�ɲɾ�����ӯ�����һ��ˣ��������С���˴��ͣ�������P���ҹ��ñ˽��ά�Բ��������˸߸ԣ�������ơ��ҹ��ñ�����ά�Բ���ˡ���˳^�ӣ������ӡ� ���ͯj�ӣ��ƺ���ӣ� ? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!usr/share/Modules/init/bash000064400000010046152526441610011701 0ustar00unset _mlshdbg; # disable shell debugging for the run of this init file if [ "${MODULES_SILENT_SHELL_DEBUG:-0}" = '1' ]; then # immediately disable debugging to echo the less number of line possible case "$-" in *v*x*) set +vx; _mlshdbg='vx' ;; *v*) set +v; _mlshdbg='v' ;; *x*) set +x; _mlshdbg='x' ;; *) _mlshdbg='' ;; esac; fi; # define modules runtine quarantine configuration export MODULES_RUN_QUARANTINE='LD_LIBRARY_PATH LD_PRELOAD' # setup quarantine if defined unset _mlre _mlIFS; if [ -n "${IFS+x}" ]; then _mlIFS=$IFS; fi; IFS=' '; for _mlv in ${MODULES_RUN_QUARANTINE:-}; do if [ "${_mlv}" = "${_mlv##*[!A-Za-z0-9_]}" -a "${_mlv}" = "${_mlv#[0-9]}" ]; then if [ -n "`eval 'echo ${'$_mlv'+x}'`" ]; then _mlre="${_mlre:-}${_mlv}_modquar='`eval 'echo ${'$_mlv'}'`' "; fi; _mlrv="MODULES_RUNENV_${_mlv}"; _mlre="${_mlre:-}${_mlv}='`eval 'echo ${'$_mlrv':-}'`' "; fi; done; if [ -n "${_mlre:-}" ]; then _mlre="eval ${_mlre}"; fi; # define module command and surrounding initial environment (default value # for MODULESHOME, MODULEPATH, LOADEDMODULES and parse of init config files) _mlcode=`${_mlre:-}/usr/bin/tclsh /usr/share/Modules/libexec/modulecmd.tcl bash autoinit` _mlret=$? # clean temp variables used to setup quarantine if [ -n "${_mlIFS+x}" ]; then IFS=$_mlIFS; unset _mlIFS; else unset IFS; fi; unset _mlre _mlv _mlrv # no environment alteration if the above autoinit command failed if [ $_mlret -eq 0 ]; then eval "$_mlcode" # redefine module command if compat version has been activated if [ "${MODULES_USE_COMPAT_VERSION:-0}" = '1' ]; then MODULES_CMD=/usr/share/Modules/libexec/modulecmd-compat export MODULES_CMD if [ -t 2 ]; then _module_raw() { eval `/usr/share/Modules/libexec/modulecmd-compat bash $*`; } else module() { eval `/usr/share/Modules/libexec/modulecmd-compat bash $*`; } fi fi # export functions to get them defined in sub-shells if [ -t 2 ]; then export -f _module_raw fi export -f module if [ "$(type -t ml)" = 'function' ]; then export -f ml fi # define function to switch between C and Tcl versions of Modules switchml() { typeset swfound=1 if [ "${MODULES_USE_COMPAT_VERSION:-0}" = '1' ]; then typeset swname='main' if [ -e /usr/share/Modules/libexec/modulecmd.tcl ]; then typeset swfound=0 unset MODULES_USE_COMPAT_VERSION fi else typeset swname='compatibility' if [ -e /usr/share/Modules/libexec/modulecmd-compat ]; then typeset swfound=0 MODULES_USE_COMPAT_VERSION=1 export MODULES_USE_COMPAT_VERSION fi fi # switch version only if command found if [ $swfound -eq 0 ]; then echo "Switching to Modules $swname version" source /usr/share/Modules/init/bash else echo "Cannot switch to Modules $swname version, command not found" return 1 fi } export -f switchml # enable completion only in interactive mode if [ ${BASH_VERSINFO:-0} -ge 3 ] && [[ $- =~ i ]] && [ -r /usr/share/Modules/init/bash_completion ]; then source /usr/share/Modules/init/bash_completion fi if [[ ! ":$PATH:" =~ ':/usr/share/Modules/bin:' ]]; then PATH=/usr/share/Modules/bin${PATH:+:}$PATH export PATH fi # initialize MANPATH if not set with a value that preserves manpath system # configuration even after addition of paths to this variable by modulefiles if [ ! -n "${MANPATH+x}" ]; then MANPATH=: export MANPATH fi if [[ ! ":`manpath 2>/dev/null`:" =~ ':/usr/share/man:' ]]; then if [ "$MANPATH" = ':' ] || [ "$MANPATH" = '' ]; then _mlpathsep='' else _mlpathsep=: fi MANPATH=/usr/share/man$_mlpathsep$MANPATH export MANPATH unset _mlpathsep fi fi unset _mlcode _mlret # restore shell debugging options if disabled if [ -n "${_mlshdbg:-}" ]; then set -$_mlshdbg; unset _mlshdbg; fi; usr/bin/bash000075500004317170152527226760007023 0ustar00ELF>@@8 @@@@hh8}8} 00t8T 00 DDStd PtdBBQtdRtd0022/lib64/ld-linux-x86-64.so.2GNUGNUGNUﮊى .羃O 00 #!JzdAPDDB  @AJ!IhMa"r 6NL@@@AB 0Iq(h @( H +H&R€D!D  $DJP` @A4`@ABd L@0 dPCDB@E!%32BX@TBD$ @ @A%  !0`0 h@@ bBh HBHD`1B Xq@ Y BdH(0"BB1@ p2 IP8@ {0 "Bi$$DF0" )4$ @DXAp @B82 BH  & =HdL@0( 0D@kBDH`$yh@(>5R @!%) PH bPAbBP@(L.<:B@&JD08` PPQ0D`` H`P30! BL 9E$!( BD@"@@ XDBQ( h@#6A`/#( G80DÐP "$ctRp  , BAɪ@ 4d1ÁdAD  `H2`NR l1C  "7$aD!A8P_P YϚH (B 1@;hȀAEn" L F   F`"`% H0A`k $&# Z4%D"hV#@@`@CU@ F9$@ H(A@@P @B @@ @9 @SF DD ̀ @@0  LDo b I.P(]`! H DJHap5 B(HB A@ E< D$@ Sh & " 8 B0&  @C tP"T 0P e @AF($B !Xrd. 7M< "  "&"P H!`%`A $"A ` 0  #FA!I`7@`/ ͨЬ@)CQFAh`,b#  @D X!@@ @R 2(aPHpJe$@HZ` %'@ 3@D xA  . & t8`Đ) -"$Y"(A !C)pZPE@@@( )(@C4#DS_ T$ D @Rq&51H@D (B(I("H f j P$H " 20  #& (CP$r`Dd$"7A0D@!E0@@4b PHP&"PJ` "@ BPrD  (vI6    "#%&'()+,./12379:<>ABDFIKOQRSVXY^_`abdefhijklopqrtvwy{|~   !"#$%&*,-/1359:=?@ABDEIKMNOQRSVWZ\^_befhiklnopqtuxz{}~     !#$%&'()+-.01234689:;<=?@BCEFHKMQRSUWXY[\_`acdegijklmnorsvwyz{|     "$')*-./146:;<=>?@ABDFGHILMNOPQRTUVWYZ[\]^_`bdhijlmqrsuvyz|}~     "$&()-./023478:=>?ABDEGIJKLMOQRTWXZ[\_`abcefgmnorstvwyz{|}   "#$%&')*,-./014569:<=>?@ABCFGHIJMOPSUVWZ[\]^_`cdefgijkmqrsuwxz}    "#$%&'()+,-/124578:<=>@BCEGHJKLMORSTUVY[\]_`befhjmprstxz{}~     "$%&'(),.234589;<?ACEGJLMNOPRSUWXYZ]^_`abcefghijklmnpqrtuwxz}~              ! # $ % & ( , - . 0 3 4 5 7 8 9 : < > @ B C ]De' n lqsm#*K4EW5æ *N?me")T8*C8z?yk\3Ӫ˝İ{+ߓƌqxI{?4 ajW{o3k2!`혍:ZkY _ȕn5;i z%#a铁iDi_ñm\YhFL`I{A4{WǞ Pt/hYNm6 T>SHrwYK8nٻ { iNAo``0Tr@#V;%R ymnu&g:d*:f'46bKV&c.#^qLw*{n{ߣ%ԯ*cV_S"$Ry$oETjtIJ'#/Y} ?U_EyQq,~oMOI;r;Yu3w":{ٛ|/5רFM'8`͊#' h^k_|In&'_,@͗WO3C =ךW}@yr5؂jP#';/eɌU7cMu=O%u҂]4Yx,Yϻ:wXcx(36v]bv~k iFbxYΨI3Hxbb][1qo`9 37_2y ӣ;̬*)gaj|:𿣠~){Di\99,%2R;N3N'UOM c_ Q~0O}F(~T+`…+*! J|tG}%|)ؑ®Aw glj`3w1tguoBK+uV8獔! Ź@Η[-&F7'.c3'R0Sq=Z).Hˊ\:G iʝ. PMH[+Z=A,"yHB+O?@TB= @#ػЀ}+)K{1enF_KQݣk-qCAXZgߊ.M{٦a67׉]BZdq83-{k+A,ƀ6mm}LdY_V<Ͷų`_dJC|2kbm-\+oGZst#\Jf <ۇXqжUj_+_2V[m#AasC,_?و ~4jnʗKxpw֞M[QGq&!&PJ[]t:q٤-N|}E Nr/oQ)/χdlF2c7;YF ai[(Q+ldz^w8~e5U@Z,5wʓo7};HrcesFzeXmeBe!1S!y^PQpQHaG;iRԵvyb؇C U+5%qGQ-q eȩU׊JB,+S{{CE 2(=|, ~BVA6=<+BeAh3Y?,JMl6 ?_+c&̟hIiۓ5Y_t؆\osv#U`D;%k{ d˥D'\Kߔmj1,Ĉ\cK^__ G>+ *B-=Un#|QRUM&Zu'iÄDG^2BTz:ul/Odsw-"n \I> )NΒyE%*頒J_2 @]u%k0Ej>Xm 9q_t΢E:<)d\;;ExK Q;CbIw`#U設K향-m<{Wzl|81t\ #wnsB2ld#ߦ 41:\H ޥ,8URCض x?޽ o\>aGޫ$ ]SU--6Ɓ޼)G$Z9Gbul@*FfQƴ7Z3B.h OGu8W@M>>o0WIs՜Y47*j9ٍ(xV;wTbhG",[0sC5rmb'!Kz=[o~ah!|W,fi&) 5 N\fcH)W,ZxsYAR Pnnnks\ȣ NKYkʦg*+2`/VaGGEtWi)d"4y}l0zx%2j CM#KQ@7,zE8~-w!7^ GZ9 Jݿfo3БѹOHM߾Zx} = ޕWʊp[4@^l>Y)@%3 =^MD*沥Q >S.8 2(PMky+8uJ"s:BQCI}]ӥaޘ[Y?@=ateN )"J Yyʁ I =M[uiyيSQ'er+3)Y zkSf?g| H0ZZb sY{EXJw9N "cD9E'"hjg]jK Ym OI'k~[vtS# N(fr;-jSQ?ց>xwujE+J]u 6eM! Mao!LjlRuҊ_יHu+}w75 Tէٶq-GLX; Ky?W2]q`#6(Q%{q;b>yv tUy kJ/qj;>nrJУ)zkI-:*]2Vfkv;F:&S &fdؓe6Ot|>8Wn[ʸ .n;͒Ы#UUd~wA`(^rMo5bkV[˧LTYL/nsb$Um]"_A˒GثsP/  _7(S۟?S7-Fݙ:iX2hHΏ_TfM~GaW?Bas0&7=@ rۙWr\5ӹ[{$W(H *I)WJ%l> R.hP'6mo3LXoC?,zZ/#T:.7e2tp!ܙ$-wu;%R3}IJxV|1 yXW$JPLi(|+@=0 lJuU]'[!v,ʁiPnSLhfz(uCՀ1jWw2rF܉YEBE?P  ,/U4N4bŧg"҂(9AE>$akXB#za6_1P|-wpt 'aWrOf:6qZ/-XN aOހmr60YA6ÏC-t]'t[b/yoڸPY<*~r` 6EjǏ"|A&LQ`HvNKOz?#PMpBqa9hyez`DQuXx$MmB쑐$kk-g0'Fpóy㋚/) ūS'&6i Um`O mj'&%L;ByCkU=1 h<ބt;i49 ;7jeGW8;Ũ: -6sLlSȘ=s)CbAY5ɍ&C7<>*֖V*^p$!"Hb(I\ yyi^+:n'wSoSĊtSoNm:U.|3d.(5 e S0}y^ ]\Aid\qJ}Gr,r Tvڱ x%O.QJI%x`)u98ȟMt]?Cfo=#I "NAC!)\-ԁ98Gk+w/BCH$~dÂSYu$DX1$t8xB4PP-j.Z̋)U  b)щj"Js;ѿ mN<)//aH#Wݸ63ű}-}KMB.lUa8qbOWztYa8$FMߌ4^0b3iw5͢mcYcF,2=iR"Ď M߁cA(ϡ*>@yΉ5égܾ6eKb'G8(++75A}=:qž ҵ.Vn %!"OZŨ#r!+1]::OȪY5_X&rȂᢚվ e *քgw 3s>ӢCΞÑ7$ N@]D}\d H8)z?XTY DIΥ{ o Ymnblfگ" #@KP__jPl8Vcr X ίn-OtvAC:uYUg'&$(pB!9/B4`3kY+AD3T9y!Ka1ۜ^S"а$\æ&M/79't.&S/pG ղ]#p/n?x7Wпjl&3ˆ._FɌ~&*tvٳɵ13~?T15 b؂QD1]l 5i 9Ut10" nb0p?[RFPj[ZIu&9EK G suNl&`=b`ך5^s@Î;4Szz5TƝ,;=3%>l2} AiZ*#kiD7-*3 ]jd8Z ,JZš<3Ko[|=S -jOʇ3t% "pH}GӳYp^_e% N$Yj-=߆2ηR-Aj'Dj~ WODMrZXe裞L;Y蠇R b0 + Z݊5sܿy8P6~U|'dԃ\Q0XcV*)Nd9MJq[E~߼ON;"?G)oOu@ dkMfKwp嫐LFB& "ii7(S˛!tNYTanB ] !4e7Z Z ֬$k|xI 㣼,ޗ?'% o7<kUϫ+OqҠp7۵4))i^%p3lhvyd55Ű!uPN~v TWW4=%- [N@ Wsr5N)o-6ϚțN-c&R-6*mՌ/pÛu٬K3Xf$mgq6JaOfFNK>`T;Swݻz^D&yp/pRDQTǾkq`i};HPAw5yѕ9p)R{4a@cХ..C֓_VpIHl;QiCpxY^_/W7d xz ;{'핺އta2ݸC y"5t=TBRϥŀe a֛T"BsMysHB]bj5юMm_ˬϾ- ؊35g&?H\ 0p. SgA 0jS$n ]lt1y 0& u|Б1[`hV1ew0(;^1ZZ)$`yaa,^1: uw19C1ӐB1,#y1[1{\ )LP yo]1@@0,*q=r1'u` 0 d#Lx r v1 P /7 W4_1h ^1Qm`0 &p0t&-3| cC"1\# Tc}gRX^1A0 %B=$:N`^G2P k v P13@ x:@ 3t0, W~0( e` y81;p L@( ;Sx2JupE @fL12 qJ}1o\Pf w@F30i A81cM}1W@ R]10M;  Cd/)f0 3` yWpP0Uh1=1~ nNp1P% -3"5Q$y1 7H1z1~P1h<}1PPV`t1opcL8G1l: y $P %UW<V [`[1^1Xt119 uP @vrzPC1<H1`ajpg %# 9 10 I@ !)& OuM rv S ]% Oe 3?2U`5)Pi*@RO >/=`^PCn\1+`WT^qI V"\^`\1 @Az4 !(u@oPL1K5 I7-0(I`0< n o_P @ pg0| 3}2?} XN' #`0HC`1O`  0B~hi8 )1t:^p8PO}41nf`I|lx dPR( S@#1C i| hrk@:ma IP ,E1X !*}1a18@4q10/Q(007P;T3, e70v]0Z0^1!0,O~ V WjP0 M; 2kP0V $ 'p  k ic@P 1mN |1[ 2(fi@ A0p%RhГ0^0t n6 ` c.  P#m9 l;@021(t1Ph0*Pk ?Ё Q!x0(< [|w1xa0(R+T 1;B1Q{J c\h0 f=D^1ԈTC1R.411j I1E1C8@D AE %l`B ЈБ0Y>e @11@8 5p`ˆp!}F1&4/ p= [B9^C 8v( NDyB@ 0DC1H` ig@6l0dT&w#1yV@ 0X1~1 Nl> QP=8pq PD(DK  [1(1eusp  P  $!E1>G WMG1FrP6 #U@c+0 N#0^18(H&8p1}F1c0? \86 ZP7 *f00[sO1qP ,0_ .h [z T% 11PN,Mw ]1 +e4Mz ;F1d1ap '~Th0i9nT 9u$Nh@\ aF1D`W  rm^1w Z Fy {п %p +E 01'@W( 17P\T cg( ʇ<~#  r7R 5*89 >U@ky} ) Pp >. N1&@ xY5 0i Z f 2_upf PPT7[1Oh`0*1;_W@F1=C1F0 *V1e R00~-B@cMـ 5h0 (=lfyJ ;xw1pv0* SK G19MTkd`1/E0)Y* p 8; LT S|C1h1GPU q&Z1zjUQ,`1JWMM*b IO8= \"P+ 1RL1D~nj~1gЁR,1g@.0\  kk"` ?X1l_1r8^10 T1hQ@t100G1YFp4 Y-{a\" :k F+ ^0Ol0a F$(1"5`& >@!gpe 1:40_b DYe v#Y2 a5c 001c0+t 6 L@Сm5 }@j AP}9gW&( pc)&TPK@0FЂ4m P3P @ KDVp#}LQP6\P7}& M{Ї5h/([1s1E ghD Lޑ@:   `Y P . 083 x1MU`0ƈ0;[f40Et)?r1av0'SX1* LS 0J0[1 `+r0I$ E!@X<pT  }1 ` ^1K h '?1^G "L } A[  i iP 3Ʉ5 HpwKx1Q 0pL\ s2 M Hfs0"+  Ճ`')'14` &k!'t;x1 G LN{|7J` kG 0 N yq :s K6 nm N x \)6pQ`9[ 2jv Vleo 0 n =Q1f0`X@lX]Х |^0(` vU6# @ h.S m I+p^=( z HF1‡ jCT% j 4L"ď1lp11ddF1v YBVD1U @1_ Q3 02: 0[}SPk`[1=T x0 R3 iu@tI0p?81B1 ;1uLP>, B1$+ s^1P\19B f ` A`pI~@u5H}1bА0Yn@f /@!lS- / 8+p 4[ ` r1>xF1 t1~ '2cI0TKIg0P/)341hK O1G1sHd0 \P^1 CDB r@}1$G1Ri0(f02{Aw8` :# D tWJP4YC1- 90 K WO1> @0 L0w1w1N5lF1-PP;ё@Q 8uPF1p [(`\%  Q xV^ Z$[ Jȏ1tpx1t1@0(z1,<g 1 Oye(C1T/` gJF F$N44.`fu0P6 H ]* Uj[1Jj % ?h1MC8 E8`&t00 WJ :0>{r^IeP1?%\ 6bR1qcP!|+pupO |50( 0I A 4h1{!MbЖ LbQ24? *w O 1: 0pl$0Í FH1~zF1}18 P OЌ Ju LI0 > q UDf\F1}s Da@@I*,@OwP fBHC-PdBk0=X_g`@10 VV0 S8,DV A ]1uy1P0*`F1b1# VUP O< 5P> =C [1~TRwX0KQ-#0M13B0XW,LtF10p $Kp0$@  ֋ ( 1_r1'0m8P0<1HC1x;%pyEc#dp m@)TF16t1dP    0NW%P>d@{s -nPk Cy@$_a&wi5 s > P tw1c C-1_` U |1   jG`u80 M:uP1A 8[1F7@ \܌C1!'"P8.``1X) YM@ +1,K ` @P ahx J/1`1RWSuQ-0 u7 Dr-P\}pGy $16В0_PW9d 76`J c` l|`pC1m: Z0 v W"@0$ 1 |x}1 \ @0=Z0(3&` qG0  3 ?,171L z AT2>W#yZ0 o % VWGBvR(h.`>>  0wP d0( a K*V@_ ';Ћ  /tp+0 +8)[1lr1]@Aam0 L*V$70uQT,0p1S`PU #c @B # FP =ǂ0P]@\21iV0( o@ y?fp}1p` n` ;* 9!pr1P H1'; 7w gr1 f7"7}@80lp0<HF1,05X\1Ob|1pL6Y@  {1516 vf{ [1RYГ]b s '$v,P. a O hB_k1V4G1oP $"1: +i  Tu@0(5  {(0C ps@ %u]))6Y;*>^`b,':L e UB`$ IX` .