open temporary fileFailed to read from temporary fileFailed to save TIFF imageFailed to write TIFF dataFailed to write to temporary file when loading XBM imageFailed to write to temporary file when loading XPM imageFailure reading GIF: %sFatal error in PNG image file: %sFatal error reading PNG image fileFatal error reading PNG image file: %sFile does not appear to be a GIF fileGIF file was missing some data (perhaps it was truncated somehow?)GIF image has no global colormap, and a frame inside it has no local colormap.GIF image is corrupt (incorrect LZW compression)GIF image loader cannot understand this image.GIF image was truncated or incomplete.Icon has zero heightIcon has zero widthImage file '%s' contains no dataImage format unknownImage has invalid width and/or heightImage has unsupported bppImage has unsupported number of %d-bit planesImage has zero heightImage has zero widthImage header corruptImage pixel data corruptImage too large to be saved as ICOImage type '%s' is not supportedImage type currently not supportedIncremental loading of image type '%s' is not supportedInsufficient memory to load PNG fileInsufficient memory to load PNM context structInsufficient memory to load PNM fileInsufficient memory to load XBM image fileInsufficient memory to load image, try exiting some applications to free memoryInsufficient memory to open JPEG 2000 fileInsufficient memory to open TIFF fileInsufficient memory to save image into a bufferInsufficient memory to store a %ld by %ld image; try exiting some applications to reduce memory usageInternal error in the GIF loader (%s)Internal error: Image loader module '%s' failed to complete an operation, but didn't give a reason for the failureInvalid XBM fileInvalid XPM headerInvalid header in animationInvalid header in iconJPEG quality must be a value between 0 and 100; value '%d' is not allowed.JPEG quality must be a value between 0 and 100; value '%s' could not be parsed.Keys for PNG text chunks must be ASCII characters.Keys for PNG text chunks must have at least 1 and at most 79 characters.Malformed chunk in animationMaximum color value in PNM file is 0Maximum color value in PNM file is too largeNo XPM header foundNo palette found at end of PCX dataNot enough memory to load GIF fileNot enough memory to load ICO fileNot enough memory to load RAS imageNot enough memory to load animationNot enough memory to load bitmap imageNot enough memory to load iconNot enough memory to load imagePNG compression level must be a value between 0 and 9; value '%d' is not allowed.PNG compression level must be a value between 0 and 9; value '%s' could not be parsed.PNM file has an image height of 0PNM file has an image width of 0PNM file has an incorrect initial bytePNM file is not in a recognized PNM subformatPNM image loader does not support this PNM subformatPNM loader expected to find an integer, but didn'tPremature end-of-file encounteredRAS image has bogus header dataRAS image has unknown typeRaw PNM formats require exactly one whitespace before sample dataRaw PNM image type is invalidStack overflowTGA image has invalid dimensionsTGA image type not supportedTIFFClose operation failedThe ANI image formatThe BMP image formatThe EMF image formatThe GIF image formatThe ICNS image formatThe ICO image formatThe JPEG 2000 image formatThe JPEG image formatThe PCX image formatThe PNG image formatThe PNM/PBM/PGM/PPM image format familyThe