@t T(` z#^Ia[11_c1GP i1Yt 9?X@ 8w0( vA{^1L Z1( LR '~@xC )00/0}1-GQ ^`]49VS( hjZ~0yp "r@d 9ۂ$1 _i3]0("`6z0` ?z1ǐ99) ynC`O 6` AN Xf 2qNMyL0S00`Yp @xp Š@j|1B1N0h 'R|0(p_xyP 1:G1JG1 >Hb`xP ~1yp ;mpNǁ {(0E1, 'jD17`l%2!0~ B(0mq `CcH0 p Hr/;90= =;1C"q\1P\@ -b@ [P1m8d2!f-9  K'Z cu + 4b];PQ :QpF12l&"}x1](\`1v\6aP D < 0/pK, .B_p.֏C11&9a|5E1Tr! P >40'L(^1Vp  [13 0@*Rp13Z9 [1P Vl uw16e[ 6n HP0AitC1nQnX@0%ȏ@T7[1#f0pg& I\%pk <11 CB1/qn 0@ )@ X[1(/hC1AU YQ 3:  # V7B & 1H;dw * eL1P E! AQ(G1 dp[ )t`.J 0$%H0i"{o * H-5 'ht1R0,>^1?* qQa@bM"[1H,1o0x[1{q{@p jy \B0,xP 21{Py7g5" 1X Q Z :#PeG }Mv8 #P0p2A?M #$<t W4@` ?~1[1Q ( M\^1oPi !OX}1QPp|@^1 Jg[1Bhg &^ 'h@2@0 &vw1-b R2hw12F 6U s`P}1;#U=  c4EUPC\|n Q A) mpT_@/*a@E0R`)01]L0F1b yn$1}`  H P j"  }1Y T.| \H C0v 06\o % +WG0Z au !/p !>0<FPq R4w1  \ !0(,@S4 U v#Ѐ!dt1 [ HO[P!k0ZE1zu0 !!0 ,@Wt8p1n,P"%P-wP Z6TX@0 7@Pq 10cPHB 01(}1g W6a_ M{P!|TvDL^1|E1BS8  ;V@ }4}1"20.^4F1gP0=B  4G@ 04 DlPO,P^izP>b8`781<`R(I^ }|0  c1P1$7p -}p1(- 3 m fr@t*y+4u0 w=PH 0( `)` 1e3,1$D|0O#8:1e}1)I6 N0b*Ct1)% =W`: ea 5 G1qАuP L|y"0@00(I@8#t`0 "y*%1N3w#1z1E:o J[ n60Nj@f1"  5`o TO: 1\rn1]ir08F1V`5 X\0v00P`)1A`0!=P4C1 p F= Uc3 Xfh11[~C KWp(3\^ W1ʎISpH Q 0D 1(!0P3'U}01XI|͌1&} E1]U/11`hs(17 zB}؏1~.C1R:1[@0(D` lMPC@:1zK(1{0 5) ?YJ \1B 4/;J:sB13O18R 5) ` '/C =dP\J CYS  U `@0(z1?j L!ppu #D p1w6!_c  (6!rm1WE1lopB9B/kEm 1/i S9avx0#(m <[N"1sH\1+ @ A 1$ PG^1a`P @l}1q`2 96Xm1p}P '8 0 t ,1o0Zk^1PC141,Hp ;7I-U}1D B % O0S@Sm<Z;wCa U F11k0c9 M Kp)9KC16#p ^~` 0^G(\10[1) p3 )*o  @dU ` 5,1}L0Y R$_0 3'sT 5` otw1>@ l T =1B1) (;H^146i[H0G= @0@ {` -Ph(. yq0\(0m Clep )`1 C{N04q A< 5 /O  ! #"0 O]zA `b/Q -qIWJM@T jRhF1=pD13Lr1#Uiz- jzp</D@JJ@ DmT  a0-܊@@ Z}U{@ N,0[ -TP)@j`0`)N`3Y"p a2$VAEЏ1-9  : G1Q18}3w020@ BA` 9 В ,@0(A&/Q&@ =>XF1>v=Dy>p e}P  1 }TH{H1J0F/J5!c60a=8$D  XJ WHPT @!E1p=$Ntpw1>5 nF>p v#(vmEy |w1t@1?/tRj>=@` <K q@) vn$2W MPg   d_w1a o'8T1xpZ* }1c J,06? x1J` nR 0  (i1V:[+`8@%3% p0-q  w14[1k 4`1Ap dc\1y BjE..h&p1gb SC`S E~y1ă L`IZ0`1@{0p icKz05^!v[B1n1G0tJ0X1*r197  u1P1IZ4 Y@p1vО `dfC1k0 }1o1@]~GsMD1zp dX`i| /_ 1N;$ 1[` ΅@w wll u!&WA7 2 1,H1] P* jU00p=a CP%8>$ ?3<%@#71=.JPk5+(1s +SP H܁9w4@ Sx1Xp_ !w=(1gp|BnE1Kcpt1.?EY0"\0 Z<T1Rp0{ 5 8tA0aEP^1hZ'uxP1#75 S'#Z  b~ S0 L  XN&)6`: 3F ;0 7lj@0( Pr 2A%}1^p{ >,p u' bWc'`v NNdR 00p g/2" L?1* :0 t&Q@0*p S01 $^1E@1 tP 00< TlP<IgW1x<` X ߄07!v`f l%p1'aF1P jUp {N0 a?PV UR*/0 <kF\ Y K!9/5 o<8C1nj1En 4p)0[1R<1 .+`h $WH@0(&_0_i7P 0 *MIOsB1].j I1Aq(1EpPe@C  B)\e8V}1mPFo 1;P_`09<^:0e Aip0~0( A@\1S#MYoP_ %"00U1:S1 _@$Y{30LI`k 4=0) Q8Ei0: aO j`ٍ 1| <=[1nB1@0 1B1pDF1щ1|0 Th}16Op cEpp(J 0 (L0g#Q . C`q0'41+1_8`:8}1}k x#J:h iÌ1eO1{!1Yx /0(2W`@a Kb) "0$ `[1m^ P g@ O< V G0(|P81q {sT,0Y0Bp| *Wu0,w0OR4qtt@uq 1]@1Z0l o! `/\;`}1S1`O;0 ~Y0F 6}{o0 (- TP~ #$W1{` &L088\1MD04^1F<,Z $6 UЕ }g` W-p xT 2a`/0 }1 wД k |_ '$ " \h 5r6)KQ 1F0(I^1 { H"H06 O@ Akp_xZ0- VN0({h5'ot1cu0 vD3 L @F@0U L*p G+Q"cp B/0\1!%RP^iH1y pS3`Plr %1@1/#LQe |wD0^T\ wf X!hep Z5[1]RzO [ ]i - J@69c x"^18P EЏ0G3@ \ 9xC1~1=Rp S| O#(op`0!6*. nwR`7,+T 4b >00rb 1t0z~@ >X1y`A@@0J 0M0@8 0W0 3 0cȯ0A Я0mد0= 0z0+ 00@ 00+ 002 0(05 0080 1 @0ļH0) P0ͼX0( `0޼h0J p0x0) 00, 00, 00R 0&04 04Ȱ0`5 а0Fذ0 L 0O06 0`00 0m0`$ 0{0" 0(0 0 0080P7 @0H0`& P0X0PQ `0h0pE p0x00) 0˽0( 0۽0R 00 Q 00) 0ȱ0G б0ر0@( 0 00l 0,0@ 09< (02100P8021@0iH0"1P0tX01`0҇ h0`1p0x0`100`100@00Ȳ00ز0,0100ď1001 0(0180 @01P0X01h0p000&0<109000Q0|1ȳ0hг010v0pC100h100X1(000@}1@0. H0|1X0`0C1p0x0<}100100B1001д01ش0|10;0}10G0B10A 0 C100x8001H0XP0}1`0nh01x0010U0}10010ȵ010P 0a 06 (0P7 00 80 @0 H0@ P0``0k p0 x0 0Pq 00 0P 0 0V 0J 000` ȿ0п0ph0; 0x0A 0A 0A 0B 0B 0A 0A 0A 0A 0A 00B @0B P0 B `0 B p0 0B 0@ 0$g 0 B 0B 0A0f 0M{0A 0t 0^ 00"s @0~s P0f00vA 0{A 0A 0B 00lA 0B 0B 0"B 0(B 00@0qA P0ؽ`0p00f 0M{0J0.B 0{01B 0; 0; `0kg h0Pp0]g x0P0h 00g 00h 0@0wg 0P0g 0P02g 0P0h 0p0>g 0p0)h 0p0Ig 00 02h (000e 800@0g H0pP0;h X0p`0@h h0pp0Gh x0p0Rh 0p0[h 0p0gh 0p0rh 0p0zh 00f 00h 00e 0 0d 00}0 0; (000{ 800@0h H00P0h X00`0h h0pp0h x0p00A 0@0h 00(g 0p0p0"{ 0'{ 0.{ 05{ 0={ 0D{ 0L{ 0T{ 0[{ 0b{ 0j{ 0r{ 0z{ (0{ 00{ 80{ @0{ H0{ P0{ X0{ `0{ h0{ p0{ x0{ 0{ 0{ 0{ 0{ 0{ 0| 0 | 0| 0| 0&| 02| 0;| 0F| 0Q| 0\| 0g| 0r| 0}| 0| 0| 0| (0| 00| 80| @0| H0| P0| X0| `0| h0 } p0} x0"} 0-} 08} 0C} 0N} 0Y} 0d} 0o} 0z} 0} 0} 0e 0} 0g 0>g 0 @0 0h 0 0 0P00@zH0{0z00xH00z0w00H00v0Pv0uH0y00x0 0 0x(080Г0@0@oP0xX0h00p0x0}0000`o0 y0000y0y0000"y00(0000o@0/yH0 X0p0`06yp0x00`00Dy0ay00P00ey0͉0P0@00͉0oy0P000 0oy00ty80`H0 0P0ty`0׍h0px000 p0zy0000Hp0y0000xp0y0000p 0(0@80В0@0yP0yX0h00p0p0A 0`000y0y0p 000y0d 0P 000p00 (0000y@0H0 X0p0`0yp0x0 0`00@q0c 00, 0P00y0c 0 - 0@00z0ŏ0. 000 0q00W}80P6 H0 0P0z`0j h0C x000q0Ϗ0J 000r0/z0 N 000Hr0^0@Q 000xr 0A (0PU 80Б0@06zP0HzX0n h00p0r0ݡ0 000Mz0}0 0008s00 000xs00` (0000s@0XzH0p X0p0`0sp0azx0 0`00gz0qz0 0P00xz0k 0 0@00z00 000 0z00z80 H0 0P0z`0h0 x000z0z0 000z0t 0 000t0Fl 0` 000z 0z(0 80А0@0(tP0zX0 h00p0{0{0 000!{0B 000Xt0a_ 000t0B (0000t@0X0p0`04{p00`00t00P00(u0"B 0@00u0(B 000 0u001B H0 0P0u`0x000u0G{000O{0f 000^{0k{000u{ 0{80Џ0@0{P0h00p00v0{0c 000{0{0h 000{00^ 000{0{0 (0000hv@0{H00 X0p0`0vp0Zx00$ 0`00v0{00( 0P00`w0|0, 0@00w0|0V 000 0 x00|80V H0 0P0x0h0x00 000@0ȝP0؝`0p0p00000$00000<0 0H00T@0`P0p`0p00000О0000 00, 0800H@0TP0d`0pp000X0000@0x00Ч0 0`00@0P0`0p0؟0000 0080L0\0l0 000@0P0Ԡ`0p00080x000(0`00ت0 0p00@0P0`0Pp00Ь0080000000 000@0g P0`0p00000f000ġ0ǡ0ѡ0ԡ 000@0P0`0p0000000 0000e 000@0!P0`0%p0X{ 0P 0)0:0I0U0a0n0x00 000@0P0`0Ƣp0͢0Ӣ0آ0ߢ0~000Fs 000 000= @0P0`0p0000,080J0X0f0z00 000@0ƣP0ѣ`0ޣp000 000* 021(0X0@ h0@ x0@ 05 0@ 0@ 0@ 0 00 0P 0@ 0@ 0P (0 80@ H0@ X0@ h0 x0 0@ 0s 0 0G 0@ 0k 0@ 06 0@ 0@ (0@ 800( H0@ X0@ h0@ x0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ (0@ 80@ H0@ X0@ h0@ x0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ (0@ 80@ H0@ X0@ h0@ x0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ (0@ 80@ H0@ X0@ h0@ x0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ (0@ 80@ H0@ X0@ h0@ x0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ (0@ 80@ H0@ X0@ h0@ x0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ (0@ 80 H0@ X0@ h0@ x0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ (0@ 80@ H0@ X0@ h0@ x0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ (0@ 80@ H0@ X0@ h0@ x0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ (0@ 80@ H0@ X0@ h0@ x0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ (0@ 80@ H0@ X0@ h0@ x0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ (0@ 80@ H0@ X0@ h0@ x0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 0@ 1@ 1@ (1@ 81@ H1@ X1@ h1@ x1@ 1@ 1@ 1@ 1@ 1@ 1@ 1@ 1@ 1@ 1@ (1@ 81@ H1@ X1@ h1@ x1@ 1@ 1@ 1@ 1@ 1@ 1@ 1@ 1@ 1@ 1@ (1@ 81@ 15 1p 1` 1 1P 1p (10 81P H1 h1 x1 1 1 1@ 1s 1 1G 1k X10( h1 1@ 1p 1 L 1) 1 3 1 (1J 81 H1`& X10) h1P x17 17 17 17 17 17 17 17 17 1J 81 3 X10) x14 1 0 10? 1= 12 1J 1( 14 H1( h1P7 1PQ 1 Q 1J 1| 10 1pE 1@ (1 3 H1J X1@( h1R x1p4 1 0 10? 1= 12 1J 1 1`5  1  1 ( 1 8 1R H 1( h 1P7 1`P 1 Q 1J 10( 10 1A 1@ ( 1@8 H 1B 1` 10 1p| 1 10 1 1 1 1 1 1 1 1 1 1 (1 81 H1 X1 h1 x1 1 1 1 1 1 1 1 1 1 1 (1 1 x10p #1` (#1`o 8#10 H#1@ x#1@ #1| 8$1u X$10 x$1p $1 $1@ %1a H%1 x%1P %1n %1P %1P %1P %1P %1P %1P &1P &1P (&1P 8&1P h&1 x&1 &1 &1 &1 &1 &1 &1 &1 '1 '1 ('1 8'1 H'1 X'1 h'1 x'1 '1 '1 '1 '1 '1 '1 '1 '1 (1 (1 ((1 8(1 H(1 h(1 (1n (1 (1 (1o )1 h)1 )1_ )1_ )1| )10 )1 8*1`k *1a *1`o 21 21P 21 31 31p (31 831` H31 X310 h31P x31p 310 31P 31 31 31 31 31 41@ 41s (41 841Pq H411X41k x41"141 41p| 41@ 41@ 41@ 41@ 51@ 51@ (51@ 851@ H51@ X51@ h51@ x51@ 51@ 51@ 51@ 51@ 51@ 51@ 51@ 51@ 61@ 61@ (61@ 861@ H61@ X61@ h61@ x61@ 61@ 61@ 61@ 61@ 61@ 61@ 61@ 61@ 71@ 71@ (71@ 871@ H71@ X71@ h71@ x71@ 71@ 71@ 71@ 71@ 71@ 71@ 71@ 71@ 81@ 81@ (81@ 881@ H81@ X81@ h81@ x81@ 81@ 81@ 81@ 81@ 81@ 81@ 81@ 81@ 91@ 91@ (91@ 891@ H91@ X91@ h91@ x91@ 91@ 91@ 91@ 91@ 91@ 91@ 91@ 91@ :1@ :1@ (:1@ 8:1@ H:1@ X:1@ h:1@ x:1@ :1@ :1@ :1@ :1 :1@ :1@ :1@ :1@ ;1@ ;1@ (;1@ 8;1@ H;1@ X;1@ h;1@ x;1@ ;1@ ;1@ ;1@ ;1@ ;1@ ;1@ ;1@ ;1@ <1@ <1@ (<1@ 8<1@ H<1@ X<1@ h<1@ x<1@ <1@ <1@ <1@ <1@ <1@ <1@ <1@ <1@ =1@ =1@ (=1@ 8=1@ H=1@ X=1@ h=1@ x=1@ =1@ =1@ =1@ =1@ =1@ =1@ =1@ =1@ >1@ >1@ (>1@ 8>1@ H>1@ X>1@ h>1@ x>1@ >1@ >1@ >1@ >1@ >1@ >1@ >1@ >1@ ?1@ ?1@ (?1@ 8?1@ H?1@ X?1@ h?1@ x?1@ ?1@ ?1@ ?1@ ?1@ ?1@ ?1@ ?1@ ?1@ @1@ @1@ (@1@ 8@1@ H@1@ X@1@ h@1@ x@1@ @1@ @1@ @1@ @1@ @1@ @1@ @1@ @1@ A1@ A1@ (A1@ 8A1@ HA1@ XA1@ hA1@ xA1@ A1@ A1@ A1@ A1@ A1@ A1@ A1@ A1@ B1@ B1@ (B1@ 8B1@ HB1@ XB1@ hB1@ xB1@ B1@ B1@ B1@ B1@ B1b B1@d C1j C1P C1{(C18C1 5 @C11HC11hC1 C1IC1TC1C1C1C1C1s C1 C1C1D1D1d8D1vhD1xD1D1D1D1D1D1D1E1E1(E18E1HE1XE1xE1 0 0X0Wh0`0nؿ00E1E1 E1E1E14F1K F10 0(00080@0H0P0X0 `0 h0 p0 x0 000000000ȸ0и0ظ0000000 0!0" 0#(0$00%80&@0'H0(P0)X0*`0+h0,p0-x0.0/0001020304050607ȹ08й09ع0:0;0<0=0>0?0@0A0B 0C(0D00E80F@0GH0HP0IX0J`0Kh0Lp0Mx0N0O0P0Q0R0S0T0U0V0WȺ0Xк0Yغ0Z0[0\0]0^0_0a0b0c 0d(0e00f80g@0hH0iP0jX0k`0lh0mp0ox0p0q0r0s0t0u0v0w0x0yȻ0zл0{ػ0|0}0~000000 0(00080@0H0P0X0`0h0p0x0000000000ȼ0м0ؼ000000000 0(00080@0H0P0X0`0h0p0x0000000000Ƚ0н0ؽ000000000 0(00080@0H0P0X0`0h0p0x0000000000Ⱦ0о0ؾ00000HH-HtH5R-%S-hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!%}-D%u-D%m-D%e-D%]-D%U-D%M-D%E-D%=-D%5-D%--D%%-D%-D%-D% -D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%}-D%u-D%m-D%e-D%]-D%U-D%M-D%E-D%=-D%5-D%--D%%-D%-D%-D% -D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%}-D%u-D%m-D%e-D%]-D%U-D%M-D%E-D%=-D%5-D%--D%%-D%-D%-D% -D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%}-D%u-D%m-D%e-D%]-D%U-D%M-D%E-D%=-D%5-D%--D%%-D%-D%-D% -D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%}-D%u-D%m-D%e-D%]-D%U-D%M-D%E-D%=-D%5-D%--D%%-D%-D%-D% -D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%}-D%u-D%m-D%e-D%]-D%U-D%M-D%E-D%=-D%5-D%--D%%-D%-D%-D% -D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%}-D%u-D%m-D%e-D%]-D%U-D%M-D%E-D%=-D%5-D%--D%%-D%-D%-D% -D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-D%-DH$H% %( % % % AWAVAUATUSH(|$H=.Ht$1HT$dH%(H$1|ud-=[i.t[g|$HD$McǺ1H5^ JHH1HH=h.1Fqa;-tTH=-HtaH=-HtPH=-Ht?H-H-H-x-#u-f-= [-9 L-R-u 19D-H=] h.wHt h.H=.#t,h.۲.D$H.HD$H.HD$D$(L$)h.D$(9~L$(Hg.=g.Hl.n.Hg.Hg.D$$.@-g.g.u H'8-u HH9g.H\ 1-H-H\ H-g.yg.f.g..g.?g.Ag.f.~.~.ɳ.{g..H=|.H\ <~.H-H=]|.x39>A1H=.f.F*HD$H.HD$HHHHe.;-HHe.8suPhNuu xuNf.H=3.He.HtBHe.1HHHHHHH.Hte.HYN-;1D|$(H.D9|$HL$IcHH;-DsD$A-L%-d1HL- I Ml$MAED8uLHFuHcH-HHŃ}t{AHL$IcHH HUHAD9|$<=d.D|$(=d.tfo1C9HAD$%HE뙀xHKY Hd.H8Y 1\$({.L-z] L|${.Hc.H.9\$HcM$MA,$Eը@-f.IE4$DEtDfD*.@HcI4H)1@c.@.yfHcM4M2c.5(c.H-c.9HcH c.HL0hf.f.Dl1H5&X DH1[BH=4b.1MX1-@ƃw1-@1Hlj5eb.HcHWb.HXb..AD$t<-aA|$U=Fb.\$(ta.1=a.H=~W @ =b.4b.y.=a.=b.t =?y.=.t)HcD$(HL$HH.HkD$(D$(=y.Ha.=La.*a.0a.a. a...=`.1H=a.u*^H1HHЃx-H8@H'9`.H`.HH`.`.`.a*Y=s`. D$(H=.D$,7x.D$:t,*=0`.D$x.D$$D$$D$,= `.D$(H=U % H=U  _.=w.H=_.u5gw.D$$ `.[w.Qw.=`.^1 6w.=_.&w.u H=I_.l79H.HGt$(T$1H|$= _._.D$(tH=é.^.=.H=*^. t-ii^.8-u HH^.^.x_.=1.H=&.' =t^.d=_^.Wߺ1u21H5r H=cS H=WS |u.oOu.-].u.D$1D%].E[=].v].|=].tAu].=].=].=].8D$:u.=].D$(;D$t =.H=f\.H=\.vz1H50 H=!R H=R QW-]. \. ].u=H=N.;H=vR HC =H5~1H5M HH16HT$0DHD(uD$H%=@tWD+HK5LE'mL`HHt:L1H1AąI6H49E'Ht$H5I HA*H}tt%;e-S.t]-S.;et+o.9H5 HAąd뿺H5GI Hu,.H5%I H H=)I \HH=lR.P1*s-H5H HE-R.H5H H  ʼn-R.xH=-+f.1I^HHPTLF H OF H=J-H=aQ.HZQ.H9tH-Ht H=1Q.H5*Q.H)HHH?HHtH]-HtfD=Q.u+UH=:-Ht H=n-deQ.]wH1CQ.1wQ.YQ.'R.i.SQ.  i.Q.@HfDAUATUSHHL%P.H5G 1oHL-E LML%Ө-H19H5E 16HHH @LH1I IL$HuH5eE 1HHBH5vG 1HH$H-H0HLj H0H0H>suL€uL` LHxLIH4[LIHMDDIA<$-t]LHtH5D 1HLH1LuGH[]A\A]Z1H5C ILHHLC 1H-N.H5jF 1H߾HH1^H-N.1H5F THH߾H1/H5F 1,H߾H1 H޿ mH5F 1H߾H1H5F 1YH߾[H]1A\A]ff.S1HH|$H=}.t99Btyju.N1ɉH=B g6H|$1HHH߭Ht$HH5B H^H[Ã..f.9$AVAAUAHcAEAT)U1HSHLdH;HHH HL9uHH8t H1=HEt)HH+H*D[]A\A]A^HEHH1HHHڬHHH=.HL.HtHEHH1HHH蚬HHH}H.jH}aDdÐSH=D !d.d. x$K.c.c.Nc.[úH5D 1cH1.K.ff.fSHt 8Hu H[H [ff.H7Hƀ-uPH1ruH=x@ Hff.fUSH=-oHH(HHHxHHTHk(H-Ht }HH/bin/shHH[ H-H]HxĪHHH-H[]'H5? 1HHHP- HxrHHH+-VH/bin/shHH-8/fH -H[]fDHHxHHrtHùH=; €uH=} H=g H=; tH=; h%^.H@USH=0-x3=%-DxP ----H[]Ð---1H5> qH1#+랐-ƿ--1H5> AH1*끐H1HF-u:~.HC.-.HyH=$-tÐf.PXH5N? 1HH1H=-D.H94fSH. D.t =.u%.薔.u|H[fDuH=> HtH5> H=$.uH=Y 1Ht>H=C.H1H> HlD$ WD$ H[H=9 Hff.AUATUSHC.HC.usE1E11ۋ-p.uQ/p.u7y.ŋC.tHt EH[]A\A]Ð2f=o.7H== dHHuHxHtg 1E1HAąWH54IW7f1IL4H[]A\A]E1E1ff.fSH B.HD$D$ kB.EC.5RZ.tB.H=B.t .H|$H MB.HVB.-B.?.t*H=.HtHHt 8mHeH|$Yn.iWn.tHD$HtH|$ HD$|Y.ZB.1H=.t5DrA.E!t7D$ ;A.21ɉH=; )H=V.A.tE A.LA.X.BfA.7ۍ.-@.H [fDdHD$D {X.Et XV.>A.l.=l.4l./D~ H512D1.Eu ".= .u8HD$HtH|$HD$1H5. HD$2f..H?.H59?.HQH=*?.s@.tH @.Ht?.Hc@<Hu.HttHH^.DfHE.HJH 8.@z>.t =G-)3B.+}K)^(}A &t31Á(} 1@f 1Ð;tc1{fHcA.H A.H5A.H9s( t uHDHH9tH t t1-&fD1=KA.|ff.USHHc>.Ht4fDH{H+Ht'HCHt`HHHuH>.H[]USHH- A.H HxrHHHH)؅t0HH| u$HTHH) Hz u BH9u==.HH57 1F#HH[]hHH=M@.H5<.H=<.HfUSHH=_=.Ht0f.HcA=.HH8zH*=.j.L-&H-1H=\s.H=<.H HHD&H<.h.7ut H-H-<.Hk<.H[HpHHcHcӃHM<.Hc H?<.H=4<.=g./gH5,/-H;-HD= -1ۈfD;fD;.H[]ff.fH5%. H=.Ht fJ)-( tz&tutq1==.}K{};uH}3 |~uf.w)#'{ Z/X1=0=.F =.-DS1H5-?+HHtH[fH5-"+HHu.-wH 35 HcH>fH.HtH53 H[ @H.HtH[Hc=q.[髇Ha.HaHHHxHH)H:AWAVAUATUSH8H=S<.dH%(HD$(1H=H=<.HpIHD$ IH<.MHD$L=;.A?HD$1E1HD$DHHHD$HHD$ 1ADI9tSHD$ IHD$A<tgI^HL$1I4/HH)HtHuHADI9uHD$(dH3%(unH8[]A\A]A^A_1AHI9vAHI9wf.1LfK4MM9v@HL9uff.fATAUH8SH)H:.D`HPH:.@4HP H:.HXHP(_:.P0Ht{Hd7.@4HKHO7.H-P:.1Ht$}t}t}tH-[]H :.H :.A\9.H6.HH6.ff.fHH=9.Ht蛾H=6..HGOH9.HG(H9.HG H9.G0m9.ЃtЃ.HHc6.HGHt`1HAWAVAUATUSH=.tHDQ6.EH-9.Ht }H5vG 1H}.H-?}.H[]A\A]@H }.H, HHDfD=|.tSHD2.Htxu@xt2HHuL32.H -, H5H=@ff.IHH5*H=ff.IHH5H=#ff.U@SH(H={.HpHR(={.HC8tIO1.H{.C0H.1.HH$1.B1.t 1.H[]D={.x1gHC8렐SH0.Ht_HHK0.SHs(H{ LCH0.=<{.t:C0H{0.HtcH[Zf.0.[@= {.xt.Hs8tb.X-y Dz.Ǻ1ݹ=z.Hs8͐H/.Ht&;xuf9xt HHuf1H.x2.l2.P_2.Pz.P HfDHt#?2.G22.G%2.G y.H5/.1Ht 1HzH111MH/.@4Hf.H=..t DH1.HtH1.ÐH1.HtH1.H;1.sH@H B1.81.:1.01.x.=x."1.Ðx.x.VB.~jSHJ1.f.H;5+.. HLx.Ax. {x.HC%Q%x._x.A.[A.ff.fH-...w.t I0.[Y.H=w-.w.A.tH=]0.Ht&+HH0.H50.H"0.H=-.HtH-.-.zw. /. -. HÐPX1H5x> HJy..Hu tD=,.(tցH# HD@ t[HD) {9tDHBuH# =n,.w=s.fDHU S@Hq,.H5r,.Hc  t uHcH HB t tH0$ i|nH>U HDfDH}s.Ht1H;Js.ff.H*s.H3s.HEH(.HH.s.DAWAVAUATUSHH $HL%# dH%(H$1I0HD$80߇HL$8D$4HL$HL$4HHL$k'.EuImEEt A!A\HcD$4Ht$8PHcH9s.PHAtRAtLT$4ID8HcD$4&.두H0H9sHHt$8芇HHcD$4PHAufDT$4HcD$4PH@EuAVEV&IcL>fDA}!5IHcEuIHL$HT$HL蝾HHcD$4?&.fDfo& n-L5&.L-&.)&. Ys.1ҾHD=t-L$HH茮HHIL$D=B- s.L5q&.LL-o&.H$dH3 %(7 H[]A\A]A^A_fDA}{賅\IDx@M]IEMEfI肅A!IfDH HI轭PH--H(HȰHx/HIH`IfKIHcsIEHc=-IpsI&ƄI‹- k$.LЋ l-#DDD8I@DHL$LHH胭D$OHAljD$UIAA|$D$ABAL|$@LcH= LL|$P説AdAtATA@6AADD$EoD$PLH!%tDHWHDHL)HrLH觬IH5Q#.HHt$ ԮHx;Ht$ HIkAh- ".LSWILLT$ WM]LT$ IHfDւM]AvKD =a HHD$ 1L@k-H  IHL\$(@LT$ L\$(H=7 L$H HLcHcƄAWQLL9tHL蜳L- !.LEIHD!.cI!ƁIAaAeAr DDE:M]ABIfDIHcpIH= .H-6 走讲H HصH&= .I A= .ABI ABAH= .I耵HŋӚ-  .H0I 5y-tsIBA\D$AABABgAE0<WAEIMIU0<7AEI0<LCƄ$LA#A\IfE lHl$@HaHIm赨HHD$舫HxHL$IAELʄu fHHBEt<}uA9Duu%XAAfA9L|$PLʾLL$ L胱LL$ IʼnD$LϧEKD$PW-  .L]=LL\$ I苧L\$ IHH LD$F.L1HIH= \$Ht8]//L1HHHD$ +Ht$ LHHaH5g-HL\$ 詧L\$ IML|LH H!%tDHJHDщHD)]L H!%tDHJHDщHL)HzBDHx}LHI#Hx}HH迦Im}IA[D$H¹ M]IAHH L!D$PH-ܖ-HH LD$HH LЮD$$H.mH.fDHC %.H"`.H.H.H)`.$SUA.D=BA. CA.s"iDz_.9fD .H_.EkvH.H=.rHH.f..D$H[]A\A]A^A_y@.111T=Q@.:5^.uH=d.Hپ1HQ H=/.= .HH .H=.H$gH$.E1.H=.v覛Dd$H.H.H.-].1D$\HHHy.H5e.Ht H~HA@D7D$ ,\'H=). D$uHQHqHH.rH.H.AVH+].AUAATUSHD3.H.EtM].E11L%5].Dr>.p>.&].Ņt؃7.C9E\E>.>.uc\. thA\.HC.HcÃ\=.a==.=.SIDe\. u. @=z=.=cH.HcӃ@, tjE1fH=.)Ѓ5.HcqH{.fD .tA<$tGtS fHcHt4^>.t )[.uqH[]A\A]A^@H=y.4uH1[]A\A]A^Ð=.5 .)[.HHD$Z.,HD$H[]A\A]A^f.AWAVAUATUSHx|$1Ht$HdH%(HD$h1H.HtH .Hfx.(oD$'D$#t$#"}@t2.A2t=-EAA2@A@1oD$Iċ.D$ D$$D$TD$HD$f.1|$'t 1A @8à AƀtN)uI|$uBA5HcD$ A< %@HHcHA| t);D$Ps AƄA A o|$#d1)FfDHqD H5.(HL$H|$E1)(I!DADAcH|$WEAD$ A΀ .7X.%AƄ fDD}E9HcA,At DeDDH-Bƒ6H5.HvH=".|7EADD}LcՁE D$ H5>.H\ H=.|7J fDȃ4 A<Dʃ$ u Dȃu # Dȃ@)(H.HvH4.|D$E9mC(-(A(l$(DfD(|$ D$ D H|$SD$ AD|$ AɀDȃ4 f.AƀAt'HcD$ A< uH@HA| tT$ D$P Hc|$ HD$L8ED$ QfDAD$$EfDD}E93EHcA,fLD$8LT$0DL$(DL$(LT$0HLD$8 Pt#H5 .HH=f.|7 |$pAt#tKA@to  H5 .<HH=.|7uH j-B^ D$ AtD\$$E A@u< tt |$ H5-BH5 .Hz AfH .HvHl .|D9 McCC4EQEAADt$$D$$D$f Hf-BuCH5M .HvH= .|7$E9| CLD$XDL$8L$0LT$( LT$(L$09ÉDL$8LD$XtQuu;&ue|t`H .H H5 .H HNT0H .@&@ƃ|@h ;_ tDHy .HXH a .HHHqTH5I .ADD$EfDLD)Fl(@IcgI<H .HvH .|HcA,DH .HvHT .|l$A)l$(DE9t$G<)H t-\HV .HvH .|~Hc /.5-.H.y9oED<A.'u EWHL$`E1ډDL$0H5P.-.HD$@H9 EDL$0uT$`aD9 HcHt$@DL$(LQDL$(l$`H|$@DL$(YDL$($0L$AE΅HD$HtH#HcAHD$H(Ht$hdH34%(LCHx[]A\A]A^A_Él$(A(D(@A@E9~LIcDL$8LT$0eDL$8LT$0I:A؃߃[t (;H.HvH/ .|A@:(?{* [ H5.H9t$@ D$`DD9S IcHt$@DL$(LDt$`DL$(DH|$@DL$(DL$(f.AD@H .HvH5l.|YASD$ DʼnD$ ~fD$'H.HvH.|AE@D$Pt+HD$I<8tHcT$PHt$Ռ]H|$AD$ HD$6fDDLD)Fl(@IccIE9CDED$hA)l$(DfDLpHD$HtH^H5B 1K|$T)L%.H1w.fH9-BthH5).HvH=.|7tMOD.HFH=.|74A@<DLLT$0D)DL$(Fl(@Ic^LT$0DL$(I@HcT$ fD1ߊ-@H.HH0.| E1'HL$`''DL$0H5-DL$0-I-H9HD$@ H<.T$`HvH .|gL|$@1HL$dDL$0LđLHY^HQHIHD$@Ll$(DL$0‰D$`2f.DLLD$XD)LT$8DL$0Fl(@L$(Icd]LD$XLT$8IDL$0L$(dH=s €H5-HH=n.|7RD$PfDDLLT$0D)DL$(Fl(@Icm\LT$0DL$(IHL$`A'''DL$0H -DL$0-<-H9HD$@LL%-D9McAD$CLd$@ Dʃ$ uuODD$T#KLDL$ D)Fl(@IcWDL$ ID$l$(ADC%DAWDAVAUATUSH|$t$T$HL$XDD$ dH %(HL$x1DL$0t Gރ>, H!@H |$"}D$ 1D$4@A@E1VD$$IƋ@-Lt$D$THD$pHD$8HD$tHD$`1|$'t 1@@à AA E4#AǃD )@@.|$'Mc@ƃ @Hl-HL-A|t$99t$@{H-HvL-A|pEt$D$$AE9kHD$BDT$ A@\H-HvL\-A|tE0|$0Ez r AH~-HL -A|,HL-A|H= HT$hLD$HD\$SDT$@ɀHT$hDT$@HD\$SLD$HA|DD$0D$0jf1D$4D= ?.|$'AA  A;\$XH-Hl$$Et$AE9|=@A@E9~H|$IcLT$HD\$SL$@ ET$pDD9pHt$(IcH|${Dt$pH|$(,z@$/ED$$%IcLt$IAHD$XDHL$xdH3 %(LW HĈ[]A\A]A^A_@V-tx<.\Eu/E1@|$'1EA)@Et$E9HD$McB EEcD$ HN-HvL-A|Et$D$$AE9HD$BfDD$ t \EEt$McE9AHD$BDH|$D)El@IcPHD$Et$E9 HD$AMcBB EeHf-HdL-A|QT$9T$|-$fDD$ `@؃߃[t (1;\$)D$$(9{F[H A-H9L$(D$pDD9AD)H|$Fl(@IcvOHD$@McEt HL$BT tH i{-D t!fHY-HvL-A|t@gEt$E9JDH|$LT$@AD)El@IcNLT$@HD$ H-HvH{-|HD$BMcE|$"`H-HvH0-|UHL$8DD$4`1`H -HD$(H9D$p;DD9Ht$(IcH|$vDt$pH|$(uH -HvH-|EfD@GH-HvLc-A|ZAE9DH|$LT$@D)Fl(@IchMLT$@HD$fKfDLt$LL5-,uH5 1xT$|$TH1M-|$`@؃߃[t (H-HHp-|H|$(lYLA-A|AfDH|$LT$@D)Fl(@Ic@LLT$@HD$D$ @ʼnD$4@fD@+H-HvH-|BDD$4DT$@AHL$8''' H D-DT$@--H9HD$(jD +e-T$pEuDD$4EH-HvH (-|L|$(HL$`1DT$@L!LIK='p-*7|$47DT$@Et|$0T$tLt$(T$pEt$H|$(D)H|$Fl*@IcJHD$n^AH-\@"" d-u T$4 H-HvH-|L|$(D$p1LD$`L$TPLsLIJt$t1LnLHD$( rD$tPT$p,@B|$0H=} D\$SDT$@uDT$@D\$SH]H-HL]-A|DD$0D$0,@Et/AHq-Hv[L-A|uLHY@ HD\$@HcDT$( 3-ID\$@DT$(H-Hc-5@D$0H-HvH-|D#DT$@DD$4Ht$81eHD$(DD$4HL$8}1{AAHD$(D)H|$Fl(@Ic:HHD$Lt$LL5-p"DD$4HL$8]1[LHD$(:t$4L^kLIHD$(oLr‰D$pD$0VLt$LoLt$(|$`hrL;-fDAUE1I)AT(1AUSHdH%(HD$1HL$HH-H91:Aă)t$H#-~HcHvH-|FHH(D$H{PHctoHcD$H)HcD$DdHcD$E1DI]nHt$dH34%(DugH[]A\A]f.D$xHcFHËD$HHAPHcnHcD$HDI]-nEHqfAWAVAUATUSHhD=-dH%(HD$X1Eb@0.%Aǃ&Hq- uA#A /.zrH{-HvH -|SDƒ<D‰€濉/.@t D;=/.&,A9I#A<A>&„ H-H9+H -|'+1A&$@$H-H,H M-|,H-H fHH@lH -=A-(''5- t'HvH -|'߉z..fDH' H -| @A-u:-=$u*H-H H -| =B- AGD$H- D$<$1D$D$HD$HHD$ ~Hc a-E1t HHcDtA\,AH5Ao-ITH--HvH-|55 -QH9qD<E1HL$ D-DDEA`AA--IH0-I9 D$H)-H=&-D9DmHcLD4/IcHAkl$HDA"u$LnHDD$D$LE1+jD$A$D$$D$A Hc-tH|'A!AAǃ $A$H d-Z-LcAAE1DuHA9F<(AGE1E DAD#l$D D$D,$Uf Hlj5-Hc\AHc m-HlDAfD5-E(+.DL$(DL$(fH-HH-|mA\`n-f.+.A(AA|@AH-HvHF-|A| 5-QH9 D<HL$ DE1)(DL$EM--A-IH-I9f D$H-H=-DL$D9 DmHcLDL$D$/IcE1Hhl$HLgD$DL$D .AG߃HsPH-HvH6-|t5(H5}-HtHi-H -A$DA<EA=LcAA =-V).tVt'< w H t'LDD$(rDD$(4+H=$-DD$;J/Nt/D A=A5(.DL$4 L$0HT$(kHT$(DL$4L$0D AtnHG-DD$;HvH-|/DD$(DD$((H5 -HtH-Hq-fHi-1E1F$AH-HHN-|AH--AA@HA%&DuA9uB(E1Lcf.L$0DD$(=DD$(L$0(A߃[EH-HtH-HD-v-LcHh-B6H-HH5-MHm Hd HPD|H-Y H-HH-|ESA'AA"@AH5D-HBH-HF|2,A$H-HD,LcH- A$DA<EyA[=-%.LctBt< t~uH=-J/ HT$(L$0dHT$(L$0 BfH-HH-|LcH f-F$A"1E1-)HDD$(MD $50-Hc:DD$(D $H-D1艿 H -HHi-HttHrDH5U-ELcAA`@Au^AA"AAA HH f-D$A@u4EH -E1D$r-#r-E1E1AD$H E-;-f.)%5-Hct9HH -D@fA$UH5_-HvH-HF|2)-MH-9 UHcD$Hc$A$D$@HDD$()D $5N-Hc8DD$(D $H8-FAH #--H5-HH-HN|2qH5j-HH R-f.E1AD$H --OD1&H=-t$LcH-B HvH-|D--L5H-A+ --tA>e-6!.t!.A>{QA-tDL$L$"A5 Au A>-jp!.5 A>]+ A~] A~ AH\$XdH3%(DHh[]A\A]A^A_fHc-5-HJ9E (Ht$ D-]--IH-I9D$H-H=-D9>HcDuLHcD<IcD,/H_Dt$HLE1^DAD$DP . E1DHc-5-HJ9% (HL$ E1D)(---IH-I9D$H-H= -D9Q HcDuLHcD<Ic/(H^Dt$HL1]DD$AD$ H)-HvH-|A{HL$ E1]D[IHS-I9Wf.HfD HDL$5-Hc4Hc -DL$HfHJ.LcE1E1H --D)%5-Hc$4DL$HH-)%5-Hc3HH-DHc-5-D%-HJ9 D,-A' HL$ E1DDDDL$--DL$IH-I9D$HDLD$L1LDL$PLI=[t$L1LWLI$[D$LDL$PT$LD*-H=-9: HcLDL$(H[Ll$LZD$DL$(D$ N-tR-$H-H H P-| H=--e2H-fHL$ AA}D{ID=-HH=-Dl$BE6 H"H-|=.- -t D$  -MWq}HcH91H-2-CHHH]ZD\$EtKDT$EtKDL$-A~puA~K@D%-EH&D$ D$$DLT$hLT$H5$I-HI-HD$HEE1HP\$Dl$ HELT$EHHsAHD:&uL[uIcH|$x.HLT$\$Dl$ T)_A|U$~7.pfDDS-D .DЃCtHD΁t'Ѝ< w H tvA2t6DL-% Au DуK!A4DSA L-A4DSH(-HH@HHL$ A ]D[IHI-I9D$HB-H=?-D9DuHcL/[IcHZTDt$HLmSDD$AO Hlj5`-Hc<+HcM-HDH)у 5-Hc+H--=$HfHt$PL$rTL$tHD$PHcH9 H-D Hlj5-Hc*Hc-HDV-=t A>i A>dA~oA~A 7fD)%5-Hc)HH-DHL$ A'''DL$ --DL$IH5-I9D$HHL$L1LDL$Pa]LIvQLLLIcQLTDL$‰D$L7f.H fDH 5fDA>}A~ Af  1u1b. %.A +B-"fLT$D-Eu^M'h}HcH (CHH--HH-QHJH U-mDD$$.uV=-tHt< 6 t"v LT$蝌LT$t @7$-D$.\$@HI-|D$ D$$AA|*A<>H-HH-HfA&A(u‹=:-  tH|$PnH|$P11lH%-@4\ .u O .A>@Ɖt3@t.H-HvH z-|A-@|H-HvH ;-|A.DA~nA~=u .-AKf.A|iaH'-HvH -|wA/@ -5 .-u--Hri=X-H .._-A% .f.WHvH -|?  .1E .Il$DD$=0膑DD$MtLDD$.DD$H=-HL%a-y@-A0-J-A{-)ED$D$<A 1蕣dA!EL5-%.D%- .Ƚ-- uD=w-EHDD$(HT$.IHT$DD$(8.AMM|$|BfH .iA-H|$Pm- ]HT$P1AHH_H+.WfDHH -| 5_-|BDA"討D)LDD$(%HT$AHcI-DD$(HT$IH3-=p-3HkH --|Y5@.2A}Ǽ-OH5 1G|$4H1ݡDD$H#-HH -HyHJD H -i{}u -Df.f-u<5HM-A%H>H ־-|,H ,-H-A# H.7.&H ޽-HH5m-HQA)|H -HtrH-A'11ɸ- Mz .LT$zLT$Љ-A'* 4-[. -H -HtH-HtH?H-A*H.@A&A$.A(.5-t AdHH1H5l D=ɹ-HH1ܞHA H -HH-HHrDA#H5- .YA)ALXHT$P1A@2HHZHf.} H5{ 1ANC=-H1Z}-t-1H5 C=-H1ʝ`CAE1H -v-'Lc Dޜ>uJH Һ-HvfH5e-HQA,|H -Ht-H-A+H -Ht H|-Hu-A+gA,\HE1AyH@- u--t.w- tHfDATUSH=tIÃ(=tj==xH5 1A=-H1C-1HH[]A\HvfDkHHt̃HH[]A\@{HH1H5 @=(-HH1跛H=gf.--=k-)1H1_H}1H5y.H>=H= 6-%#-f.xHHt{H5u 1==-HH1KHs:H1L葎-fH5 @1H5 2=H11H50 ==A-H1ӗ뎀z=zVH-=uWH5-11ҿ0[H1ɿH[H:1H5P <=-H1SH߉D$ 袍D$ GwHHt.1H5Y L<=z-HH1 H191H5c <=L-H1ޖfS*=- Ht [fH1H[8ZS=\-!Ht [fH1H[YAW1AVAUE1ATL% USHxdH%(H$h1Lt$Pf|$PH$-LM-D$H$Hl$Lt$IcE,LEA3x-=0EuA~^McH5, Bv9GH F,pDEt$ok-I-EHt$H<$fAFI^H?ITH9L)HHH'*H=''HFHH$H|>IHH,LHH=H$Ht$HHLPHHD$ IHT$(MLf=IL;|$tLHD$6LT$HD$(I\.IlHD$ IDH9D'LT$MAt`L1@H 4HDt$E|$uS -?uCLkH F,hDEL9t>HHHE,DA3tAA~wMcH: fB-1L5--tXt uOH@-H5i-H9tHu--uy-%G--HL$ w-y-s-i-h-HL$ -ƀ;-= --0u)H5-HA-+K-~ uHH)H5-0-0b-fDHH/ Etf-HuHEIIHt$ IAHD$ IiIAAB (Ɓ~wHcH f;4HtMH HcD,PD fD--m@-u}XfH D,HDo -HID$MtLZ}=HL$ KUHL$ #-N-DHELMLsAHELMLsAHU1ɾ Ls-AH= -H-XLMHUH} LsAHŪ-H=ƪ-WLMкCEHU1ɾ LsA-H=-H-WLMкHU1ɾ Ls[-AH=N-H?