QTIF image formatThe Sun raster image formatThe TIFF image formatThe Targa image formatThe WBMP image formatThe WMF image formatThe XBM image formatThe XPM image formatThis build of gdk-pixbuf does not support saving the image format: %sTopdown BMP images cannot be compressedTransformed JPEG has zero width or height.Transformed JPEG2000 has zero width or heightTransformed PNG has unsupported number of channels, must be 3 or 4.Transformed PNG has zero width or height.Transformed PNG not RGB or RGBA.Unable to load image-loading module: %s: %sUnexpected bitdepth for colormap entriesUnexpected end of PNM image dataUnexpected icon chunk in animationUnrecognized image file formatUnsupported JPEG color space (%s)Unsupported animation typeUnsupported depth for ICO file: %dUnsupported icon typeUnsupported image format for GDI+Value for PNG text chunk %s cannot be converted to ISO-8859-1 encoding.Version %s of the GIF file format is not supportedWidth or height of TIFF image is zeroXPM file has image height <= 0XPM file has image width <= 0XPM file has invalid number of colorsXPM has invalid number of chars per pixelunsupported RAS image variationProject-Id-Version: gtk+ 2.6-branch Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?product=gdk-pixbuf POT-Creation-Date: 2012-02-04 18:44-0500 PO-Revision-Date: 2010-02-26 21:10+0200 Last-Translator: F Wolff Language-Team: translate-discuss-af@lists.sourceforge.net Language: af MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=(n != 1); X-Generator: Virtaal 0.5.2 BMP-beeld het vals kopdataBMP-beeld het nie-ondersteunde kopgrootteSlegte kode teëgekomBisse per kanaal van PNG-beeld is ongeldig.Bisse per kanaal van getransformeerde PNG is nie 8 nie.Kan nie TGA-kop-geheue toewys nieKan nie kleurkaart-inskrywings toewys nieKan nie kleurkaartstruktuur toewys nieKan nie geheue vir IOBuffer-data toewys nieKan nie geheue vir IOBuffer-struktuur toewys nieKan nie geheue vir TGA-konteksstruktuur toewys nieKan nie geheue toewys vir laai van PNM-beeld nieKan nie geheue toewys vir laai van XPM-beeld nieKan nie nuwe pixbuf toewys nieKan nie tydelike IOBuffer-data toewys nieKan nie XPM-kleurkaart lees nieKan nie IOBuffer-data hertoewys nieSirkulêre tabelinskrywing in GIF-lêerKleurprofiel het 'n ongeldige lengte van %d.Saamgepersde ikone word nie ondersteun nieKon nie geheue toewys nie: %sKon nie stroom skep nie: %sKon nie ICNS-lêer dekodeer nieKon nie beeldhoogte kry nie (slegte TIFF-lêer)Kon nie beeldwydte kry nie (slegte TIFF-lêer)Kon nie van stroom lees nie: %sKon nie geheue toewys vir kleurprofiel nieKon nie geheue vir konteksbuffer toewys nieKon nie geheue vir kop toewys nieKon nie geheue vir lyndata toewys nieKon nie geheue toewys vir laai van JPEG-lêer nieKon nie geheue toewys vir stoor van BMP-lêer nieKon nie geheue vir stroom toewys nieKon nie geheue toewys om beelddata te buffer nieKon nie nuwe pixbuf skep nieKon nie beeld dekodeer nieKon nie biskaart laai nieKon nie metalêer laai nieKon nie die beeldlêer-formaat vir lêer '%s' herken nieKon nie stoor nieKon nie die res stoor nieKon nie na BMP-lêer skryf nieKon nie skryf na TIFF-lêer nieWyser-responskol buite beeldHet nie al die lyne van PCX-beeld gevind nieDimensies van TIFF-beeld te grootFout met interpretasie van JPEG-beeldlêer (%s)Fout met lees van ICNS-beeld: %sFout met skryf na beeldlêer: %sFout met skryf na beeldstroomOortollige data in lêerKon nie '%s' sluit terwyl