-RWLMHUH}LsAH -H= -WLMкEHU1ɾLsA٩-H=ҩ-Hé-VLMкHHELMLsA3,HEHuHPHuHpLMLsA3HH HuH2HELMLsA3HEHHHHuHULMLsAHHELMLsAHELMLsAHD$ 1aHELMLsAHD$ -LmD4HEHtH8t H1]H}LDHLsA3E5- L`W5-IHc-Hˢ-LmD4HEHtH8t H1H}LDHLsA3>E5<- L`5-Hc-HX-H=\ LmD4DC1HCH}LDHLsA3D5-LM w5-iHc-H-H= LmD4B1HMCH}LDHLsA3aD5_-LM  5E-Hc9-H~-H= LmD4jB1HBH}LDHLsA3C5-LM 5-Hc-H-H= LmD4A1HsBH}LDHLsA3C5-LM 05k-"Ԣ-H}LsA3 -HuOLM -H}LsA3 -HuNLM r-H}LsA3 Z-HuNLM Hc-H-HuLsH}A3F5-LM P5-BHc-Hğ-HuLsH}A3JF5X-LM 5>-H}1LsA3Hc"-Hg-E5 -LM 5-Hc-H,-LmD4HEHtH8t H1KH}LDHLsA3B5- L`E5-7Hct-H-LmD4HEHtH8t H1؍H}LDHLsA3A5*- L`5 -Hc-HF-H=J LmD42?1H?H}LDHLsA3,A5-LM e5-WHc-Hٝ-H=ݗ LmD4>1H;?H}LDHLsA3@5M-LM 53-Hc'-Hl-H=p LmD4X>1H>H}LDHLsA3R@5-LM 5-}Hc-H-H= LmD4=1Ha>H}LDHLsA3?5s-LM 5Y-Hu-LsA3H}@51-LM 5-Hut-LsA3H}?5-LM 5-Hu2-LsA3H}?5-LM X5-JHu-LsA3H}M?5k-LM 5Q-HEHtU PLMLsA#HEHtpLMLsA#HELMLsA#HELMLsA"H}Hu;LsAH=LMк"ZH}LMHuLsLL$(&?=A"LL$(H}Hu!LsA<LM"HEM-H3--LŃ@̀1-LMLsA3HH!к%H LMLsA3HH!к% eHELMLsA$ILuA>MuMnHT$81ɾHH!H#D$0HHHHHD$0H|$8}FIUHu0IEHu|LALs;LM$HH HuHH}Hu|LsA{;LM$111BUH C;u -;LMLsA#K111PBU PU ;u -;LMLsA#HELMLsAHELMLsA3HELMLsAHuH}LsA<@LMHuH}LsA?LMiHELMLsAMHEHuHPHuHpLMLsA4 HH HuH2HELMLsA4Lu5>-Lo-@J -9 -LMLsA3!Lm1&A}Lj9=--@ -9 -LMLsA3!ELuD-LE;-@ ;-9 e-LMLsA3!LMLsAHH!кH 0LMLsAHH!кH;LMLsAHH!кH zHELMLsA4^H}Hu;LsA4"8LM4H}Hu LsA7LM" E1ɾLsA`-EH=V-H-HA-TBLMкE1ɾLs-AH=--H-BLMEH}LsAȔ-H-H=”-ALMк?E1ɾLsA-EH=-}-Hv-ALMкE1ɾLsS-AH=F-8-H1-DALMHUH}LsAH-H=-ALMкyHEHULMLsA3HHRHELMLsA3H2HEHULMLsA3HH HELMLsA3HHUHELMLsA3HHELMLsA3H}1LsAG:LMH}HuLsA":LMdH}1LsA9LMAH}HuLsA9LMHUHELMLsA3HHUHuLsATH}9LMHUHuLsATH}9LMH}Hu1LsAT9LMHELMLsA3dH}LsA3:LMCH}LsA38LMк"HUHuLsA3H}9LMHUHuLsA3H}8LMHuH}1LsA38LMH}LsA3AH=/ HALMHrHuHMHFHu2HNHELsA3H8@LMH2HHHuHHEHuLsA3H8@LMкHHuLsH= A3i@LMHH}LsA3?LMкHHuHMHFHu2HNH=# LsA3@LMкH_HHHuHH}Hu;LsA42LM%HUH}1LsAHm-H=n-y<LMкEHU1ɾLsA=-H=6-H'-:<LMкEHU11LsA-H=-H-;LMкpHU1ɾLsǎ-AH=-H-;LM0HU11Ls-AH=}-Hn-;LMHuH}LsA/LMEHU1ɾLsA -H=-H -;LMкHU1ɾLs-AH=ٍ-Hʍ-:LMOHUH}H-H=-:Hcw-JLMA [-H -LsHѺEHU1ɾJ-H=C-H4-G:Hc-JLMA -H -LsHѺEHU1ɾ-H=-Hь-9Hc-0JLMA -H *-LsHѺ(HU1ɾ-H=|-Hm-9HcM-JLMA 1-H Ǝ-LsHѺHUH} LsAH -H= -9LMкEHU1ɾ LsAً-H=ҋ-HË-8LMкHHU1ɾ-H=-H-8Hcm-JLMA Q-H -LsHѺHUH}H3-H=4-?8Hc -JLMA -H -LsHѺH}1LsA~,LM`LMLsA3HH!к%H 5H}1LsA0,LM-P-MHV-&-t -D-Et-9z-[1L1]D--H-B-ExD%-1LE@yH-MHU1ɾLs-AH=-H-6LMHUH}LsAHc-H=d-o6LMкH}LMLs&LL$(?+A3LL$(HELMLsAH}Hu!LsA4K+LM]H}Hu LsA4!+LM3H}LMHuLsLL$(&?&*A4LL$(DC-HELsLMA6EHD$HLL$@T$(,H[]HcDL H=,6}-; ,9[/9H[]fATIUSHHdH%(HD$1m H1HHUu9H$H9t0 t uHH$ H t t;tt"1H|$dH3<%(uH[]A\DMtI$ff.t8x--:,p--D-w->x-fHuD t uHtu1fD-JuMHDHtHWB< w"f0HHcHBHt r@ vHHEHEHE11fDHH(dH%(HD$1LD$D$fHHIIHHHHI)Lȃ0AH wӅH\ L¿H | H5 HD1HD$dH3%(uH(ff.@f.0< wHu1ff.fHtHHt 6fD1ff.fATUSHtc/E1@tFH H0@DFu@_u*CHStNu<_u#HuAD[]A\f.E1[]DA\D1HtU?uUSHHXu<uH[]1HfH[]H[]ff.UHSHH8u¸t1Hu H[]@H11HHt8EtHH1[]HHuHfUSHHGu/t(0< wOHf.0< w9HuH5$ 119HH1UH[]uH[]fDHŅu1H5Έ HH1jUUH/SHH/1HtH[]fD< tH , u/D+D űr-tHH[]>fDH1҉[]ff.fS/H>/1Ht[H߾=#/1[H‰teH ,u3<>v6HP@Ht5u <>wHs1@HPHsfDf.ATAUHSH0DFu_uh=[t\HU10f.Nu_uote=tH[t&+uՀ:=uЃ[]A\Et8[u311҉H)H|]uBHcL5+u|5=Bt[1]A\À=tDS11{x!%u[@߀1[V[ff.@H1Ҿ1*HUSH1HH1Hy1҃;H[]H1H=م %xHfDH=o-HHt1yHATIUSHH@dH%(H$81HtKHtnHH9t&1H$8dH3%(uyH@[]A\DHqH9suH\$HHL$HNuHL$HuH$LH(zHj3AVAUATAUSHdH%(HD$1ZEAA Ll$ tP1LGu9t6Et1މÃt!EtH=mn-(9tHL$dH3 %(uSH[]A\A]A^~=OÍXB@/A_ff.~-< t&t-VHDG< t HtH9u1f.SHcx*;@n{@ZC1[SH?x{xH1[fDHHdH%(H$1HH$dH3 %(u HĨf.HHdH%(H$1H1҅uD$1%=@H$dH3 %(uHĨSHu[DH߾ [Ð1HtE?.tW/tt.uW/ Ðf.ff.@HtG1t/t1.t@W/t't#.uW/ Ð1DfH/(HHHt?/u"SHHxHH[H1HH`?/t'S/HHxHH[HEfHufDATIH=e USHt4HH~$HcLHHuI4tH[]A\H= Htπ8tHHH$wtH<$H~I<~tL1/uHuH$I9'HL)..H)AD$.I|$fA$HcHeAD,f.H /tHPHHuL`@fDUSHH|u8uHH[]f.H(tHH[]fDHH11[].ff.HUHSHHu9uSI<:titeHcDNHDA)fDAIHt:uU9t7HH[]Z@LcIA<:uLcIAuA8uH[]ÐUH1[]1ff.fHHް-k-Pk-t f.UH-b SH| HbH(HXH@Hk-BHHp H@Hk-Hk-H>d-HHhH@Hd-HH@H7k-H[]AUATIUHSHHHH[]ff.AWL= AVIAUATIHUS1H(dH%(HD$1HD$nIHD$HD$HcL9sXI4<$<'<`=-~At<HcL9rfH|$dH3<%(LH([]A\A]A^A_f.LHL$1Hl$H)H&Hs8HuC@<"eAL$ZDAL$JDHl$ Uf.SH#H[HSHdH%(HD$1H\$@|$HD$HHEHT$dH3%(uH[f.UHSHHq-~&Hq-q-HHHhHH[]fHhHH[]SHGHH1H2H[zf.U SHH藼(HX@H@H[]DAUAATI UHSHO DhHL`Hh6HXHH@H[]A\A]fAVI AUAATIUHS LpHDhL`Hh˻HXHH@[]A\A]A^fAVI AUAATIUHS~ LpHDhL`Hh[HXHH@[]A\A]A^fAWAVE1AUE1ATE1US1H(HGH|$Ht$L8T$ fDA< tN< tJ1LHTV CHcL,uE1}t(L}A< uI@LD}u؃=(sHD$ CMLcMLsMHD$H|$LkHC 7 HXH H@H([]A\A]A^A_L1LIǃt|tWu2E1H8t HILfHDE1E1H8tHIfE1H8tHgIfH5,o ~H5p 1|$ H1C?HD$1H5o H@HT|$ HH1?L;L3L+1ǥ-H([]A\A]A^A_H=m I\H=Y I.H=E I'@UHSHY HhHHHXH H@H[]AUAATIUHSHHDhL`HtH}t H1XHHHk ǷHXHH@H[]A\A]ATIUH S舷HHtH}t H1GHHkHLcHC[]A\ff.AUI ATIUHSH LhHL`HhHXHH@H[]A\A]ff.HHff.HH|ff.UH SHyHlV-HCPHhHHCH H[]ff.AUA(ATIUHSHH V-PDhL`HhHX H[]A\A]fSH ε1HXH@H HtSP[ff.S 葵H脵V-HCPH@H@HHCH[ff.fUSHHHtfHt)HkHu%֟-HEHH[]@HHu fDHHHuHCHPHHpHH[]@Ht$H<$Ht$H<$ k-Hqff.@AWAVAUATUSH8DwH|$ AFt$,\Hl$ 1HE H81WIHD$HHHÉD$(HE H8HE L}(@1E1D$Hc1HD$|$AIH k-rT-th-LE'AEtD$(tyHD$D8 tWL/D$HA9|)DrLHT$DHcHҳHT$IHcHcLIcLfQHT$HL`u@HD$A< uMADHD$ H@ L(g-H8[]A\A]A^A_ET$(tGHD$D: uHT$HLt)A IE'A tDHD$A< u[H5R-L1bHL$ HA(LI$1H5h HT$t$,H14MH5)h 1UH8D[H]1A\A]A^A_3f.AVI0AUAATIUSHdH%(HD$1蛱LpL` H@(h@DhHHh HHcH>I<$HTH$HcH9L-1 CH$C Ht$dH34%(HH[]A\A]A^@CACBCAM,$L4HL8-uI<$[31 ChH5f 1H1.,AVAAUAATIUH SH=:F L`HHhDpEl$H@Ht@(uuHCHH}HHkHtHKHx貯HHHHk 薯HXHH@[]A\A]A^@HxHtWw15qHCHpJO-HCf HeE HDHCEff.fUHSH HhHHXH H@H[]fATIUHS訮HH-Hx蔮HHLc HCqHXHH@[]A\USHHHWHBHtH8tH1>HSHBHBHtH8tH1z>HSHB-tSHCH@HtFH@1H(HHSHRHHtZHRH2HtSxyHtH=d 1%O-HH[]Ð1ɾH=d 5vHu1H1uHH=i HHHMd HD1f@USHHGHXHtyGusx;umHH H!HugLCAx;tZf.LAAx;uHIHLI!ItHH7HSHBHH[]DH[]DHH^a-Xa->a-H+a-fHH`-Ht@5`-;5`-}HHǃ怉5`-HcaH`-HD?=`-Hcܫ`-H`-HfDAWAVAUATUSHHhHt$8Ld$Ll$HT$@HL$HLD$PLL$XdH%(HD$(1H$$HD$HD$0HD$xD$If.D$Hc_-L$H_- _-_-HHHk<%uDsEtHkAc~LAd:As$/HT$HBHD$L2AL%;fDA%~D$%AM!Hc= _-LLH=_-X^-9D^-H^-HHD$(dH3%(SHh[]A\A]A^A_f1H5:c MAH1?(f.$/ƒHT$$AMD$3f$/wXHT$Hc:$xY LחHIALÅGE>{LcHT$Hc:HBHD$yA L1H ` AMHT$HBHD$DƒHT$$fHtKATL% UHSHf.HCH;LH=` HEH01HHu[]A\ff.@ ]-H ]-SHc9#H)уt 5\-HcH\-~HUG*I0H=\ HuH=] H1[]GtH=j 1HuH=\ fDGHuH= \ 뤐HH=Sq 1[]@GtH=i 1kHuH=k\ ^H= 1EHC HS(H=[ H0H1[]&fDGHuH=j[ fDGI0H=R[ H1[]G^H=F[ H1[]fG&I0H=[ HuH=[ G6tH=h 1cHuH=Z VGtH=ph 13HuH=Z &HUGI0H=Z HUGH=Z H1[]fDGI0H=rZ GtrI0H=hZ HUGI0H=ZZ PHH=sZ 1[]l@I0H=Y ufH=Y @H=Z u@H=Y e@I0H=Y H=Y @H=Y @H=Y @I0H=%Y 1f.I0H=Y 1wf.I0H=X 1f.I0H=X 1oHk XfDI0H=X 1Of.I0H=X 1/f.H[]fH=?f 1Hk fH=f 1/ff.fUH-X SHHuoCtyH{H=l 1xHCH=4 H01cH=l 1UH[ t1HBCu1H=X ,H{SHH=,X 1[]H{/H=X 1H[ (H{H=W 1H[ HCH=| H01H=l 1H[@t H[]@HCH=< H0H1[]eD T-HmAUI?ATE1U1SHHCPtGfDuCu {HHHt<1H=Nk CPuHgHHt{I$HIHuHt~aS-umH=k 1HL%f DH(L1~HHu S-HH[]A\A]Jf.IHEDH-R-H[]A\A]fDHC HHt({~ƒ$ Ѐu HO-LHPHHAD$AT$LT$ 9-T$HN-A9N-{9-=N-HD$McHE11HD$/T$LDAH΄thD9%Q9-~_IN-9~RAtHt$HLlHN-dd<HH N-~DH1A>tZC >tQ=M-G9}DHcKD>HT3)Ht3HtHHH9t JA>HuL-xBH@HcLMLcAbIcH|$L T$VHHc!M-謘T$HHM-]HL-ATAUHHHD7-SHHL-uz;t=EH=L-IH1HaP $H=uL-[]A\@EuH=\L-IH1H} H=-H=>-1H=fB HC>-HxnH=^>-t H=O H=A 1%DΦ,)D>-H=)$ &;H==- =>-H$ H=ܩ HD5=-H=l 1HCHxH= 1ɾH=A `H=A 1DH=@ ,@H5B 1赳H1HCHx@1H=@l j,=-7fH|$D$ @l$D$&uHCHxHH=yT 1HC<-HxH=0# {L`H@H@HxwB,-q<-)o<-MH=q@ L2LefkH=S 1mH=S 1ZHCHxHD;-Et;-H=^" 1衲H;-d;-H;-HU;-HH.;-h;-HQ;-TH;-H5]i 1HfDU1HH=u SHHHcH};-H=:-t H= (1H= ? *H;e,:-H=:-t H= P>,):-HH= [] ff.fAWIAVAUATUSHD-r:-D%,U:-:-H4:-Ht ?HcH=t> 1AjAp:-H='> :-,17L8 HtgH-9-D-9-D%N,H=Y .L%o9-EfDHpHL[]A\A]A^A_DLxH@H@HxWD-`9-D%ݡ,-N9-MtH=X= LL{L%8-EuA|$ uL襯It$I|$HPHZHL[]A\A]A^A_ yOHH=s 1~fH=g 1 ,8-H=< 8-H=< 1SHH?Ht軫7-97-| H[$@HHHCHc7-P7-H7-H[fHt7SHHHtH{ HtH{HtiH[0ff.@N7-9L7-H|邃fHHHGHc$7-P7-H7-H<HAUL-6-ATIUSHHHHHtAH{H+6-96-}L#IULcHc6-H 6-HHHuH[]A\A]@ff.@HATAUSH0@KwLH/|u4u$HHHt6H+CtH{H{(ǩH{ HH賩Hu[]A\fff.@H AUATUSHHHHt8H v; HcH>@HkH}H}H*HH[]A\A]HCHxsH{HkH}SH}JH}AHɨH{GDHkH}H}jH蒨cDHCHx{HCHxH{e6HkH}H}zH}H9 @LkI}SImHt&H}AH}xLeHLMuLH{fHkH}H}H}H} H蠧qHkH}H胧TfD1ɾH=r9 m.SHHoH{H{Ht ['[ff.SHH[f.SHHHtڦH[ѦSxīy[fD[鰫SHnLH[eDH1ҿ]ff.fS1[Zf.UH58 S1H3HH[1]ff.@AWAVAUAATAUSHH8dH%(HD$(1D$%HH|$HAHHIA)HgfffffffH?H4 HH)HHH)HH)fDHG IHHH?HH)HHH)Dv0HEqHuMcҸIDtHcHEtEurm1H|$IIgfffffff)DHF\IIHH?HH)HHH)DI0HEJHuɍNMcHcI)HcLDL A΍iHDLEuMcIEuIEu,AH\$(dH3%(H8[]A\A]A^A_DAsLcIfDD$ DD$ HtlHHtd.DAHcANdHL : D0D5A9|A$'-Dh)-^)-HtHmHUrH=- )HD[]A\A]A^A_H)H;=,@LgxH9@L9E1H;==,H;=ȉ,E11@HLD$1DLD$E1H&-AEHH9*L9Y W-1H;,…uKI}%- %-Aŋ+-DDH=, H;1,SI}%- z%-A1H=, LD$H5%-LD$HhLD$IAH5E HEH=;VLD$@%-$-Ӌ=X-AŅ*EH;y,H=3%-H=, )@H=+ L$H='-_H=$-NBL$1$-A&-n$-$fDH=$-t$H=w+ T$^H=711NT$I} $- $-RR-AŅfD#-~D#-D9!H=#-}#-#-~D{#-D9/H=f#-EZ#-pfBL$2L$L%-MLnHxmLHHH=nH1FH=H15BL$|fAHcH= * LD$H5#-LD$H`AH5Y( 1D$薘D$H1DZ"-Q1E1H5C( 1D$HY-ID$HH1D"-UHSHH5b -yu-S -t - /W-H[]D& -H;t膝H~H;őHt P(@u%H;HJHuH;.H1[]DtH1H5( eHH1jX-1HH5~( )HH1= -X-ff.HCH&fDUSHc߿H9kHʼnuH@HH[]fDHkH1HEHߗHH[]D5 -tJ ` -u@ -t  -u,HM -Ht  t t uH@@& -ÐH=-Ht HH-Hff.@9=,Hڇ,HEDHŇ,Ht88u)HHHZH,HEH1DHHHGHGHGHG @SHHT,H54,H!,#,H,H%,HxWiHH茒[,Hچ,Hӆ,fSH x |C {x iCHC[H=,G x9tSH%C [ff.Gx9tSHC[ff.HG HGHGHG ;=,u" ,5,,,ÐATUSH0dH%(HD$(1HHt#HH|$HD$D$轓u!HD$(dH3%(H0[]A\@H;PxHcgH;H躅HP(@Hc{ VH;11HIN9LƏHc{UH;1ɾHI(9L蠏LHH $ H1МHc{UH1HH׮H_HW fH6ZtH;#ҐH;ӊH\T-H9tHtRP(H;HD$HD$L`LHxfLH贏HH HH;P(ff.G Wx29tx29tDG 9u xGDyH=,롐SHH x9t9{x9tHH[ CHH[gt$ C t$ f.USHHH?Ht[xHcKeLH " HHH1ؚH H;HH[]jf.H[]fATUSHHdH%(H$1IH$LlLϙHWHL1ڌC$HH;HtތHF1HHHHCHCHCHC 而H$dH3%(u H[]A\ff.Htfff.@H=,,ufH=i,@^,tÐff.AWAVIAUIATUSHHdH%(H$1蚑UIċ(/-1H~=P-AŅ]Ht9t4 t/11H賕11H蟕WA,$H-O-H$dH3 %( H[]A\A]A^A_=/-C1H10ADž@{m-l跀/-(QH-@ t H@H-1d= -?3-E-C-A-N--7-|L}LpADx|HEt-IcAL$HHHHTH)HHHHHH9uH>-H]HEIcHDHE8-uHHE=-G1H=K-u !H<草H9K-H=K-uH=-D=K-H-H-XK-L5iJ-_H=sJ-辒fDn1H5L HHHH1Lt$@ǺD$LX|$IljD$ȍE~SAGHD@A~ |$@#u2A~,|$@ELFu"D$D<<uA@|$g"fHt$@Ǻύ11H蓒FfDHL$@HHL$藍DHD$Ht$ HL$HH &H5 1HHH޽~H1;A$pfDHD$`D|$zT$|HD$ HD$hIHD$(D$vfD$D$xfD$D$~fD$8AHHHT$0Ht@HL$(HT$0HHD$(|$胒AALD$(ADA9ULD|$T$LL藎IHkHL$ |$LH'T$L$9L誆5D|$A!IFDf t H9uLHIA,$HcA|- $H5 1~$LHH1L A4D$\D|$nT$pD$ D$`I։D$(D$jfD$D$lfD$D$rfD$8AHHHT$0UHt?L$(HT$0HHD$(|$AALD$(ADA9LaD|$T$LLIHL$ |$LH苐T$L$9dT$@ƒHL8fuIL݄LI`E1Dl$ E1Iʼnl$LH\$@H~K1HLHuYI9uILL蒍HHt|$LLHIŏHLl$H\$Of.Dl$ |$H\$-A$AuXHH= 1L~D$ fȃHH)Iփ:fuLHH=b 1sD|$8IMIW HHT$0CLD$(HIO|$HLD$8HT$0HD$(ƎAVLT$(L  HI;G LD$8tLLD$(D$ST$$H,HD$H ^fDH|$|$S@czfDA x[-4H=-HtTH5,HHt$WHx,Ht$H7UHP-T$BH$$设H=oIHD$0JH=,L19T$DŽ$HCHDH=,L Hg01_XHCZH8h=,T$$tT$$JT$$葺T$$E肾$$$9&H|$0[SH=该:LDLJ)H_,A^H0,HHۨH= ,H ,Ht迨H,$s-A=,腾|$蝹D5%,ECE1-D$L|$(^=[,D}$H|$0IHT$kT$-H|$0QH=2E MDLp-D<$.H5, EWD$TD$TD9D|$BLE<$DAEA]-EttA uD _WD=,EG?ʂ; <$tHPHtJH@HtH,, , IGHxW , , IGDMHx-m,R1ɾH=c  Hx,,HtO D$, ,IGP !-,su-D$[$, H{HBFED$|€,tptl-D$|-,軐D$|=,~,t-D$|Y,Ei \$D$|AOMDL/D$vH莒D5,D$UB1yHCH{(,L C,dH=I蠠H=1L菢tHCHLM{FN,x,CH߉P,w5a,\A_ T-u;H=-HtML-7,LQHxn%LHNH- ,AŅtLH/-HIHEH8Mt AE)*H1LlHsP(@wA<$IH{yE,AŅt ,u,,,{,tn,PHmHC,}=,肸mH5蛳dA|$FJA|$S>A|$2Hj%D[W=X,9NHEWH01LRB D$(AB1ˏ@rD$L<$-u,D5 ,qB7XAGMDL$,'-ŅD$$#N-E!,$T$|-},褌T$|$k,"HD$8HsDl$L<$H5, 1P,,H>H|$X1H)jH@(@HD$@HxD=B,At =,u:|,z,,,t,H= KHHs1ۀ8fIEHDl$,$L-,,H=7rͰiH$HtHD$h,HH|$@Ό蔰=,TH$HKH$H~zHcT$(H9pH$ HHVHuHBH?=.,D$(E1AAADDl$(b=,赴DH[A $,t=O,u = ,@L؝H=ػ--,D$(Dl$Dl$L<$,B-MDAAGL$t, -UŅEu;$ u5t1 -D,$ -1,X$,$ u =R,l$o=,蔳K 1H Nb1/t4*,E1D$$=?,LDd$$m?,=?,NAA|$R<$Hxt HtOD$1|$t%=,迲=,诲nխE=,蕲'軭=,{MDAOLD$$D$D$ED% -x=,1踉H=>蔛H=*D$8E&>*=, 1T$۬T$=,T$蓱T$`L|$Ht=:,u =,+H<$šH=ƸD$h-,D$,H=1ɾe+X- -)L|$H,D$hH<$-,I,@H=DdDl$D$8A$,)H8Q=$,D$SPAb=,9lL|$HL|$HAPL|$HF -<ff.UH SHH,~H=THOHH=%1>I1HJH߉H=D>,t",u',u2H[]Dc,tً=,n,t菪H[]fDAVAUATUSHH,OtHCHAA1AAAcN,H{ŋ),',,,tz,H{;,Aƅt X,uEt EEuEuw,Y=,^,N{DfDk,`,[-,]A\A]A^f=B,,t ,,t,AWIAVE1AUAATAUSH8,_t$LD$ tt E1A/D$,؃ t T$AG,,-D$ϦDT$ -EtD 9,E>D$)7tx5H|$ t H|$ MDD¤H=;6,f.A wH੯t AEtDm-EIHt#uIdIGA? L|$1҃RAGtHt$F FAG(ttH|$GGttHt$ HL$1H=L-AD$(AAmL-D$ uS|$ tg|$ j-t$(tۋL$u>H8[]A\A]A^A_@1H=?-K|$ uL$ -t1Ȃt- ~D-xDHt$FFAG-PDV7,,v,O(,@AGD$PB,<,D\$1E)-DD!t -\$ -@fDHT$B:B/B@BHB@DIGH@L9HD$AG¨@fDIGH@L9HD$AG¨pZ@IA… ҉L-EfLD$ t$H|$5,,޴,,ƴ,,諡IH_}f-IH:b@HE14A_A1|$,@uHDAWAAVAAUATUHSH81,HL$dH%(H$(1t)L%1,H51Y?HL1ʖHHH1,Ld$ Hq1,H$Hj1,Hf1,EH@1,F,D$跌H|$IEH|$ELBL{HHBHL1;L>Hx5LHj<HAą|$i@|$`@HEDHx@|$Hʼnx D$E1=}1 =H肪1H޿:DD(裦1"u,u5lD$H$(dH3 %(uH8[]A\A]A^A_Dp|$?|$?H1ҿ]:L$T$HLD$cH=,5BH=,)BF=ff.fAWAAVAUATUSHHX,Ht$ HL$HDD$tH|$t"\,uD|$8EBtH|$(t,Ab|C(% ,fDHi,,HM0 H85HtHXHC,H<$HHھL=HcL|$HHLHe70H $DT$8HD$0LpL`Lx Lh(HHhEuHt$0H=ՙ1NHD$ H84D i,E|HD$DD$8@,,E=3,+~ _,1H=~,,I,(CH-,c,9,AH-,H=$,Ht ,9H,u HD$@HL$8H=-,H=,HX[]A\A]A^A_H=4HU,H;1SdL1H=7H= e11H=,聋H==,pH=,_H=/,NH=B,=Ht$H=1蚉H=,H=9,H=,fH@H$YLpnH@HD$fD\$8EuFL|$(L8Hx LHH5H=K H1H=*oH1CpBE1xHD$CwC6xH?-HD$(D1Q*H|$0֖,dfD",9t5W,Ått,`f.LD$HH|$1H-,,H-,)uH-,, HD$ H83c|$8HD$@,,|$<1(itfDH|$V6Hx Ht$HI3H= L1,H=EmL1fDH=Yc11HH5d15HH16,rfAWAVIAUIATEUDS1H(H;=#,H|$D|$`HT$F,HD$H;",Щ,HD$H;~",Et ,D!t ,\&'7iH|$ht H|$hD苕LH|$1H=>->=-,D$|$H|$T$pHt$[H=,-9Za5?,,,A ÃHD$H;}!,tMD$tvg1LH=r-EtXHEL$,HxHOt$ ID D2HEL$,IDt$ HxHEL$,IDt$ Hxt$ ID1ff.%,EtMH=:u ,D$ u%,u{|$utE~o1N5ADžRHM H=a,D1L$t$ HMDDE11*f.EyL$t$ DHME11La,,,EtUDt$E2D95$,1|$9=$,H ,HcH<; H=_~H$8dH3 %(HH[]A\A]A^A_@t$ ID1f.諒AfD=,e#,4DHA,IcH<&L-d,D%),L.HxLH!,DDHA*D1w9, fH51-H1螇i1L*c,趑DdDH=*1~11eH=D$1~HtfM M1H衿1DA-D7/H=,D1Q~MD11]?M11a-AWAVAUATUSHHXH|$H$t$8H$T$غQH$ )HckdHD$p)Ӎ1D$x8fDcE9[AEAIcMAL$Ml$%uAMtMe%PAо< 1ҀluAL$IREULSkDD$`HL$XHD,E9HcHIcLMl$&AL$OLH\$PLH 1H|1Hd-L|%HD$D$LH@HxHx=,D$LfDDLD)E|@IcILD$@L$<1T$8H|$7D$HfDH=>"IH8}D$4aH$HdH3%(D$HAHX[]A\A]A^A_fDH\$,KD$L$0D$Hs,HDŽ$@HDŽ$ HDŽ$0HDŽ$HDŽ$HHDŽ$(HDŽ$8HDŽ$H$HDŽ$D$Ltf.SD9}0A Hc8@qиMeAMO_@L$D)F|8@IciAM$IDD$xHL$p1H'}D,E9VDLD)E|@IcI5fDD$dHL$hH|f .,tT$LL-~L-rDD$|H$H|fDH1H5Z$n%$H1{LT"%t$4H=/-+1LHHȹ@HHDx@A)Icf.@HH1G)fG(%f.W(Ѓt1W(1с  t f5ʮ,9w,uЃff.@W(1  t,9G,G(%f.V,G,fHH8HH0)u&ff.@H?H6)u &ff.@UHcSH}HcHH HkHHCHHH[]ff.UH0SHHHR#HxHH HCHHHCHCHC HC(H[]fUHSHHH=,HtH;=,tH"Hx5HHj H,HH[]fATUH-b,SHHt9H"HxHHI H{Ht,LcH[]A\ÿIff.S1H dH%(HD$1H1#H$H3D$H r,HH1H*,HD$dH3%(uH ["ff.@AVAUIATUSHHtgH,HtH u[L]IEA\A]A^Ëx87HH,P~fE1@HJHtI@LsLD!HxLHHHHCHHP HHuH;,ID9`[ImL]A\A]A^ÐSHH耢H[SHH[ff.AVAUIATUSHHtWH8,HtH u[L]IEA\A]A^Ëx(6HH,P~eE1@HJHtH@LsL4 HxLHHHHCHHHHuH,ID9`[ImL]A\A]A^fSH#H[ff.«,ATIUHSHt/H8 Hu#LH113[H]A\H8[1]A\ÐSHHHH[ATUSH1^HH蓶H{IWHqLcH[]A\USHHH=,tIH{HtH-,HHx3HHhHCHH[]f.,u=,[dfUSHHHcfH{HHt%HkHH[]USHHHc&H{HHtHkH؃K(H[]USHHHc=,H{HHtHkHH[]SHHdH%(HD$1Ht>Hu'1,,HHT$dH3%(uH[Ht͋$f.SHHdH%(HD$1Ht>Hu'1,HHT$dH3%(uH[fDHxt͋$*f.USHHNHcH{HHtHkHH[]SHHH5, u H,13 Hd,H[USH1H H+=,H,H6H{HHtHkH؃K(H[].CtH=<H$=@;ff.',tÐ |ff.ATUHSHdH%(HD$1H=ɥ,tHL$dH3 %(HuVH[]A\H|$n,T$LeH,~1Hy,HHLH趮9\$9fS HH1"K,H ,*,uH[f,H[AUATUSHHt^IG)tXHHtL?tGII$1H2Ht/H@Hܤ,Ht@)tAt$HxHt?IuE1HL[]A\A]fHL-,[L]A\A]I@u"@u@u'HtDmAWAVAUATUSH8GH|$(HT$HD$ IHD$(HT$ H|$HD$LHt"A~AtA~A@EtkI|)LL$dHt$HIHBASH_FUNIEC_MU fAELE%%LL$HfUHE=A>uBEDI|)LL$Ht$HIHLLL$E=A>tH}IQLHD$McJHHD$H([]A\A]A^A_ÐIw11cILIHD$fH%,HtHCH,HHtSATUSHHtBHoL% H1LC(tHP HbH]Hu[]A\HWHt;St\,Ht1Hu=HSH5 1[=DHu1[fDH1H5 C(tH, [AHH51ZH߾ [f1[ff.@Ht>SHH?Ht0HDHH{HtG)uHH{Hu[G(tqff.@Hc,t9ۜ,D$ H ,5Ȝ,HyAfHu3BNBN^^EºB HEH S,HfDHHHHiHiH)HiɧAHщ%9tfDD$ 9,cff.USHHHc,H{HHtOHkH؃K(H[]ff.fHtEATIUSHDHk 1LH)HtH@H-,Hu H[Hu1[]A\1ff.@ATIUSu|-thH&,HtLHk 1LH)Ht*H@H-7,Ht@)uHPHt[H]A\fH[Hu1[]A\Ë,tH,Ht1HL(HlH@Hњ,HuWHLHufDHATUHSG)HHtg?tbIf.HxHtE?It=-1u1S- ,@H9tL9tHt @)tu1[]A\H]1H5AHH1fH1f.H>Ht@)u HfDHHff.H1Ht@)uHÐHH@HH5!,lHt/@)uHPHt"HHHHu1HÐHH5ј,HtHPHtHHDHff.ATAUSHtKP(HtBHxHtA?t<HxHt/?Ht'rHtP(tu1H[]A\HEtHŀuHH5 ,\Ht/@)uHPHt"HHHpHu1HÐH*-1H,u1- ',@JHt@)uHf.HH@SH=wHtHxtP(рDщP([ff.HH=aLHH鐏HdH%(HD$1#HtHxH u&<,HD$dH3%(uHH$, HHtHfHgQHHtt,HH\ff.@HSHt=+,u",#HO,Hf.Sa, Ht/HXHt&H,;u/ [+fD",[Hx tź 1HeH1Ht 1Hx@lj=,P,u H#=~,OH ff.AUATIUSHdH%(HD$1HtHhHHt}u+~CHD$dH3%(H[]A\A]H H IH$H9t8t/H[H5נ1 HLH1p`fDD tH5 DHtHDAZH[H5\ ATIUS0HHXH+@t}}@HDPtGS.tvDHt4{u.@ҍDBЍP w[] ,A\DH5 1HLH1u_,,[]A\fsDp{{q@@΍DA{ff.@Hj-H*,u1. - d,@ƃHt@)u H@HHD@-1u1 - ,@)fATUSHtjP(ItbHxHta?t\@HxHtO?ItG-1u1[ - ,@HtP(tuE1L[]A\L@tIĀufATAUHSHAHt'Ht@(%=tKC)uH[]A\DHtC)tH{uH{Hg H,HHDR뻺H51HH10^c(UHSHHHt@(%=tJC)u HH[]fH{uH{H H|,HHDfDH5\1HH1]c(ff.@SHT,1HZHt H,H@[SH,1H*Ht HV,H@[Ht7W(HGu@uDH5 H1H֛fD1ff.fHH=HtHHt8u1Hzf.HǺ 1aDžxփu@HHtHH2f1Hf6y,t x,tHH=:HH$@USHHdH%(HD$1nHt8u${StnHD$dH3%(H[]HHtH,$Cx- -jfHD$dH3%(u7H[]A\A]A^A_Ð HL€& -@H3Ht.s,tPt@s,ty,Hs,!zs,^_,#HfDHH=ƕHt8u W,Hf 1H‰9,H@SH;LHHu{At"ruu,t ,[rfH31Ht8uHfDHǺ 1YH~ff.AVAUATUHSHHdH%(HD$1G(uJHHt$|HNjD$LHHL$dH3 %(H(H[]A\A]A^fLd$HLO|L$HŅLH5|T$H|ftk>HHxxHHIE(u 1ƒL1hLH2H>mHHxHHH6IHE18At)A}A}LCLcMf@H/;t{XMfLLIHK<4HD+IHE18t*A|$.A|$SLLcIm1;t!{t{t HH<(LHHJ|-H IAHE1L%c d@1kLhLHIDAE1L-" {uKMffAAgAAA?HoIKAm``AVAUATIUSW(HЀG(HG H@u^1HH{Ht HC7,C(t C(+H[]A\A]A^@uH[]A\A]A^É1HHHHS I9tHtHRzDAՉxIĉ0tSuH{HtLc<1L^uLEtK(1SH;1Lt !,L3t 1H5PLH1Sj1H5LH1 RLrEu1fDAUATIUHSHWHHxHHt -HCH{HtNHtZHGHCS( },ЃC(tЃ €S(t N+H=+躮HH[]A\A]@HCfDLH,Hx0LHeH޺H%LI*HIE9ff.AUATIUHSHwHt"HHOHHH[]A\A]JfLmHEH,KLmLH-V,HHx}LHHHrHXH[]A\A]HtWSw(Ht8H{HtH;C(t +H[ifHDff.@f.SH5,1HtAHH=.+H{Ht G(uEH{H1[ÃQ+ݸ[SH5,,1mHt&HxHHtNH{H1[ø[ff.HtsUHSHHfH[HtGHs 1HHtHxHXHD$2HD$H%HmH1[]@H[]øff.SH\,Ht$9,fC t9StH[Hu[fH{ HtuHC [fH5IH{ HC ֐H5%AUATUSHHtmIHH1fHC Htx H[Hut3IH} LLHmHuLI$HH[]A\A]fDH1H[]A\A]USHH/,Ht5H{ 1ۅt)HH=,HHHqHH]HH[]ff.SHSHߺ[HcH `ff.SH5,HHtHH[ff.1S1$HHtHtH[ff.@SH=HHtH?H[f.H=PH=@H=0ATUSH,Ht",fDS t9Ct3H[HuH5ƌ11%H1KH[]A\Hk Ht} 1ttdH{ H5IHI,$LHtHUH[]A\ff.fH=`AWAVAUATE1UHSH(Ht ?H=.IH/HHD$H1HI<uM~1IHD$IcHD$HD$HunAE8EIIWHtIL*EuLIHxxLHCH׉D$HL$IWHHc\$HuHD$HHLHD$H([]A\A]A^A_HT$LH0fvAAkAHD$SHl},Ht1H HtH},H@[1[ff.H=-},Ht0HH5PH=},H},H@ff.@AWAVAUATIUSH(t$1HcA|(5G},t$H |,L9A,$Dn1HHD$DHCI9LzIU I~1DD$Ht$aMff.SH=tH dH%(HD$1Ht 8HD$1Éj,. ZcغQD$)B0kdD$)HHcHH\$HHB0D$HHH)Ã0\$@1Ht$H=sEC+H(HD$dH3%(H [DHt$HKD$Éi,i,0\$D${غgfffD$)B0D$)Ã0\$FfDH5\w1޻1H16Bi,c0zff.UH=WNSHzHH=hHXaHt@)tHhHt }/CHtS,}H=rHHt'1HH=;h+H(HBH=hHtHxHt u11H=gH(H[]ÐR,u11H5wHOZH?1HH=g.,+H(iH=gLH@) HhH}/11H5RwHu+fD11H50wHDH蓷HHt HH=,qHf.SH dH%(HD$1Ht$ HcПH=pHaHt`(1HH=pH(HD$dH3%(uH [UHc SH(dH%(HD$1Hl$ HO1H=vpHHc H.1H=nH}HD$dH3%(uH([]aATUHSH1t_11HE1ȖHtP(AԃP(AH1HƔHHtC(ƒEE‰€S(ucH[]A\HAHtP(AԉуAH(uH1HHH11H詁H@H5s1 HH12H[]A\SE1HH H dH%(HD$1HHHHL$dH3 %(uH [fDSH3HtP(P([1H5 Hf,uHP(P(ƐH(H=d,AtHd,1HP H(DHt$H|$T$DD$Ht$H|$ff.H=d,ATUSHt H=d,H5d,1HHtHJ Htq HRHuHd,Htp Hc,HIp 95`d,Td,H11HHc,HC Hc,HCHH=}HHt H(HI MtL`H;qc,tH%e,teS+[]A\fD5c,Hc,c,Hb,Hc,HL,HHX1f.H=HHtHtHHYHkH[]+A\f;5c,Tc,Hff.n+t DS1HtX(u[.+[ff.fHuHf.HGSHH?Ht[H{ HtH5 H{ H[4@SHHoHX Ht&S t1H5HHD$iHD$H Haa,HZa,HPHBH[@SHBF=,t A>S11LLIHSL3AE(H +ƒEAE(E=AE(&IMwM'"H5ۊ,H=q H5]H=t ,H53H=xrD5G=,E D +E1H5g]H=U1H5/H=9\HlKH5:]H=:]YH51H=0]FH5~1H=$]3H5<,H=] D<,Et,D a<,H\H5w\H=\EHDH(.1H54rH=zZ41H()1H5rH=[=5<,S+H-;,E-% .,H-D,E HU HsH;E11HŋC(Dt&H}Ht9C(H{uIHEHD,H;D,H HtC( E(HH[]@H;xHH[]*f.HeHE H*D,HP GfH= €H{xf1HEHC,H;C,Dc(<DSG(HH?00tH[d@%Hs1E1C(HpC,HP H hC,H9 YC,tHtS( P(H[c(ff.@HH={NLHt?D,tH=LH齶DH=NH=zLH霶@뺐AWAAVAUATIH=SNUSH(dH%(HD$1̪H{@(HhHED9hH]ME1H[AIH{軴Ic~zHCD9mE9~KMcAE)I^Ll$ IHKc< LzLHIHBKI9uDHD$dH3%(H([]A\A]A^A_DE~Ew1Ll$ fDHIc< LzHHHJHCI9uHHIc<${1Ll$ @ LyHHHHJIcHfD[fD=+H=+UDATUH(S/LeHËEECECMtI<$yAT$IĉPHELcHtHHCHE HtHHC H[]A\SHH? SP[ATE1USHHtMDHkH}ULHljP*HIHuHtH8t[H]1A\fDE1L[]A\DATUSH0oHoKHoS P CuiKwXH/|u3tBLc(MtLZHxLHILe(H[ H;SPHE H[]A\ÐLcI<$AT$PHEyfHtWU1SHH f.HHH(HHuHtHH1[]DH[]f1ff.fAVAUATUSHt_H oHoKHCH{ECEHt EHE;wHLHcH>f1[H]A\A]A^fH{'HEH[]A\A]A^LcRMl$HLҲHx9LHnI|$HC HCA$H]LcI|$HHCA$H]TfH[҆IƋLcACI<$AF&AT$H[PIFHE1 M 胆H{IH{ID$iID$CM,$HAD$HuMt L1IMfLuLc"HA$I|$I|$HCHCH]f@Lc HA$I|$I|$HCHCID$HtHHCH]fDLc芅HA$I|$HCID$HtHHCAD$CH]@Lc(:HA$I|$AD$CI|$HCqI|$HCcI|$ HCHC H]ZLc҄I|$HHCH]*Lc袄HA$I|$HCAD$CH]f.H{'HEfD NIHCPHxAT$6ID$HCHx$ID$LefDH{HEpE1fDATUHSLgHI<$EAT$PHCHEHtHHCEEHmCHtH(Hx菃HHĬHHkH[]A\DSH ^H[HbfATUH S?LeHËEI<$ECAT$H}PHCoH}HCHCH[]A\fDH",t.H=",Ht?u HHÐ[HtHÐH=贠Ht'@(t!HxHt1iDHt 8uHo,HtHUSHcHŅt 6",t*H=!,HH1[HMG]o#A~ʋ^8,L t+H=!,HH1[HGG](H5F1DL$ DL$ Iff.SHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1=+1nHHھH$H= ,$HD$HD$ D$0HD$賩H5| , 蒮N,u:H5E1H=N ,H1H=8 ,ӰnHHt.1H5EΫH= ,HپH1襴HtEf.SHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1cHHھH$H=I,$HD$HD$ D$0HD$VH5, 5C7,uHD$dH3%(u'H[Ã=Sl,u Gl,=Al,ff.@SH8輳HH=j [H1SHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$11HHھH$H=,$HD$HD$ D$0HD$ H5, ff.SHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$13HHھH$H=,$HD$HD$ D$0HD$&H5, HD$dH3%(u H[SHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1C1H5AH=),H1ʰHHھH$H=,$HD$HD$ D$0HD$ H5, HD$dH3%(u H[ާff.SHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1#1H5@ЦH= ,H1誯HHھH$H=,$HD$HD$ D$0HD$H5, ̨HD$dH3%(u H[辦ff.UHSHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1W1HHH$H=,$HD$HD$ D$0HD$ʮH=,H H1MHD$dH3%(u H[]讥ff.AVAUAATIUSHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1cH[=9,HŅJ5$,D5/,L EHH=,H1AUH\>I?ZYH$H=~,HLHD$HD$ $D$0HD$耡H5I, _m0,HD$dH3%(H[]A\A]A^D88HH袦%L% EtvH=,EH1H=n,fH5 =1]IDH=,Hپ1H<#fDH5<1Iod,Yd@UպSHHMH*^+1HcH4輢HH=<H1fDH5<HcH]+H41vfDSH5_+H1UHH=b [H1SH5c<H1%H[H1wSH5H<H1H[H1G!]w(Hm<HcH>f.1ff.fUSH,,H-,,X,,~NHcDHDHx(Ht eHDHxHt RHDHECH<,,1HcH|%-,H[]@AVAUIATL%b,USH-,< t< u@H< t< tH-,,HtX}HD HDL5:MtFH5=1蟠LIMHHL1H=+,H- L% MSHgHt @(@u H[H=T+,迦ff.@AUE1ATIUSHH H(dH%(HD$1H訳11HI XHHHxetMIH ;HHH1LH4H茜H脜HD$dH3%(u H([]A\A]ԟ@AWAVAUATUSHXdH%(HD$H1HS+,H4Sv/ t*LxI0XSv sLIIuAL-*,L-*,HQ+_EeLMfD1A[AHa+H=r*,Ht H9HL苞HxrLHH$HU*,E'D5;*,D%*,H*,HD$H%*,D-*,L=*,HD$H),),HD$HŒ+),HD$8H+HD$0H+HD$(H+HD$ M5),HD$D5),D-),H),HD$Hp),H),HD$D%M),HN),HD$8H2+HD$0H.+HD$(H*+HD$ H&+AE= H(,D5 ),),L= ), Iŋ(,L-(,(,(,HD$HdH3%(HX[]A\A]A^A_II_CIAu<_tH=(,HtHD$D5{(,D-p(,H}(,HD$HQ(,Hb(,HD$D%.(,H/(,HD$8H+HD$0H+HD$(H +HD$ H+E]H襎IMt AD$)q 7(,c]1h],Hx:,<,rf_s@ /H LDy#<c^FL^E1Ee A0REE17AlHAJuA_t A@AT$Ѐ vAT$ AT$9[HcIL, IEgEA#uEIUH>tDAE1HHN+HS+HT+H=+PAEMe<=€=)&,M- &,&,11HUIfHHVHQjfAT$w%DLA)ẢA@A_ADLxHD$@]NLƓ1Ht 8HD$@H+H+L%+H+H%,D5%,1E1 %,L-$,M߈^$,$,11LHA<]uL<L-$,]E'%>>??!u Z>@Ƅt@A<@DŽt@(<<@A}= $$, Me fDHL$@11HVVM8EeED߀XtcIAE1HHSH11O+Y,HH8HHgM}EeA<>u-@t(A}=  &#, Me &u <&|u <|*u <*SՀu8<=us ",t'u+Hਫ਼1H53xH`1H52]HEH=S+9MH=2CHc-$", 1H562H1H5 2HH= ,c>=!,Lu=x@v< uHHAЄuDQu:<_t6M\1<-@ŃL1H52`HH1-@Ń SHË9!,t4Zf.!,H ؋ !,ۃu(HtӃ ,- ,f?t H[fDHtkV ,:= ,:Hk , ,tm/-P ,b , H[f1 ,F ,t3:t.0- ,=* ,:u4 ,t H1H5]0H1H5N1ٓHAVAUATUS,HŃ=t t[H]A\A]A^@=,2L%,L贓Hx hLHIDL5U+HHxVIċ',uILLLH+H ,HtH9t3LLHuYH,[H]A\A]A^HLH+H+H+H+襏L蝏H蕏,%gLHIWL5h+ /%t H*~Z/?