beeld geskryf is nie, alle data is dalk nie gestoor nie: %sKon nie RGB-data laai vanaf TIFF-lêer nieKon nie TIFF-beeld laai nieKon nie animasie '%s' laai nie: rede onbekend, moontlik 'n korrupte animasie-lêerKon nie beeld '%s' laai nie: %sKon nie beeld '%s' laai nie: rede onbekend, moontlik 'n korrupte beeldlêerKon nie '%s' open vir skryfwerk nie: %sKon nie TIFF-beeld open nieKon nie lêer '%s' open nie: %sKon nie tydelike lêer open nieKon nie vanaf tydelike lêer lees nieKon nie TIFF-beeld stoor nieKon nie TIFF-beeld skryf nieKon nie na tydelike lêer skryf tydens laai van XBM-beeld nieKon nie na tydelike lêer skryf tydens laai van XPM-beeld nieKon nie GIF lees nie: %sFatale fout in PNG-beeldlêer: %sFatale fout met lees van PNG-beeldlêerFatale fout met lees van PNG-beeldlêer: %sLêer blykbaar nie 'n GIF-lêer nieGIF-lêer het sommige data gekort (dalk is dit op 'n manier afgeknot?)GIF-beeld het geen globale kleurkaart nie, en 'n raam binne-in het geen plaaslike kleurkaart nie.GIF-beeld is korrup (verkeerde LZW-saampersing)GIF-beeldlaaier kan nie hierdie beeld verstaan nie.GIF-beeld was afgeknot of onvolledig.Ikoon het zero hoogteIkoon het zero wydteBeeldlêer '%s' bevat geen data nieBeeldformaat onbekendBeeld het ongeldige wydte en/of hoogteBeeld het nie-ondersteunde bppBeeld het nie-ondersteunde aantal %d-bis-vlakkeBeeld het zero hoogteBeeld het zero wydteBeeldkop korrupBeeld-pixeldata korrupBeeld te groot om as ICO gestoor te wordBeeldtipe '%s' word nie ondersteun nieBeeldtipe word nie tans ondersteun nieStuksgewyse laai van beeldtipe '%s' word nie ondersteun nieOnvoldoende geheue om PNG-lêer te laaiOnvoldoende geheue om PNM-konteksstruktuur te laaiOnvoldoende geheue om PNM-lêer te laaiOnvoldoende geheue om XBM-beeldlêer te laaiOnvoldoende geheue om beeld te laai. Probeer om sommige toepassings af te sluit om geheue vry te stel.Onvoldoende geheue om JPEG 2000-lêer te openOnvoldoende geheue om TIFF-lêer te openOnvoldoende geheue om beeld binne in 'n buffer te stoorOnvoldoende geheue om 'n %ld by %ld beeld te stoor; probeer om sommige toepassings af te sluit om geheuegebruik te verminderInterne fout in die GIF-laaier (%s)Interne fout: Beeldlaaier-module '%s' het misluk om 'n bewerking te voltooi, maar het nie 'n rede verskaf vir die mislukking nieOngeldige XBM-lêerOngeldige XBM-kopOngeldige kop in animasieOngeldige kop in ikoonJPEG-kwaliteit moet 'n waarde tussen 0 en 100 wees; waarde '%d' word nie toegelaat nie.JPEG-kwaliteit moet 'n waarde tussen 0 en 100 wees; waarde '%s' kon nie ontleed word nie.Sleutels vir PNG-teksbrokke moet ASCII karakters wees.Sleutels vir PNG-teksbrokke moet ten minste 1 en hoogstens 79 karakters hê.Misvormde brok in animasieMaksimum kleurwaarde in PNM-lêer is 0Maksimum kleurwaarde in PNM-lêer is te grootGeen XPM-kop gevind nieGeen palet gevind aan einde van PCX-data nieNie genoeg geheue om GIF-lêer te laai nieNie genoeg geheue om ICO-lêer te laai nieNie genoeg geheue om RAS-beeld te laai nieNie genoeg geheue om animasie te laai nieNie genoeg geheue om biskaart-beeld te laai nieNie genoeg geheue om ikoon te laai nieNie genoeg geheue om beeld te laai niePNG-saampersvlak moet 'n waarde tussen 0 en 9 wees; waarde '%d' word nie toegelaat nie.PNG-saampersvlak moet 'n waarde tussen 0 en 9 wees; waarde '%s' kon nie ontleed word nie.PNM-lêer het 'n beeldhoogte van 0PNM-lêer het 'n beeldwydte van 0PNM-lêer het 'n foutiewe aanvanklike greepPNM-lêer