+u"Hf.LL-H)^u3H1 ?~5%L&H!s|qH _ Yr,_*)~?/+tw-M@^tk| ~%tX&JD Hf.fDfDHH`/HEHaHS@H?HH9uHu1/@H?1H5-NH6L>1H5,+H1H5,HH'=,,ufD=,,tHSHF;Pv< u)H@HJv tދ,H,k,9XcHr,fo*+Hfo /+HP=,@8-,HHPH3,HPH ,HPH,HP H,HP(,P0Hc,J ,H ,HHxdcHH虌,H,H,HH+Ht+,Ho,H\,HA+HF+LHËK,H=,,Ht*H=C,Ht,H ,,HcH}H9@@,,Cv , ,[Ã-um@ ,u , ,tDq[D+Q ,B+62,D-+H=R+uHY ,@HHc?,Hc>,H|PTbE11HW;+L  ,AarL AHE H48EtADIcH48uҋ l>,t AcIcHƋ>,t sApHcHHff.HSH :+bH5v ,@H1yH6@tHcH@u0HfHt/Hh:+bH$ , fHHH7H2u , , , , , , ,t ,n ,h ,N ,H ," ,$ , , ,J ,< , , ,r+r+ ,r+r+ ,H %9+1baLSr+ 9HA4HuWH-r+HcoWHcHc;8ÐH ,HcHH׋wt4HcGtLcIBDHcGtH HHGfH3?, ff.6r+LS ,E1SXDK Hu IBI9tWIK DHtLALH I9t9yuDIuAuy uHtH [DAu[øSHHdH%(HD$1HtH,HteH$HHH9tH9xuHu,ux uH\$dH3%(H[fDufH$H,Ht;H$HHH9t9xuHuDux tHH9uH$H}Htt#H,HHH@[uN1GR{fAUAATUSHdH%(H$1HL$H}H[L}HL1fwx+H>,HcHHtD9ht Hy1L#wH$dH3 %(uH[]A\A]zff.Hco+9o+=o+H,t9tHHtxtVHcHH‹@t[t=Oo+tWo+HfDBo+@o+HHc%o+w@~uHco+H,HH׋@yff.=n+t&n+tH ,HcHHtztrfn+tH ,HcHHtztLHtHfD=Nn+uHHn+HyfH=I,Ht J,u fHWuH,H,,HfH5m+,S9| =,9gt~H9~tۅ~9|Kv=O9=,9 ,1x,[Pn,DH :,H@fHH9u?,xU@QHcH=,H-L ,H,9~4HcHHLHHHHBHH9u,=,,AUAATAUAH-79,SH{B9DtTH5m,HcHHDjJcLfZ BV,tHDBDHH[]A\A]fDHHH,@DH,Ht|,,H8, tIHcHHH;xt909uNfDHcHH9xt9t3ƃu1HD1ÉΉ-u,H1H=_1Hff.@HH=3ppHt HfDH,Ht r,u߾H=~,vHr,HH'HEHff.@USH=,H,HtH-sH9\,uRH5sj+H4IB6,H9tHLj+,sH[]Cx,H[]H5 j+HH5,H9tkH-rH,Hi+b,H9u H,u?sw3,ffDHi,Ht H;Ea+tl,,,,{,H5!i+HG4,H9襳9H;a+"5 , y, ~,H=~,,[y=,*@Dff.UHcSHHH+HLHMM9LfHJL9uZ9,L,|qLȹ {ADHM9t.LMx Ή<~փADHM9uHcLAH[]醹fDHcLHF,IH,Hr+HLHMYf.6fDHA+HcHHH+Hʅt HHH9uB f1fDr HEH9uUSHdH%(H$1HH$HAtHzH,tHH1mef+~SH+p af+1HBH4 fHHHtBHH9u@t f+1H޿CmH$dH3%(u H[]pSvHt[ÐH5M1pAٹ@I@H= ,1lH ,[ÐAWHcAVAUATUSHHHD$(HD$ HHD$QAD$(9Re+A+t9He+A- DED$(HHߍH1XxH)+HL$ HLxML fDHHI9uEHT$HgLHWHEHD$8D$(D$,H9l$D$EuyH޿ E1GqD$(E1H}HtH'pEE<|$1HmI9tHT$81H}wH9l$D$EtHcMH1HTwH޿ pE&|$,H51I-nHL$Ha+H+H@t AE <ǃW(8H5 ,ĺH5 +Aƅ5 +H51mEHI@H=E ,1njH+I9fDEAHDl$uDH515mHL$Hi+H+H@Ll$H5U1lHH'+1f{HL$IH+HxL(LLot3L$vH581IlLHH1iu +t+H޿ nH9l$H!qH+H\$ H؃HHH[]A\A]A^A_fD@PHٺH= tH+HL$H"HٺH=w tnf{H+HI9@EAGA9EHAHHHT$0lHT$0:tzL` H H1'tAE Dl$<t=trf.I9/E&HٺAH=msf.Dl$DDl$zMH׉L$0jL$0)…E,=+H5 1_jH+HDl$I9kELl$AH@Dl$AD"l$,fHH>+HfAG A9E QA~fH+Ht$ HD`ADH5 1iHH+fDHD$@ <H5),H5+ZH5 1IDiH=}+MIH@1fHX+H5| Z@1H5\ h?H=,HfE,H,AI99AEDH5* 1hHH1sqDl$hHL$ HH)+Hg HH@HcHHH1[]A\A]A^A_$q@t9Wt 1HH+1Hff.@H+HcHHtHAVAUATAUSHdH%(H$1HL$HjHIqLjLH1Td ]+~91H!+Hf.ACHE+1DIMBf.-+D{H5m1H$^H $AH=+H¾1gH+DHD+J,0DE?1H5\^H=+H16gU^ff.fofo fofoH)~S+) S+)S+)S+HS+Ð~+ÐH^2HH@Hf.ATAUSHdH%(H$1HH$H`HgH`HH1&Z1H+HH3+H,+HPEt H++1H޿+YH$dH3%(u H[]A\A]bR+t DAUIATU1SHHf.H{L#HtYH߃LqYM9uH[]A\A]ff.@USHdH%(H$1HH$Hm_HeHX_H1HX1H޿H-+H+XHtHH$dH3%(u H[]\ff.HH=H+t9H=P+8+cbP+u H@H=P+t]u1H5/<[HH1ff.+tÐ+aUSHdH%(H$1HH$H^HdH^H1HW1H޿H-:+H/+jWHtHH$dH3%(u H[]Zff.ATAUSHdH%(H$1HH$Hh]HcHS]HH1VH=+H-+HH+HGH+V+1H޿d+VEtHu)H$dH3 %(HuH[]A\H1Yff.@AUAATLcULSHH+Jt,WHAJH9N+wH9N+zH;UH{9)sN+{u5cN+-|N+)ƉH‰JN+H{ Ht HU-IN+tgHcff.HyjHWH>u谒u|1 u舒ul1u`u1H̷@H鵷D衷|@艷B+uzH+u4躈谈覈+H1t1h1\+HDHE+t-H5+oWx@+u)1Hf.H=y+4TtD111iʸ@ATUSnE+t%Hv+*Wx&1[]A\DH=+SÃtN+tD%+NH=HcD1Off.f++ƒ fƒNAVAUATUSH dH%(H$1|AQRAH$dH34%(DH []A\A]A^ALt$L$LQL6XLQLL1AKHT$ 1SIƋD$ H+Hcȋ5C+H ʃayEuS9uSHY{t{ u){QCu tvtqHD$ H+HcH H9Yu4@9tdRAMtH~+HcT$ HЋBtUD1LqJ@E1{SQ}fDORAf.tHtCuuHJHDx u@HH9uBBBczQH+HcT$ HЋBLMff.AUATAUSHH`S,HLHxG!HHHyJH=轛H=),<H=$ ,+H=A+H=R+ H==+H=+H=s+֞H=+ŞH=Q+贞H=m!H1H=H1H+Ht+H +O,R+E~G1L-f.HKHx HHAILH葄A9uH=p0O,H[]A\A]ff.AWAVAUATAUSH8dH%(HD$(1Ht$$ +D$D$L|$ D$Ht$f.@+tH ,1ۅu ?+u@t+V,t-P,t#H+HtH;7+ f.AvL'QD5d+Aŋk?+EE~tAD55+E+jDU,Et.D O,Et"H{+HtH;W7+jfET$ 5+Ѓt~у+~Ѓ{t D$->+HT$D5HHuxHHdD;kut$ DBD$ 1=C ‰S|$$u>+Y>+L+LcE1E1D=+1AK4FHND$HˉF @HH9t/1{ ‹C <uEt ăEDHAH9uх1Fu!E)FD$FXL$9uED$?+C@:l$t|$"=+tD\$E >+t#L+tH=t+t@=+t[Ht$(dH34%(D$4H8[]A\A]A^A_@EfRE]D MD\$E=D$DD8uD+Etl+=.+@E1f؃ +yH51FH1Tf.=+U=+ECaE Bf|$$fa+eED$FFE+}+@:+v+|$ft$ DD$ t <+;+sfDHF(F ;+HtH~0L+K4~HF(u* +t ++ugtgFu2fDHcD$$HI49:+l$ JD53+L+Et+uK@u+t{ < ,j+[+P+u[H :+HH9tHH;2+H 菪Hn+H9+HHtHcT$$H+HH4?HnJ,u H;1+HD+EtiHJ+H;+1+uYHtT+|$wD +xI,EDXO,EH=cO,IfD=f+uJ脄u,+D9,+f &-+|+};h1= +@Hc-+1H5o&7IcHH1֐9|7ff.AWAVAUATAUSHdH%(H$1HL$H:Hu@L9LH13 ++++.D5++l+VB,t\<,1DAV11D"HHxCH+HcHƒx+y+t)#++u+++A,t(D=;,EtH=+H;#+u HXA},H+LcN<N EQAH5*+L% L9t>芛L%*+i+H+LcN<N EQAUƒN‰m+AOHtE <BH`+N<N AAq ++c+EN<NH5Y诚+H)+HO+D5+Q)+++{qu11(fD++-++Aǃ18 H32H9+SHtHE (+t#H +HcHƒ(+@(+A2H5(+L%L9=+śF11DD}f.軖fD=+u111%LHV+J 8y 1LL/H$dH3 %(DH[]A\A]A^A_H+HH;+H=7>,8f+D+EH+J 8HQHfDAt!HH9D` D@@~DM+E9F'+tHU+J 8At111KH9+J 8D &+EA@AAqu&D+E= ++ ~ = +iqt =+H5+ 3H=+5H+J 81=+}LH5a&+L%"L9tL%D&++M ȃ<訽A1+Ń耀DD++=%+1S+LcDV+6=D+C>p11L,1Hl%+H.i3HJ+J 8f=r+5mE D=$+1HAt1L,H51/IcH1蕅H5$+H9[H$+:+i6ȃD]Hq+J8@5=+xA+jH+E1+@H+J 8EH̺+J 8 ++H+J 8R=H+L%#++J 8".AVAUATUSHdH%(H$1IL$L0L7L01LL!*1161LI*MLAY0L6LD01LL)11fD=+荒#*AVAULcATMUSHdH%(H$1HH$H,H$3H,1HH/&H+JxDB1H޿Dp%DHA\,H2HG,1HH%AtH+JHtxtn1H޿%DH$dH3 %(uOH[]A\A]A^f1H5}(AuH10f.H(DAUATUSHD 8+dH%(H$1EHH$HY+H1HD+HH1$}+pH +1HPH9HHAHtzuBuD8ŋ,+t%GD+Et=u+u 1D"1H޿3$H$dH3%(@H[]A\A]@1H޿A#H[*H0HF*1HH#=+IOH5+HfDHH9!HTHtzuBu1H޿i#+;+Fo+K5Y2,t% _,,tH+H;+u H=f#DIHY)H/HD)HH1"}+~7pH +1 HHAHt zHPH9u1H޿w"191H޿T"A} L+>*4D=B+C+"$+=+ٍe%H= 1,t+@AWAAVAUATUSH8|$ H\$ t$HdH%(H$(1'HS.H$IHHD$'LH1N!H/+McJ@D$|$J,uyDL$EuoH51H+$T$ HH1zHt$1ҿ1 H$(dH34%(H8[]A\A]A^A_cDD$HD$Hz+J`Euu+LxH u+D$ 96+H Qt9++H yHHEȋD$ H5P1)H +JH@)f.|$ H+JLxHLL-H L%2@IWI9HLIEͿHHD14)H+M?H(HBL9uŋ|$HH|$H% |$thHI+J HQHfDx u@HH9ut$AxAyA'DD$uhHٮ+J`Hx+H5sH1B(DDH5n1%(H+JD+HT+fo5+fo=$+H+?+)5+fo5++H3+)=t+J)5y+@|$ VHt$1ҿX+fo#+fo ++HB+fo*+)+H+.+) +)++KHt+H+fo5+fo%=+H֭+X+fo-8+)+í+J)%+)-+@t#x1|$H%+JHx+%H+H51 HH1vHt$1ҿ_ ff.@USH&1+ N+H=+MD++E# +5+=+#+9++T;++`+=~+M#Ãt 9h+t(H5ڿ1H1x +"\+#5++1Ɖ+&=+5+z%=+z+`+9H=[++ "=p+9t1H5N=+m-蕜S+uKH=3+x+H[]@KH+H+ H[]f.f++G!lj+z!++f1%M+=g+;=Y+9=Q+1  +H5J1H1=s + +x@11H] H޿(+fDH=C1#+f5+1HË($s+u++m+H5̼1H1u=+?+H5v1H1uuk$H=+ H+SH5+H5+ׁH5x+ƁH5O赁=+1HF+qL[fAWAVAUIATAUSH8dH%(H$(1Hl$ H$H-H$HHH1H= +!E+1-+u(+5+tJH ;+HcH|BHDHH<ulAƅuD5ώ+EE1\D5+AAA9};H ݦ+IcH<SAFHHH|8A9Dj+Et Df+Et@A9@ 0A9H=W+8*IH8+HH9u fDHHH9uHHHt H1i~HIGH DHHHu+D h+HHʥ+AWĥ+AGEtAGH111z@ 1z H@ H9uu ɃAOH=HHH$Hx#H4$HWHIH2+IcAMo IG(IG0LHH+AEtt$56 +t$ 5 +ADOA4$D + + +5+9~44$LcJAA)LLHLfDHHH9uH9tH$ H$Hǟ+AD5+AD5+D=+Atj+D9|D9}苙Ht$1ҿD5C+9+EuHY+H8AH?+$H$6AuD5+AtD=+A{ffD88D-v+A1EhATUSHdH%(H$1HL$H HlLLH1w-+H.+~T1xt"H9+~6H+HHtu؋B+uԾHз9+ʅtD1L H$dH3%(uKH[]A\fDugDH=+ He+Hb+9"fATUSHdH%(H$1IH$LL,HHL17 +~F1fxt"H9+~'H+HHtu#H9+1H޿ H$dH3%(u H[]A\D@USHdH%(H$1HH$HHPHHH1[ +~qH2+H1HBH HHHt zHH9u1H H$dH34%(uH[]f.1g+ܬ+ff.¬+Ð+S+=+t49+B+9tu [fD6+[f=+=++H+虲H=+161H[ff.+ H+u5X+xD1}DH迸=9+yHþ5 +x1HAff.@=+u1f.Hw1Hff.Hc+SHc߅x9|HNH+[ÐHcЅyZ+ ƉM+ff.H5[sff.H=-+++Gt H+ff.+G+f.S=+V8++@,,t#poff.HAUAATIUHSHH<@tz<*u utL1Hu1H[]A\A]Ð[H<HtP@t}*uҀx]uEuDMtA$H[]A\A]uAtHtEfDHtHt11Dx]Pff.AVAUATUHSHH dH%(HD$1߃AuHt'atHtA wHHcH>@1HL$dH3 %(HH []A\A]A^fI1HL~LH!%tDHWHDHL)HLHH+pfDH1IL1HILAH H}H< H| IcHHEHLMHMATH1H ӬXZLH H11zHfHUHH1HfDLEHMH fH1{ f.AWAVAUIATUHSHH[?HH9A HH9D#HL+AE-D#tHHx4HHiHtt T$ T$ H\tsUH9wuA DHH9w_%+HLAE蘅tD#H4HxHHD#HH9HHH[]A\A]A^A_1ۃ_IA II9wE<$A$HLm+AEE<$tLHxLH!HlfH9vVfDIA DII93+LLAEltA$A$HHxlHHA$HDAWAVAAUATUHSHHD&H $LD$Etg~~tHA*u}(z|*HxIE<*u0}(Lu=D '+Et1@IE<*tA$*EIT$HfHHBuy**HB+D+ EEHLAL9tLAtaHtt;to{At{At HILHN$;AASAED1H[]A\A]A^A_1HVAA AwEuIf֥+|*x+IfDMAt\IcL< M9vP^fDE7A i+=[+EЅtHHЁE7AuII9sfDHL9+HHEht_y\HHAH9 y\HAH} Hx\uAA)DH9uHЅA*IfDE1McIIAMDII90A AII9/+ !+AEԅtLH蕀uH$L0HD$HI܋ی+HHE2AtMcIL9A DAvIL9iE<$A$}+5o+AEօtHHE<$uH$HHD$L fLH$HHD$L8H[]A\A]A^A_DH"1HHiARAWAVIAUATUSHhH|$Ht$ HT$8dH%(HD$X1DHD$HD$t 9'IHD$8AHD$0A(DD$HD$LcJ(D;EE<T$Au|$tfIHE8&u A~DL2H= ,~b H5ht [HT$ 1HL$HHLd$HL)LHHfHT$ HL)HHT$(HH=HT$(H|$DHHHH|$0t$DH|$0H HD$0HtHH\$8H|$33g+HL$XdH3 %(Hh[]A\A]A^A_fDHD$B|(?Ld$H+11LLHL`J<LLHHD$0yHD$PQHHD$8Lc(LHD$J<(>IlHD$PLt$L%xHD$K4.ts'tn= ,~VȺAtfDLcÿA=HHL$1L|$PL),Hs Hu<L|$PL|$8IH|$A7eA>A[1uLHHx#HHHUHL$8dH3 %(H%HH[]A\A]A^A_A`HP1H|$(H路H7H|$ H1螯IHHl$(Ll$ AmAAy8HHITM|DA HH)HT$f.IL;|$!E'ALHw+AEzE'tLH|$ ILl$I9EH|$(;HcHxHHL$0Ht$HHD$0HHLD@H|$(HDHHH9WHHx[HHH31$Ll$@LH|$(~fH|$ fDME1ID$IM9tIAALH%+D$ ExD$AtD_HEHIMdM|M)A fDIM9S+LHAELxtA/AL%A/H|$ I-DME1ID$IM9IċQ+ LHEwt@AWAVAUATUSHhdH%(HD$X1HQHHE>u(Ht$XdH34%(Hh[]A\A]A^A_DIAHMHL (H1H|$HH%HHt$PH|$@L H$HH\$HHD$PD$D;HD$ HD$@AOHD$2wH HHЃD$D5+HEt{{(A*u{|*A un+`IH|$HMHDHLD1H'HDA*u |*tH< INj*A*IWHDHHBuy* *HBD5+ D +EDEEtAHt$DLuAL9tLAt\H4$H耰D$ABAp1EH|$H$H|$@H|$P$@1@AO߃HH҃!T$@{(LD8+EfDy\HHAH9y\HA@Hx\u )ωH9vHЅE1Hl$0Ld$8_fF+J,EuҸHHE蜭f.L$H4$B)DLcL9DA9HD$Ll$(MN4A@|$E>u~IIE9qE>A +=+EЅtHH7suEH|$ MLl$(Hl$0Ld$8EJHEJI$@Ll$(fDD$H $AA)McML9IHl$A Hl$Ld$MMDt$"@AnIGML9<$]INjЕ+ ~+AEՅtJtHTruH|$ MHl$H $Ld$JHEHI$n~+Ll$H߅LEЫL$$ELcOtH,$Ld$MM%E7IIEE7A +5}+EЅtLHqquHt$ H,$EMME.Ld$HHEJI$f.HIHt$DHqAE1E1CAVAUATIUSHHtE?HIuM1E1Ic})HL9vaLLHA]HA]HcAHL[]A\A]A^tZtdHL$ HL$IƉfD߉ǃ))LHcH1Ic}IlDAHA8HcH8(t!u +t@HHfL+H JAH? AWAAVAUIATIUSHhLc6dH%(HD$X1HD$HLLLHD$D%EAAl$,tA@DEHD$HD$(E1HD$HD$PL5HD$HD$DHD$ fHcI4.E"\$x}`f"'t=+AA%f.#A+EHcA@I4.:fDڎ+A]1H|$XdH3<%(Hh[]A\A]A^A_f=)+~wAt _@Af.HD$HL$1DL$0Hl$HH)HDL$0HHE1UDAD<{<(DHt$ LDL$8DD$0\$DD$DDD$0DL$8Xl$(A1A]HD$LT$H1DL$D$Ldt/A~D$t A~D$tLD$DHD$8bD$,HD$8HD$D$(xtxD$(HD$TE1E1HD$0HD$`HD$8fDM /EDL9EsEE$A#AA\$H|$HD$:t$,t HD$:ZT$(HD$:A`wA'A"= +FH=!fDHD$D$,xxD$,}HD$,lfDE1A AŃ=+`H5HcM /EDL9fDDMcC<'Ht$ 1++D$(PT$T$HD$ At A\xE1AHc@=+~_H=ftE1HcDL1HL$XLH)Lt$XFHsHLt$XfDLD$XL1HL$XH)LLD$@H'HfDHc=DtAD/< tH5;*D x=+{ff.HcT$LHDD$LL$KLL$@LL$@L$KDD$L,D $LD$LE1HL$HT$Ht$0\$A\$T|D$TXHcuD{+{HD$ 1ɉH|$hdH3<%(HVHx[]A\A]A^A_LD$@HcLD$XL1HL$XLH)Ll$XHHE1HcfHcT$(LHDD$LL$KLL$@rLL$@L$KDD$LJD$(\?fD\$TA'1LL(HcHE1bf.A|/($Ht$0L\$TE1D$TXHc HcT$,LHDD$LL$KLL$@LL$@L$KADD$LnD $HT$LE1LD$Ht$0\$,AHщ\$TD$TXHc@D$(sL1HL$XLH)Ll$XHs;HqfAHcWHpD$(Ll$XLl$XE@8q'HcUD=a+~oAtfDE1HcDHD$HL$01DD$(Ld$HH)HDD$(HH@8'=D<+u ""zσ@p+1HHtH{HxHHHH[Hq8+HtHGH uHHHtHHHuHBHUSHHÅt HHHHH[]H5NHH@SHíHx*HDHQHHt+t$Hs\uStHsHQHHu[ÐAWAVAUATUHSH8dH%(HD$(1HD$ =H+H|H|$H: E1E1f t1@A A HuE1H|AL53AIHHD$ HD$Mt:uAt\EttR uEuH=1+SH HMuLH|$(dH3<%(H8[]A\A]A^A_@H=+M~At HHYHT$L\$ 1HHL$LD$H)L$KLD$Hs(MHt1L HH9uDL$ML\$ |fDAE1E1E1E1E1襫DAWAVAUATUSH(dH%(HD$1HD$HI$IHxH$LH裫HoHs+1Ht1ۀ8HD$IHD$L-DAt$IFto=`+>IAIAuAH\$dH3%(HH([]A\A]A^A_fADtmAIIDAVt.t) yqIV IH]@lIvIH@H$HL$1LLd$L)EHs/AHe1 fDA A HH9uLLd$A51LH0趩fDUHSHHHHHH[]fDAWAVAUATUSH(dH%(HD$1?uA}IǸfAHt$dH34%(LH([]A\A]A^A_DHD$HǨH|L4)}IHL9s|HD$L-HD$HHEI9vSE=*+~ AD¸t:  HLH9uHHlI9wE&fLHL$1HH)Ld$vHsH HDLd$ |AUATIUSHHtEHLkImHhHSIE}Bu BHBQHHuHL[]A\A]ff.UHAWAVAUAATISHdH%(HE1HHHH%H)HHH9tHH$H9uHX+IHtAuH@Ht8u| fA u^LMt(fDL{M/L1LIfHHuLL3HudH34%(|He[A\A]A^A_]ÐLIL-٩+Iu3+D$$lH)HL+f.LH5V+H~B,1/ff.@AWAVAUATUHSH(dH%(HD$1HD$譥HxIz]IŀQ(HLt$MJt%L%Ht$Hu'AHI]HEt1=گ+~؉؉At,AHI@]thHUHH@HT$1LHH\$H)>Hs(]Ht1\AHH9u@H\$]~fAHt$dH34%(LuUH([]A\A]A^A_f.}fAEf.}HL֡_ff.@ATIUSHtPHàHSHH*Ht4HCH8HSHH:?uрuˁbf.L[]A\SHHtH[fAWIAVAUATUSH8dH%(HD$(1HD$ HL1L-E1+IHD$ HD$W@Et$<tG=+Et$~1I4ADE4f.A9cDEIcL9s"A<uAEHcIcA/L9uHcA/H|$(dH3<%(LH8[]A\A]A^A_DuHcHH)D)I /DA,HA9oLLT$ HL$1H)LD$LT$LD$HsH+@LT$LT$ ff.AWAVAUATUSHHT$dH%(HD$81HIIH"> D$NH+He Z1 DHt tuHut$^MUAHvgH$tcAH$tTAH$tELԠH$7fDE1H|$8dH3<%(LHH[]A\A]A^A_H$HD$,D$,E1L5+HD$LAHft|HT$H4$ELHEHHt]<L$u"HcD$,DPv< xH؜HcD$,HtHMI}L1ID$1P|A4$@AL$H= +ft.<mIAPv< Mu@8t?@yLT$0HD$0@A @A =֩+pHg@<щL$,Hc\Sv /E$EQA|$1?DC<t;\NS€ @H@Ɖ@uA8tńtD$,EHcD$,\f.{HHִLHKHPIŋB%D$EBL$,H$1LDD$H)ADD$HAT$,H@JL$,@HD$qLfHT$JHH蚴IRL$,EA|$A<C< AD$,H\C<v A<~AH*Sv HA<\u҉D$,fE'E$E/@D$,HL$,A8'Hޟ+H D$1{< |~ ~ 1~@lj|$1L$,zD$,qff.Ht/SHHCH84HCH`Hu[HSփ*t1@tueH5}<H[DuHL±HHHt7HCLDHIIMuſnIHtCH8t H1+HŋT$ |$HHHHH[]A\A]A^A_1@AWAVAUATUSHL$DD$ HHIA1M>HLHHHt7HCDLH8襛IIMuſmIHtCH8t H1[HŋT$ |$HHHMHH[]A\A]A^A_1@HcH=b7+?t -N7+f>7+tB 07+~.H17+HLHH9t 8tu6+ff.@6+tB6+t8HHtHclHc6+H56+HHf.1HtHff.@1f^6+DHU6+SHc߀<u [f˙H46+-%6+[ 6+tF6+~4+(H=P4+` +D$H|$H֗*b"+D$ /W+u *I"+495W+-Ċ*1X-*D$u9i6+RO6+dM6+, V+"=7D\$Euk +TH=+C|$L蕕H5;1ʔH=jLH1yob!+1H5.;艔H1?D$ |$H*l|$Lc1H$dH34%(yH[]A\A]A^A_9+1H|$HD$2\1H5l:H=KH1b-B +pU+}fD賻A+D$q@賆|$L芕D$HD$ H++HE11u &@t1Ҁ 1ҀA Huދ|$ D$8AHD$P|$1HD$0E1LHDl$I@M9sH<$LC_H$A?tvA]1AHCHx^H$HtQ|$H$LHʇHt$(H<+輇m^H$W^H$H<$L臇A?tbAbH{^H$qL4$Ht$(LDI<L8@HD$(xuE]H$_H{1]H$LIHHfH|$()HxH]H$HK1?e]H$ ff.HH=q'+Ha'+Hff.AWAVAUE1ATL%lUHS1HXt$dH%(HD$H1HD$8mHxHD$ \H|$@H|$H|$8IH|$(HD$1LtA'\"=+APAHLLDD$ H $NDD$ H $DIHcLtAuAHD$H|$HdH3<%(RHX[]A\A]A^A_@D)AHc"fHcLtAuEA\ID$D taA'HcIAIHcfDT$D H=އ*@A\IAHD$H识H$HvLcJ|5褆LH$Af.IcHttA't<=%+AthAIcHtufDH4$DH?L$DIA8HLHE1DžLÎHc@H$HL$1Lt$@H)HEHsHfDA'Lt$@AfHT$ LD$8L1HL$(H)L$HHsH~AfDL$LD$8bfE1HcDt@AWAVAUATUHSHHt$$HT$(dH%(HD$81HD$0E1Hv HIHD$0E11IPHD$L-iI!f.HcHt=}<`<>wMIL <~ Hހ:wLHDE=+‰ATtjHcHt=uEt D$$HHxoXHHH衁HH\$8dH3%(HH[]A\A]A^A_LLT$0HL$L\$H)1LT$L\$HsHaLT$LT$0fDHt$$HD$(HHt"HH5W$HH8B18ft$$HdHGAWAVAUATUSH(t$dH%(HD$1HL'I1M1LE1LLc謂HxWLHHEJ3T$8=VIċ +t(ENt3LA+H膾A[HH,DLH;IHt.HfAE(@_C+fL~H~HL$dH3 %(H([]A\A]A^A_JL39+u AJL3tAmy9HHHL$1aHxUHL$HIH~HDLrHI臯M1719ftAEE%@Ł At A E +HqIHK@(HErLH讼'fH5d'11HH1nL}H|YfAE(/AEDDLH`5IH@(HDAt AE +tH*rIH)@(@|DLL)IDžAE(Dt +A9E,1HЙIMM7H1葭L@Hh1HIMfDHt$HωT$D$T$Iĉ@DLL(IDžu2AE(DLL"/ML~AE(@uL"I(DL1x(IDžH%IDL1P(IDžtHљIH1IL!ID~L1HR ff.fH(dH%(HD$1H<$HD$HT$dH3%(uH(}DfH(1dH%(HD$1H<$HD$RHT$dH3%(uH(x}SH=+HHWH5+HHD1Hv+:H5Y+_+ 1HHfDt Hu|H=3+H;~H|Hw]H"+H +[~+H+~+fDH41+H+YfH=+HayHcHBH+HwH5+H=Z~+[@Hu+@HtWHtuH?1DH?H5qfATE1USHtcHH5+HHIHmHt>H}H5~+MtHHtHHHmHIHuL[]A\fHtS?tNUSHmHHt+H[HHHtHH[]DH1[]1DHt?t1ff.fUSHHt9?t4HHt'H5H0HHuHH[]1HH[]ff.AWAVAUIATUHSHT$L$DLD$8LL$0dH%(H$1Hc؉D$t<#D$pu!LHDH_Ld$pHHL聕H3D$pHcT$t@)9qHcL HH|$xp9DEPT$tA:HcH Gz*t L$?1@}D$D$f.D;D$@A#RA!EME1D$(DHzL$DT$LD$xDH߃ pIHo HD$ E11Hy'tKD$HL$0HHT$8ƃD$DDl[HEHtP@c*ZE1D$@t;HL$ Ht-1EtEtD$tu yDD$@@D$@E A} AT$ݹ;w%HHHЃ<ɁT$Ht$tHDD$TWHcT$tHD$H|}H DD$TD$tAED$ D$ D$uAD$݃t A}= H|$ Dl$EDL$ED$ DD$(HcT$xHHH$Hy8+PAL$Ht$0AL$sZY&l$Aƺ AEʀE|$P^D|$P,#|$P~Ld$H%MxA AHD$E1H$T$LHx@(@&DHD$`MtLsH|$rHrH|$Ht H|$HrH|$ rH\$`HP+H9|H?+H9[IHH_HD$8Ht KHD$`8=x3D$(AL$HcL=@!ub9}^@|=})HߍpHcJHËD$p+D$tH@D$p+D$tHDD$pHcT$tHcȉD$pL fHHt$x9oq@0H1LHHD$p肐HItHHp{IHHcD$tDHcD$t|! H{L0rLHqHcT$pLHDED$tD$D$D$D|#T#0H0Ld$pH,HL褏HLr@65+H\+H51rsHH1H]p=Nm*+~D*EL%+H$dH3%(L'H[]A\A]A^A_Ð+}KHHDHu _1aD5t*ASD$ ND *E #t ?D$ A{D;A0A HpD$ D;AA#CpHcT$t|}H :s*DW0Lc< w Llpu1L :H\HHH9D*E!HL%N+nD$tAE_@A/uD$D$D$߀^t A,c)Dd$PD$D$D$Q|!D*Eu#s?j@a*SHcʀ| @HL Ht$xfDEtD$tD;D$D$D$D$@A#D{D$ E1D$(t$ HcD$tL{|}DL rE\1L2hHI@)?HpH2>)Ht$ 蟄Ht$ IHpHxvDHt$ HmAGIfDHQ+I9H1+I9D$( *r <@<*EV 0+H HD$HHtH:lH2lf=*L% +fD@D$(I?H|$ LL=~ +H|$ L9<Hc +H9dHkf.A< D*Eu#?@*DCD; D$ E1AD$݃0H DH={AHtHcD$t|}D;D$@1HD$HD$tfDA-~LA?A@A}uFHjgIċD$(AD$HD$ I$`DA% A+tvA# /+H%H51XmHH1HD$HHtH9jHD$ HH#jfDA=uD$@EA+H|$H$H|$HifT$1DLhHL$0HT$8t$HHD$Ht`LL$HMAt0<  Ay1LLL$H9nLL$H At0<  AyD$ t$ T$LE11LL$ LdLL$ IL iH +I9dH +I9TMdAGD$(%D$(AGD$ AA@5{D$(.D$tHD$8HtHD$0D$(HfDT*@]1L>LNkHx?LHHD$HhH|$H1H$!#HtHgH$@t*u x]H|$HgnfDDH{LC|hG*D$ Aƀ@A ET$HtsHDpu@_T$HLjjHx>LHIjL@wu11HI(]IHcD$t|*t$1LHD$tHD$8HtHD$0D$(HtLfLջLfD$tHAEf8~IH(D$(AD$7@HA@AHuj*4 EtD$@AH5j* D$ DD$(HcT$xHHH$H*+PAL$Ht$0AL$eAZA[A$HD$HA8/Iu D$L`LhHx=LHINf|$H  D$DLD ƃ@D$DD1A<$/@1ɉD$=HIT:/ t$L_E1ID$MA<#%M<%u L$IFIǃ  H$L$LLHx@(@k4HD$XfDMtLdMtLvdLndHfdH|$H\dH|$ RdH+H9D$XH+H9D$X {IHD$XI$HHD$8Ht (HD$X8sDHt$HDD$(HD$xD>AAD߀At H|$ KHHcHHE(+H$PL$Ht$0L$VcAYAZAƃ AG< )H|$ `cH|$HVcHNc'+HH5z 1(fHL%+H1tD$4HT$x<@t<* { DD$(AAHj'+HHcHHY'+HD$H$PL$Ht$0L$ebXZH L|$H1AH$H$ALHD$H$HD$:f$NLcMA?:E1H|$HYIH$HLHD$(!LIa$7A AHD$LH?@(@H@HD$hP LcIt"MMM9MHD$H&+EuH$Ht ]aD1L=+HGaH|$Ht H|$H5aHD$ HtH#aL9H+H9xIH(HHD$8Ht D(E}}WE1x]AHD$HH8HD$ H8DD$(HcT$xPHH %+AH$APL$Ht$0L$`ZY$AHD$HA#<%Hl$HA1HHHH7HHI`t$LQZLH_AAC1H$HH*P(H$D)у@-HxHIMD|$DDHLEtLH$dL$MAHH_H|$ ^H|$H^H^vIL(MA}A}MD{fHcD$t|}PH߾6D`H@HcD$tPDdT$tD;A#~{@H51LL$ 0aLL$ H1L~LL$ L^uIH*IAG:fAHb*D4Au D$ A#AD$(fDHL%>*]W@LLL$H^t$ LL$HDDD$(T$xAAfH߾A@=5HfD07LLL$H^LL$HA!`HtHD$H8xA.HHIEt6fDHD$HD!+EuH$Ht\L= *L/fD ~ uqMML$H$LL>IDžuH$Ht%\M LD$ HD$XL[g^@{w|$HT$xDDD$Eu4t$H[H|$HtBH|$H[HD$`H[H|$HtH|$Hp[H|$  @ sIH@AH0[D$tAEHrHI?!I$m`L^Hxw2LHIHD$[t$L(UIA'~wAeAT$H$LA|IEuH$HtgZHD$`ME L4HD$`L7Z"EtMdt$LM[A<$hT=V**I D$ 2t$LHOIf|#DjAtHD$EuHD$E1fM9Au!HD$@(@ HD$hLch fMIGHHD$0f\Hx0Ht$0HHD$YH|$PH|$HD$XA:Ht$(H|$ H|$IX$AF AM LLI9I9*HL$IH !+A!A1L=*Ao[Dl$Dd$Ho L$HDŽ$B[M H A_HD$At*HD$At1HLHHHHD$H$DL7?E1HD$(0DA_AfIcI4=A~HD$XRHL=Z*MIFL$ID+LIHt-D|$DHDHE軷LI谣MTE1H[H|$ aNH|$HWNHONeIH~~ uE1cE1tHD$HPIPHMH|$HjH|$ MHD$XH$DDID$M@A<$~Md$D$ H|$E1H?AA1HHHLhfHD$XHD$JE1i6HD$`+H{詭L̦HM:‰HD$`D$@GuoH$H$DZDIEuH$HtpLMLD$DLH$DLL$tE1l$tHD$8HtHD$0HtH|$ KH|$HtHt$Lt$HHߺ+LL$0LD$8 DLrOLIKH|$HKHKHD$ HD$Lch4?HD$`6H=N+L$E1BeLHeL$IH+H_H5t1"NHL%*H1nH|$0 MlAKfD1H+H<tHH u H*Ht@HHuHcHc=U+ IHcD$HE1IAD|$HD}LL$[LL$DhLH\$hdH3%( Hx[]A\A]A^A_@$H߉t$LHt$LSIƋD$LD$HMt A>(zD-3*)*$DL(E1HtLHLL$耗LL$MtLLL$BLL$HcD$HD-*E1IfLD$ALD$I4H+E1E1LLL$XHcD$HLL$IfLT$LD$衕LT$LD$IMt A-MtAD$L$DED腝LAHD$ҖHcD$HLL$I@D-*H W+0HL E M D$e$T$fH|$eD$g+ĸ*@H*@$MDMHt$HHL\$LT$H*H9tHn*H9:HH8Ht@ t?LT$L\$& T$HUX8*YMAED-*E8E1DE1L=H߉t$LH #=Ht$LHN,aIƋD$LD$HMxL7IL-+Ht$PLH+ LIL-|+?L?DD$PE=K*5*}C+H$*HfDHc=+@L$D|$LrLL$1H8DGf_ BL3AVIu͉T$HA9HD5HH8H4HP(AAHxHD?"1IM1A9Lt A12IHLL$b>D$HLL$EHH>$IfMD$HAEE1EEA  D=|*Et =pC+1DLLD$訙ELD$Iu;D%D+AEt)D^D+EuHD$AfD *EKMBA6D}MA9Lt AfHc=u5*TD$HuHߍPFIcfDA LƊIMAEA9DDA@LH?Hx/HHd=IMND$HE@MnL?HxLHI5?L)D$LHL8)-DL$LHD$TEQHD$T1H\$ E1HD$HD$\Ls#Dd$4EHD$Lt$Hl$(YAmHcL=I+ ȺADlfDE9IcL(tQ)H'tc\t"=.I+ȺAA@Dt$HDHD$AIcHDIcI4t:'t5=H+~<At5AIcI4u@A @Af.HHL$1Lt$\H)H>L!Hs HtĉLt$\AZfAUIc1LQL!ALt$H\$ Hl$(Dd$4L9H5(LIfD$HE1E1EafDD- *EF*HVH9*&*"uH=+p L+IDŽ$D$|MB8HD$@D$8~ L8HD$@HD$ HtD$P111D$<pD$D$(D$xE}fDI|AA:A"EA|$8D$x~HItw LcIHcD$xADAFAFHcT$xA|HD$xMHcT$xE|HI|AA:KH4$6^ P t$, LcŃLcI9G<C4D$xD$xHcE|@A$A'D$uHDŽ$D$x$H$HD$0A6HcT$xIHWI|HT$(06HT$(HHD$(,H=ggA@IcIt'=@+ADHI9sLHLD$0 LD$0IfA>A`A~A\D$Dt$E=@+|H5A IHI<HcD$xHHL$xADBH9uC>A<.A=ZH4$6A APD D$L7+A< D$[LcʼnD$xEi|$8R D$xH=D$xHItAHL$HLD$0LD$0HL$HIHPJ<8HcD$xHpt$xADBH9uAA611@ʼn)HH9 K<L-7HcALm0HcT$xHE|f.A| t PDT$LcʉT$xKt AuDA@AE|$Lcy } D$$ L 4*DC#@D$T2D$HH$ H/dev/fd/H8I@HcD$HHHD$`[I~H+L*D *MtD9L$H|vLD$hDL$X7DL$XLD$h=_*|$H9| GN*LHcDL$XHc|$X3*1H6*)HHD$XHc4.LD$XHD$` *A!*D$hN*D$Xt *u !*1*1D$`JeD$X*D$`'H=Ǹ*t 1H*D$hX!*#|$T-H|$0(~ A t$@AAuE1AAH$D|9HH$ H:$HDHT$0~:HT$0HH8~u,D:A~u"HHHD$H.HT$0HL$HIHHL$0($HL$0D$x$ f.H$ T$|\$  DL$LcA6PD$(bHH^LHDnIh=.+DH=pAHL$HLD$0^LD$0HL$H\IHPJ<8fDHcD$xHpt$xADBH9uHu LcDHD$(HL$01L$H)H#HsHdL$AWHcT$xA|HD$(MD$Eu |$(8ALfE$71HHH:ID$KH51%+<^H $1|@#7H<$IL8t %A FtH$ANtH$ANtANLIvE11L$DŽ$U$|$IH*I9H*I9vLrML}IGHt@ t DŽ$$>I?D$|1ҾL0zILs^IcA|D$(GH5[LtIn@]fD$(HHL$0wHL$0HHL$0wHL$0IH@HI9sLHވL$TLL$HLD$0L$TLL$HILD$0 AH4$DHcA|D$x^H|$ D$|HtH|$HHT$@1H$L$H) HxHFHCHHIGrpH*xHIjH*L0LHx?LHHD$0oIGLDpqHL$0A9u yHHL$0|HL$0qt$<LC4D$HT$@1H$LD$0L$H)LD$0HxHvHLxLL$A|$[HOH="UAHL$HLD$0LD$0HL$HIHPJ<8HcD$xHpt$xADBH9u{$(HcT$xD$|HE|vHD$@HH$1L$H)HIHsHHxfDL$L2_L$LL-?*LLuH5HFfIE1\LL- *GL?HT$@1H$LD$0L$L)LD$0HxHvHoLxLsfL$THcT$xH=WItALD$HLL$0;LL$0LD$HIHPH4(HcD$xHHL$xADBH9uCDA6M`LILM>IL_mHT$@1H$LD$0L$L)LD$0HxHvHLxLfL$HT$@1H$LD$0L$L)OLD$0HxHvH|LxLL$`L4$Lt$0}8a[e*H $_*H $D&+ *$H $EH $1D$Xǧ*RO1; A>H $1A>|$TH $É|D$T9tH=*HtM{Hj*|$HH*H\$`Ld%+7qLH5Y*S-M** V#*4HD$@1H$LL$0H$H)HLL$0HxHvH6HhI:@H$HHL$0HL$0HLcH5]1E1H=;H1Js&H $XH $n}H $"=g**H $H5]1>H $H1Hr!H=ڌ*H $a3H $H51H=H1rLE1|$H|$THD$x$HD$(\USH(dH%(HD$1H?HT$HxHH"HE1HwE11H$s*~d*HH*H9tmH*H9taH<$HtHtFHCHtH8tHC`HsHL$dH3 %(Hu.H([]1@H,1H.Hff.SIHwE1ɉHH*H9t)H*H9t[H* H*f.H=q+Gd*u@11҉G`F*HÐH=1+G$*u@11҉G *HtHHrD1HfATUSH dH%(HD$1H1ۀ?HAD$*CHxHHH11DH$|H<$HHtQ*Ht$HCHtH8krHC`HqHL$dH3 %(HuH []A\@1ff.@USHHt9?t4HHt'H5H ^HHegHH[]1HH[]ff.ATUSH0dH%(HD$(1Guh1H *H<tHH u H*Ht@HHuHHt$(dH34%(<H0[]A\fDH<@tA<*t=H *Dt6u0!<kHHcH>{^Hk1H8HT$Ht$ HHH@(DuH* 1tHkHt$ *€@ ʨ@t ~]HcD$DH|$ H?k1#IHGH5HH\LHeHcD$HT$ D]H}H{HHHD$ "=H|$ HHU?L=c@1fD1H *H<tHH u H*HHHuHt$ H3H|$ dHH=HC1;t{-HHD$3HD$~f v*:1`Q*tHc=E*$HŐHt1}t#}t}t HDHHD$HD$fHHHP(uDtz@Hx H5HHt9|HL;7{H>D5~*51cfDH0HxHHHE$HؕHHnH5HYHI HbMHA<$tA|$LHD$h HD$1H =*DH<tHH u H*Ht@HHuHcEHHc=*1H Hc=*HHHD$ HHPHT$ X@]*pmHD$ Ht ~] T$HFC(HHHHD$ *HHtVtbHpH5٬HrTIĉH^bLHsH]H[]A\1H[]A\fDHhgH5HTH@AWAVAUATUHSHHt$dH%(HD$81HD$0 E1Hv H IHD$0E11IPHD$L=EI!HcHt=<`<>wMIL <~<4Hހ:wLHDE=;+‰AtkHcHt=uf.EH? HxHHHHH\$8dH3%(BHH[]A\A]A^A_fLL\$0HL$LT$H)1L$P LT$HsHa@L$L\$0D$u D$Lt$H׀HWHD$(h HxHHt$H|$ 11HD$ HHtUH}HH"[Ht=HeH5HQHHZH|$ HH|$ 1Hu f.U1SH(dH%(HD$1?t>@H<$HE1Ϧ*D$@*HHH5jQHHKZHtH߾^HHHHT$dH3%(HuH([]Lff.AVAAUAATAULSHH@dH%(HD$81Mt HIHt$(H6EHHxD$0HHD$ $HD$ Hx#Ht$0AVDjH|$0E1E11տH|$0HD$XZHD$HHT$8dH3%(H@[]A\A]A^D1HAHL$HLD$01DmHËD$.H;Ht A>YHAHtuHD$0HEjDH|$(WHD$ HtL8Ht AjXHH|$ E1Ht* #fDH5|HH E11HD `f.1Ht$ HHT$  @t *z]HL$H@(DDHLD$0AHflH^;Z{PAEDE;fDHHtsHxH@(AA@?t AWH[H[H81HHHXH;1H荳;lHDAąY1H5ӫ*<HH*H1X(1蜚H ZH rfAVAUAATUHSu,t'1Ht@)tLpMt A>uffDHE1DE1HHHtAHu$_XIHH\U[L]A\A]A^]IfDLHxLHI!ff.@AWAVIAUIATE1USLH8H4$Hl$pL$ DD$dH%(HD$(1D$(;IMAI9H\$+AA|$tx|$(tpFf0IAL$EfM4$Ht$HdH34%(L9HX[]A\A]A^A_fDI9rD$XՃOE1H6HL$(H|$0}*D$8@H\$0{a*HMtD$(Ht 1H:AI9tHHT$HT$HH|$Ht L$(tu HHL$L$(HD +EtHHT$'HHT$IƋ\$+H:uDL$EqHIOML0HxLHHH1WHIA}!AMHHDHu<_A< v, p*u #t?t@tL*ut )tfI}VHHt 8H512LH1PHLLL%*6M1A}uEp*Y#t ?KkL1HӪ1LH߅t/ҴH:*I9tHLM<$@ϐ$HH5HT$DDHT$IHt$,LD$,!H'fDHKH51HD/fDE1`HH5HT$CAL$HT$IzfA>t:HLD@@ƀ* @A~uHJH8uxuA tAL$HD$HtDD$(EtU11SHHH~HH'LHtHH[]V@H1[]AWAVAUATUSHt$dH%(H$1f*HDHH*D$D$ 5D$2)$HHD$1fDH+HLMHSL+Bu%=tH:{*HtHCH8L8HD$ML`<@LuJL$A@AFHLIM|$HMK LCL8II0L$A8tLL IfHD$HtHJHLeMH1^]HHoH{L#OuL HHt HPB tI1AfDHwLL$(11LD$,D$()IH*I9H_*I9.D$(LtIG@U[MtI}t L1\IHL1\HMI|$MM$$O%=M1t D$0-ʁ@@@D0APLD$@H31LHI9 H~H8-x-nLAIBtA@Hw(MIAAtD@uD$0-LK IuH6I9t H~H8-tt$@1 fDA4H@t L0HHHuD0~nIGH8 1H8IIUHH€:=1LD H|$0I LH, IHL$G$IrIG1H8IWHHIHHD8+uIg=nfDxt$@@yLIXGMHD0gPD0A @ʁtXt0PD0aIUHD8+D0gDHD0gPD0a@IGHHFHF*fL%*HDMtLSFHp*HHHHPB?HHHuHE*IHHP*1wfL$ tL= *M8E1H$dH3%(LH[]A\A]A^A_ÐHEHtH}tH1rXHHtD$tD*E#HKOIDD$ E}L=k*LMjM*ID$HH8.H#g*D$t#ID$HH8qHD$L=*MH!HE1H9AL$$H-*ML5 uD|$ fDD-!*I|$DH*H-ݳ**uL9u*M$$MuL$$L=c*L3DHP*VIGHH DHDs*AH9tH *H5~*t\HHtTL*HE1$@MtkHH HHHHHtHrFuHHHuEtL*H*HD$H)H@IADH|$HD$H\$HMCH|*@I|$Hc*mHW*M$$MuH=*BH*f.H}HOs.*HrE1HD$ D$d*D$Dl$ HD$ DH$E1;KJHHEH8HUH1LeIHLMHELmH8@ uDHEH8t"MHH*H9H H;HLsE1{ILHI~IHuHLH1TIH$H,$HEJfDH$HtH?AMFI<$L1TIf.c*dc*r* x*^O*=1c*5b*D$(HHHEH8HIHEH8LHUL2H;HD*EuyD *Eu$LeI9D$ ID$`H$H,$HEID$H8HD$ o*-H *HEH5n1@*HHH1AfffrfSHH?0H['H=*tÐH@HӋ*HfDH=*HtH5d@ff.@)tbH5*1HtTU1SHGHøHt-HkHtH}xHpH{gH_1H[]fDff.