is nie in 'n erkende PNM-subformaat niePNM-beeldlaaier ondersteun nie hierdie PNM-subformaat niePNM-laaier het verwag om 'n heelgetal te vind, maar het nieVoortydige einde-van-lêer teëgekomRAS-beeld het vals kopdataRAS-beeld het onbekende tipeRou PNM-formaat vereis presies een witspasie voor monster-dataRou PNM-beeldtipe is ongeldigStapel oorloopTGA-beeld het ongeldige dimensiesTGA-beeldtipe word nie ondersteun nieTIFFClose-bewerking het mislukDie ANI-beeldformaatDie BMP-beeldformaatDie EMF-beeldformaatDie GIF-beeldformaatDie ICNS-beeldformaatDie ICO-beeldformaatDie JPEG 2000-beeldformaatDie JPEG-beeldformaatDie PCX-beeldformaatDie PNG-beeldformaatDie PNM/PBM/PGM/PPM-beeldformaat-familieDie QTIF-beeldformaatDie Sun raster-beeldformaatDie TIFF-beeldformaatDie Targa-beeldformaatDie WBMP-beeldformaatDie WMF-beeldformaatDie XBM-beeldformaatDie XPM-beeldformaatHierdie bou van gdk-pixbuf ondersteun nie die stoor van die beeldformaat %s nieBo-na-onder BMP-beelde kan nie saamgepers word nieGetransformeerde JPEG het zero wydte of hoogte.Getransformeerde JPEG2000 het zero wydte of hoogte.Getransformeerde PNG het nie-ondersteunde aantal kanale, moet 3 of 4 wees.Getransformeerde PNG het zero wydte of hoogte.Getransformeerde PNG is nie RGB of RGBA nie.Kan nie beeldlaai-module laai nie: %s: %sOnverwagte bisdiepte vir kleurkaartinskrywingsOnverwagte einde van PNM-beeld-dataOnverwagte ikoon-brok in animasieOnbekende beeldlêer-formaatNie-ondersteunde JPEG-kleurspasie (%s)Nie-ondersteunde animasie-tipeNie-ondersteunde diepte vir ICO-lêer: %dNie-ondersteunde ikoon-tipeNie-ondersteunde beeldformaat vir GDI+Waarde vir PNG-teksbrok %s kan nie omgesit word na ISO-8859-1 enkodering nie.Weergawe %s van die GIF-lêer word nie ondersteun nieWydte of hoogte van TIFF-beeld is zeroXPM-lêer het beeldhoogte <= 0XPM-lêer het beeldwydte <= 0XPM-lêer het 'n ongeldige aantal kleureXPM het 'n ongeldige hoeveelheid aantal karakters per pixelnie-ondersteunde RAS-beeldvariasiePK01]LC_MESSAGES/bash.monu[ hi  <ILb& -; A KVn"     %s: cannot create: %s%s: cannot execute binary file%s: command not found%s: is a directory%s: readonly functionBogus signalDoneDone(%d)Exit %dI have no name!Unknown statusno job control in this shellsyntax errorvalue too great for baseProject-Id-Version: bash 2.0 Report-Msgid-Bugs-To: POT-Creation-Date: 2016-09-10 12:42-0400 PO-Revision-Date: 2004-03-17 13:48+0200 Last-Translator: Petri Jooste Language-Team: Afrikaans MIME-Version: 1.0 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 8bit Language: af %s: kan nie %s skep nie%s: kan nie 'n binre ler uitvoer nie%s: bevel nie gevind nie%s: is 'n gids%s: leesalleen-funksieFoutiewe seinKlaarKlaar(%d)Verlaat %dEk het nie 'n naam nie!Onbekende statusgeen taakbeheer in hierdie dop niesintaksfoutwaarde te groot vir basisPK01]U8!m!mLC_MESSAGES/coreutils.monu[PK01]CO*imLC_MESSAGES/elinks.monu[PK01]Ғ,LC_MESSAGES/grep.monu[PK01]ۍy)2LC_MESSAGES/sysstat.monu[PK01]6Ƙ  ELC_MESSAGES/Linux-PAM.monu[PK01]uuHLC_MESSAGES/iso_639-2.monu[PK01]6uXbLC_MESSAGES/iso_3166-3.monu[PK01]V@)m)mgLC_MESSAGES/authselect.monu[PK01] %LC_MESSAGES/policycoreutils.monu[PK01]dJVJVLC_MESSAGES/iso_3166-1.monu[PK01]f)$$f-LC_MESSAGES/glib20.monu[PK01]ĿQ%%lRLC_MESSAGES/iso_639-3.monu[PK01]FgLC_MESSAGES/man-db-gnulib.monu[PK01]}kLC_MESSAGES/xkeyboard-config.monu[PK01]ЉZPLC_MESSAGES/atk10.monu[PK01]6? GLC_MESSAGES/sed.monu[PK01]AyCC-LC_MESSAGES/gtk20.monu[PK01]