@^)AVAAUAATIUSHH5*H1LHH@Ht\H8HHx{LeHHHUI$1EB;/tJDm[]A\A]A^ÐLHx'LH\HEHEyD@FHH$*=^)ATUSH5*H1HHH@L @tYIEH}.u }/HxrHHø./fH{H3ku.HA<$.t0LHx/LHHaH[]A\f/LHHt11LH=5/t1H[]A\@HxǾHHHY@USH蚾HŅuC脾HEHE1fDHH9HH[]fDHcHD]HEE HH[]1HtG ÐAWAVAUATUSH(HUIHt$5IAD$1I$L,IHHD$ME1fD製IIIuHHt$Hx能Ht$HIuIFHtHD$HHHAEIvAFAEIMmAFMt' MyHIt1fDHD$HH(A9\$!AD$ AG H(L[]A\A]A^A_fDHt$VHx轼Ht$HHUE1ff.1t#iȓH1Ȅufff.@1tiH1uV!@AWAVAUATUSHHT$ D?EHA1fiH1uFIIDpHA!HtUIcHHuGHHt89kuH{D8?uLuރCHH[]A\A]A^A_D$ 1ۅtܿ McIHI$JHH HHCLkkCAD$ V  11-f.HAWAVAUATUSHDv ED?EHA1fiH1uFH!HHHHD$HtgH4$IE1HIHt8H9kuH{D8?uLuHMtCI$H$ADp HH[]A\A]A^A_fDH1[]A\A]A^A_11`HL$HAUIATIUSHHtvAEL1ۄtiۓH1uAD$ h蛹!I$HcHH HHH@LhX@AD$ H[]A\A]fD1LL+HtH[]A\A]1T$ uT$ IFfHW AWAVIAUATIUSHG~uHE1N<J:HHu(Af.AH{HHHtH+H{MuԐIJ:HIE9nAF H[]A\A]A^A_Ðff.@SHH?H[HtgW t`G~YAUE1ATIUHSHI$JHu'HHtHՅyH[]A\A]@IE9l$f.DSHcHdH%(H$1Hˁ*HHH8lH*Hu=HT$HHPHT$XHPHT$0H(HP H$dH3%(u,HĠ[fH@H@H@ @(f.AWAVAUATUHSHdH%(H$1D=*L%*IED(AG1HD$fHCH9\$HH\$HD$IH8D8/uLuHt$ LHu/H*Ht$HT$hH0HPHT$xHPHT$PH(HP LmD|$A_L;*HcHHD0H(*LlεIL0HtHKHx貵HHHH*H *Il$AD$(HMeHD*HLHAHAHA A(H$dH3%(DuH[]A\A]A^A_HH=udH%(HD$1HtGHH t8H<$x11:H $H¸HtH+*1H9 1HL$dH3 %(uHt@H1H~*HD~*~HH~*JHPH fDHHH@H@H@ @(HH9ufAUATUSHT~*L-U~*~<LMdfDH+H}DH}Ht6HH*L9uMtL}*H}*H[]A\A]S&H=O) Hx qHH/var/maiHlH{ fCC /H5)H[ff.@ATH="uUSHdH%(HD$1D$Hl${HHHHMIHA$Lt=<\tQ<%tptHH=2tHu?HHtH1'HoHD$dH3%(uH[]A\1Hff.H=|*tÐff.AWH=AVAUATUSHdH%(H$1HHHHx_HHHD${*E1Ll$ fHy{*EJ,JH;t\LHLpu?H|$Pu1H:{*H(Hx ~HT$hHPHT$xH(HPH@ *ufID9=z*uH|$H\$H=1HSHH$dH3%(H[]A\A]A^A_fHz*LH(H8Hh6xH|$PlH;l$haDo1H5\HڿH1/DL;t$xHz*H(LpLt$M1HH=wHy*LH(HH H8HL$u\HL$H;L$P}PDHy*H(HHH9HH|$(`IHt@HLkDHiy*H(HPH9P|PfDH5N* O*f.HD$ y*fH=4H51HD$M+H5q1HD$0SH*HcH4@Hx*$[ff.x*AVAUIATUSt x*HH9t H{*L%ox*H-*L5a*%I<t)ADHHAt*Auڨt@l?f.e*u%y*%y*d*u%x*[]A\A]A^ff.HHH*H*L*H=*H*H5w*H _*Ht*nx*Hgx*Uw*H.*fDAHGHAHH=u1e>HHn*Q>H=a*7w* 1!w*(>HH*>H=*v*1v*=HH*=H=w*v*t^zv*K*u H+1=HH*=H=*iv*t'^v*H띃\ff.@ATH u*HcUSH|$ Ht$dH%(H$1A*D$H*ÃÃ@H5*H4HHt$H5H9HfHxͪHHHD$8\$ C*w*D$Lw*H$ HD$0H6t*H+t*HD$ H`*H`*HD$(AD*D$DWD$H=*%|$ At ${HD$ H$ H-t*Hs*H|$0JHD$(Lcd$ *H_*BDƒBTT$L*v* D$DtHD$DH|$PH5***AD$HtH=*W1H$dH3 %(H[]A\fv*D$Du8D$ A҃Ht$H|$8 *fDHt$PH=*J@1H=*D$HfH|$BdffDHcH*H&EA1HD$H-M)ADt$ L=D{!LLt9HH\$HDtzLtMtAt*v+l@1/HK/K<tCDf.CL-yh*uH\H9*tfHHAff.@h*tfHAh*tfHBh*tfHCsHB_ff.@HC?ff.@G?w$ATL%*HdUHcSI9t[]A\@1_.HIQ.I<uHf* ff.fAUL-f*ATL%UH-*SHfDHHAt7L9du1-HHD-H|uALHHAuH[]A\A]@G?wH-*HcHsH9t@H4HuH'f* fAVGAUATUSt[vVHc@L%e*Aƒu%utHH9O*[]A\A]A^L%e*HcAAAAAtoHx*E,HEtA E,[]A\A]A^fDL%)*HcHoI9;1~,HIp,I<He* DDEuKlH*E,Hf.t<1A$[]A\A]A^DH*A HE,5@Hi*H4+ff.H>H5m%d*HÐAUGATUSHvHL%!d*Hct:t@L-*H3I9DtdABtDH[]A\A]fL%c*HcA@uH߾[]A\A]fuݾ*fD1*HID*I|AxAl@SH م*7* D$HD$3c*Qt#H|$*D$D$H [DH*H HxpHHHD$b*1H=**b**D$ *D$t1H=1*D$D$ D$tJ|$tc|$t\D$*DE*D$ *H|$UD$H [{ H|$H5l5*D$@Ha*Hc$ff.fATUS1HdH%(HD$1b*Qt$HT$dH3%(H[]A\DHD%!O*O*dHu`dH5YkA_D%N*g7Ho=N*50^6*^U*u AD/H=s*Y*4@a*QtDH5jBa*QtDS*H5jCp*[t*~H4`*H$H5i-ff.fATL%*UH-_*S1I<t1dHHAuH-_*tHHHDu[]A\fD1Iff.H=H=HcHR_*SÃt#@u#tN~,At7BuZ4`*QtT[1ۉ[f.u4DfH5hD뭐H5hBff.fHcH^*ff.HcH*ff.HcHb^*ff.HcHB^*@ff.HcH"^*ff.H^*Hc H*Hff.HcH*HfHcH]*f.HcE~*H^*HЃt%Ht HP(HtHHHrHp(@|f.Sf^*=`^*HcH4H=V^*  C^*HD^*9}(Hc)HHLHHHH9u[ff.^*ATUSHcs}*[H]*HHGHCHS(HtH9tHCHJHK([]A\Ëb^*C ;t5HSHs踁HH~FHCHkHC([]A\1DHSHs;IrHHZHCHCHK _@=]*%=]*u%C ;Of;1½L)H9F;1L誽K ;HCHs΀HfDK USHH]*eHcR\*H\*9t,H-E\*D\*\*H跿H([*  th\*u w\*t[*c\*[*w=K\*$L\*l+bfDHq)HH5Bg1H1&[* [*H[]ÍP [*H[*H[]D=[*e#1Z*t!tHZ*Z*Hc@<f.=y*t.*u=c)1É=y*1=y*t.*1u 19=/)9=y*uf.AUATAUSHdH%(H$1H誾1D辺Hx H|$0 HNl$0HHDH0ID;%}Y*H}`HyY*IcH1HD#LkHkHC(HCC H$dH3 %(Hu.HĨ[]A\A]@D1@D1辺'H11x H1HfHt?USHHHc/HHt]HUHX*HH[]AW1AVAUATUSH9HcM9=DX*E1=w*u E19w*AH&X*LcN$N< HI?H(Ht*HtHUHt H;WHD$HD$H(H0#0HHHD$#HD$L%W*II$Ht6EtH H[]A\A]A^A_f.(fDEtЉDHUW*JM1fIH(KHtSO[Ǹ1ff.fSx29=V*~$HV*HtHcHHt H[u [HV*HcHHH2H}V*HtHHcSHHt4HsH+s(uHC(1HC[D;H޺1ָ[øfHV*HcATUHSH<t{9U*:=cu*tz޾*9-ԣ)ụ)1i[]A\fHU*LcJ<t1H5bLH1 HU*J<=t*u߉t*JctfD 11Ã;11ͳ\1H57a´H1v8=et*t-)*u ;=Ӣ)t1D;=Rt*uHt!H@~1 ff.USHHLH=UHt HIHٺ[H5y]#H=UHSHHT*~:HT*T*HHHT*HhHXHHT*H[]@ &@HH?HcVH fH=IT*HttHH:T*,T*9*T*}dHHGHW HH@@@@@@@H9uHcS*PS*HS*H<SAUIATIUH-7SHfHS*HtJHHSHS*HH{H981ҋ^S*9\S*|.HHOS*HuM!H[]A\A]fDL+HCHS H@@@@@@@H9uHcR*PR*HR*H=DMcH{A$8RL趴BR*9R*HHCHS H H@@@@@@@H9uHcTR*PKR*H8R*HHcSHsfDHLH= ^1[]A\A]HH[]A\A]郆H莅HQ*HQ*HSQ*H1Q*Q*[fAVAUATUSH}Q*HD-Q*HtQ*I@H؅HAQ*HtyL3H{L5-Q*Q*9Q*}L#HCHS H@@@@@@@H9uHcP*PP*HP*HLHuHH=\1BD-P*[]A\A]A^fH{E8iH舲YrP*9pP*}bHHCHS H H@@@@@@@H9uHc*P*P!P*HP*HcDH蘄QH=O*t"SO*O*O*[@ff.@SO*O*O*[ff.H=O*t"SO*O*zO*[@ff.@H=DO*t"SOO*1CO*j8O*[fff.@H=O*tBSO*tO*DH=N*uN*[HN*fDff.@1H=N*ff.USHHN*Ht:H DHHt(H{uH{E8uHMuٸf1H[]AUATI~UHcSHD-$N*N*豁HcLHHM*LcH{HHokHC蓰HM*D-M*H[]A\A]f.?.tw=M*T*ATUS!uBH)IH;Hu6fDHH;Ht$L)t[1]A\fD[]A\fDGt<.yo1AVAUATUHSH?fDHH|u蚛H}IHHE1fHHAIH;MtHt)IcHMtuH;H蔨H;HuIEt&IU1HtDHTHITHuHHE[L]A\A]A^BfGfDAWL=AVE1AUATUH-NXSHH(dH%(HD$1HD$LD$L,Lc<]wzHcTH>@Ht$dH34%(#H([]A\A]A^A_E1S(tLCHKEtHEAD$1D$E11E1A,$ND_IcL+EHcHtB|t A[MHcID ;DDEEt[HcHAuBLDOMcNEtyD4$E/DEHEuH([]A\A]A^A_fDDbIcHA\t`HcIDD ;D[f.D$Et/t\rEHcHE]LcHcNH\EEhHLcLcNJ @$X*L5UIc L>[A0HL$AEL$T$ LD$J@DOED$[:E:]cA22DEă]t=HcMcHIƒujAWAHc4]uAT$L$McLcHcEB ]NHD*A:A=@A.cA[McMcET$BB4 @]ED$7fD=u1t-:]A=McMcA1BB4 .Dl$E:]A.McMcAD$BB4 A:McMcAE1BB4 A[McMcAABB4 YALc׈HcNHfA[McMcET$BB4 @]tIEԹL$ET$ DLD$HL$I<{WMcAHcB]4JHcHZWMcAHcB]D$4uH,L$ff.AWAAVI@AUL-ATUSHH8dH%(HD$(1HD$ H<H|$H|cxIHHD$ HD$3@tHN߀*tÐff.ATUSHdH%(H$1>*u$H$dH3%(HĠ[]A\ÐIH)DŽ$I|$Hjf.;yu);uHC;1LH$C$f*fDH= *$H5}* 蓜H=l**Yff.;*u;*;**u9:*uE*u>D:*=e[*=*F[*DATUSH@dH%(H$81H4$u HCH9tnDŽ$HL$H}H$rLHu1҅uH$H$8dH3 %(HuH@[]A\DDŽ$>ff.S9*9*0 * *t$ *Hq5H9*>*Z*$7"*=*=*=*#*Y* "*"*1g[ț~H4H9p=*u+fD3PEY*$? . *tC%Y*$(m1'f9*]>8*u ]Dw7Hs,D7*=7*Eu*HB*7*9uʉ=7*5J *t D *uLN*7*7*uHH:B*uHHtu *uB*u땐ff.HH5H07*Hff.H *t 7*tTH==*(H1*11訒H=*76 *uHVDfH5i5Kt'H50H_6*HvVfDH5ff.fH5%6*kf.AWAVIAUATIUSHHdH%(H$81Ll$LdHD$pH$LL|$hHHD$cH$H$HLLL˜H$8dH3 %(HH[]A\A]A^A_ft;H$LYcxeu ft u19|1@L9uD$)qI9|ul$1)ՅUt9PX1HH=4*4*SH5pCH1IHHff.AUATIUHSH(dH%(HD$1tyLl$LL$HD$u'1H|$dH3<%(H([]A\A]fDLLT$HD$tHt$H BHcH>Ht$6Ht$L!txHD$fDH9efH9UfH9EfH95fH9%fH9mHLff.fPXH5B1HǑ1H-ff.fO1G3wH HHfDSIIW=ރ@)(LL |>u1[fw!u =@ttre?1@eùlnguLL[w=u@@tu1[@w@tul=~cnu~1LL[x@uTAA8&LL&[@fDgwLL[fDoWLL[fDuDAA8LL謒[f@ftR@q1LL[bf0* x* EЅtLL [fDLL[WLL[LL[LL[/* EЋ*tLLW [ff.fSHdH%(H$1GG<3wFH>HHcH>Ht$H]uD$,9|)1H$dH3 %(IHİ[fD1>fDH+^볐fH蘀HP(сс@@aHxVfDHfDHt$H\+D$)uHt$H\H|$@fD#fDHt$HӋH|$HcH9UHt$H3\D$(%=w"fHH\f.1>EHt$H[+D$)Ht$H[D$)Ht$H[1D$(pfHt$HS[D$(%=@BfHt$H#[{D$(%= gfHt$HZKD$(%=`7fHt$HZfDHt$HZD$(%=fHHP(Hx_f.Ht$H3ZHD$hH9D$X+vfD>gHT$PD$(%=9Ht$HYD$09x) 1H\9E1111HHHHx1 HHxH5JlMHYfSHL+*dH%(HD$1Hc +*I;-uT{uNHHL t7F{t****tB95**KtD1HL$dH3 %(u\H[9}H5j31ȁ1H.u"*HD$H@8H="*"*xuHD$H@ 8)xxn"*m"*"*Lxl$HL$HcD$HHt 8]ugxua|$~?C"*D$5"*x "*H="*!*7H5*2fDHHD2L ,2 PL#21j H="*jE}H(="*t H|"*HHh"*H=U"*St@1H51H 5H*"*H1@u[f.;fH511H}H511H}H511wH}1H52\[Hs}SHH?|H;7|H[.|ff.HH8HH0)uff.@H=D!*tÐH@”H+!*HfDH5!*Ht0H1%HtH@H1Hf1ff.fH= *t"HHt H@H1HÐ1ff.fH= *ATUHSHtpSIHttHx{H*~HxRHH{Al$HID$Al$}D  []A\@莓H*-RHI}HxRHHN{HI$}HxQHH.{AD$HID$k}D tQ tLHH*M}HxQHHzH޺H詗H=})L`[]A\0DAD$Al$[]A\H5*HtOS1XHHt8HxGH{yHyH=_})j0H*[@ fD[Ãff.fH=*Ht@HH5H=*脘H=|)Hr*H/fff.@SHD*H{ 1ۅHcH_PHH*P~VH1HHLfDHHt'FHHzHHH|HHuHL9t HHtH;kH $HHctyH[ff.@SVHHt#HXH2{HxOHHxHH[fDAWAVAUE1ATIUSH8zhHcHUOHIHD$EOAE1HD$*D$ HD$O<MA7@@E11%@ +@ !@\@'@"{u/H=8-T$Hk*T$fAIcA4I@{E9IHD$H|$yHDD)AōD9TLIcHcH|$AwHD$ED=*McBHD$0iD$ *@9DL|$E@ H=W,;HDkAMcO<A7<\'<'?<"7@D@ t@ uDD)HD$HcL<fAIcA<fDAIcA<\t@8uA<T$(|$蓂AtT$(H|$pf%f^fDHD$AMcLxH\$Ht$LD$(HuA\HLD$(H;4 V*&D$ H|$LD$(LD$(HLxLD$LwH|$HwLD$IƍD97IcLH|$LD$ZuLD$t D$ tHcAD< 9< 1*1D$ *19f1)fLcAMDD)HD$HcMcL<@tDkMcO<A7H|$LD$ vLD$ IDD)ABD9G<H\$IcHt$IcMcLD$(HtB;LD$(D$ C\ IcIHD$E9g8^H|$sHD$H8[]A\A]A^A_fD@GL|$E1McDA7@L|$1Mc@@@\t'@8(AMcO<A7@@\uAMcO<A?uHD$8t$ x]AU2@9}H|$Hc5JHD$T$|$(;T$HDX|$(AO2@9}H|$HcLD$(LT$ ILD$(LT$ HD$(H='败HL$H1 D$ .f.O<A?rAMcO<A7gfDK2D9}H|$HcLD$8ILD$HD$fD$ E/f.HtWGtPAUIATIUHSHHGHXH9ufDH[H9]t LHAԅyH[]A\A]fDff.@HtWHGHtVWtGATUHSHXH9t/H{GH{IHtFpLcH[H9]uH[]A\1DHtWHGHtVWtGATUHSHXH9t/H{H{IHtoLcH[H9]uH[]A\1DHtWHGHtVWtGATUHSHXH9t/H{H{IHtfoLcH[H9]uH[]A\1DHtWHGHtVWtGATUHSHXH9t/H{H{IHtnLcH[H9]uH[]A\1DHtOHGHtNWt?UHSHHXH9tDH{GHCH[H9]uHH[]1Dff.@ATI UHSEHL HtHeqHxEHHoHHkHHCHC[]A\fS EH1HHx@oH@H@HCH[ff.ATUSHtsHIċEA$HEID$EAD$HEHXH9t2HsH;IT$HJHAHHHBHPH[H9]uL[]A\fE1[]LA\DAUIATUHSHHIċEA$L9tU1HsH;IT$HJHAHHHBHPH[I9uHID$LAl$H[]A\A]@11f.ATIUSHOHYHtjH1HSHBHPHCHXAD$AD$tbIL$HcH9tDH3H[H9uHQL;%*HIT$t[]A\fGHu*[Ha*]A\DID$[]A\f.HtGuHt ~ "f1ff.fHtGuHtHfD1DHtSHHHtUkH[Lk@HtwUHSHH_H{H9tH_HH9]uH9-*H[H[HEEtH[]HM*H:*H[]ff.@SHgH{.H[jDHtDff.@H#DWEH9=*SLOIAI9tHE1D9~SHIAI9uH HHQI9uHAMIMIHGG[LAI@LcIILIfL)HII9uIIA)DWH HOtHtHXHHHu1[H*H*D11@1ҾHAVAUIATIUHHSHI9l$L5]*IL$Mt M9HYH9u8fHHM9[]A\A]A^ÐH[H9tH9+uHH{{hMtLkHx@LH:iILk1L% *H *[]A\A]A^f.IT$L% *H *HJHAHHHBHP1Il$AD$[]A\A]A^HSL%] *HN *HBHPHCHX1AD$[]A\A]A^DH! *HH9~9HYH9 H$@H *H *DH9tH9Ht=Ot6L *HWI9uMukHBH9tH;0u H90tH@H9u1LPLHMJMQOH9wuI HOHHH9t$H=E *H 6 *DH) *H90~fI9tH= *L *I9uH *H *HtgGt`H9w|ZH *HWH9uHueHBH9tH;0u =DH90t3H@H9uH *1H *f1DHq *H@H=n *DHY *H90~fATUSHtcGt\HGHXH9tOI1f.H{}HHH[HI9\$uHtH8t[H]1A\D1H[]A\fDATUSHtCH1IIfDHCHLHH HHuL[]A\f.E1[]LA\DAUATUSHHtuGtnHGHXH9taIE1H;*HH|LHHIdH[I9]uMt I<$tHL1[]A\A]DE1HL[]A\A]ATIUSHt&H1HCHLHHHHuL[]A\fAVAUATUSHGE1tjIxVIIEHhH9tfAH]HtHfHxf;HHdHIcK\HmII9muIH[L]A\A]A^E1Lff.AWAVAUATUSHHH|$t$dH%(HD$81HgWH1:H(HCL`L9=HD$ AHD$fDHt$I<$(Ml$IM,LmI|$O11jIźMtA>tA~ M/A}BtA}BtA}B@D9eIcEOLD [IcHDL$c1A>DL$t)A~tA~tL9eDL$@DȍpHcDxHcD ]McD5=M J|5Lb1A}t$A}tA}HT$AIcHRI9T$FD AMcLraHD$Md$L9`nfDAOLc9|)Ht Hc99HŋD$BD5)BD%.HT$8dH3%(HTHH[]A\A]A^A_9}HHc8HHL$HII9L$dDxBD5 Mc8f.Htk8t>xA~ LcP@s\IBE1IM LT$DcT$DL(cSHh[HH_H1AA `cff.AWAVAUATUSH(HOT$Ht$iLMwM9pH|$E11E1~bD$uInHt[T$HcHHD$KbL$LA9~ZH|$HPHLeM;~t|HcHt$L_\$MvM9t_Eu@A@^6IvfDEA9~LIc6H|$HIHj_D$tHz^M;~uMtHcAH(L[]A\A]A^A_D;HHpaT$LA9{H|$HPHLdH^D5IfDE1ff.AUATUSHdH%(HD$1Ht;H_Ht4DOEt)H9w|#LKL9tEI;18I91}3MIL9u1HL$dH3 %(HH[]A\A]fDLH~"IAH9tfH9t H@HH9uHLAIHu71H5HLaHMuL=hKuGH|$=HHt8u|$~8 fEL1HHH\듐L1HHo4H_DAWAVAUATUSHdH%(HD$1HEH_HDG1EIIA[HH@HXH9t4H{DLLH{IHt[L{H[H9]uDA HH|$ IHt8u|$ fA$H1LLH[[HHL$dH3 %(HuiH[]A\A]A^A_ÐHu1H5ZHsHfDH01iI~1L2IZB^fAWAVAUATUSHdH%(HD$1HEH_HDG1EIAAHH@HXH9t1H{DL|H{IHtHZL{H[H9]uDA HH|$}I5Ht8u|$ fA$H1L9LHYHHL$dH3 %(HulH[]A\A]A^A_@Hxu1H5HHfDH1٦I{1LO1IW\fATUSLgH,HMt L1HH{Ht YH{HkHCHC Ht XHCC(tIN)%C(H[]A\ff.ATUSHLg1qHMt (00HfHLH{HtdXH{HkHCHC Ht BXHCC(tM)%@C(H[]A\fAAWAVIAUATIUDSH0HHt$y/L+ILZHxb/LHXC(@H{IurHt$ IMtpLZHx'/LH\XIGC(IGLLAG(YLH`HH[]A\A]A^A_@LIMu.IGDDHEYDAUIATIUSHHHHC Ht4LLHHHtHVc(HH[]A\A]@H{HC(@t LÐLhfDAVIAUIATAUHSKHHtSS(t3A @t{ELLH1[]A\A]A^ @tH[]A\A]A^1HQH7*H9tHt P(HtHxtHHrHtHHxHuH蘶H[]A\A]A^ff.AH1ff.@SG(HtA t#@uH1[K@tH[fDH H[ff.AUATIUSHJHHt`@(@t@u8tDtHH[]A\A]ÐHH[]A\A]~fD1ۨtL蚵LOIHt+@(%=AE(u/LjuPHL[]A\A]rfI}VI}@rHHHL[]A\A]rfH5 11~*VLH1$H51VLH1Ae(qHH@(@sDKw@(@RY@AUATIU1SHHt HGHhHAHt)fDHCHE1LHHHHuAd$(HL[]A\A]ff.AWAVAUIATUHSHHhdH%(HD$X1>(Hy LEIHt C(@1MtmHD$PLl$MH$Hl$fID$Ht&H8Htt@t[M$$MuLLl$Hl$gHLI9tLQHt$XdH34%(HHh[]A\A]A^A_HI9ufDHt$LHD$LIH1=~HUID$E1L8H$HLLtTI4H|Ht$((HD$ H t`=Eu7[+H蓪uH5V*<HE\ H=^*kRff.ATAUHSHiHt,HUHHH5 1XH[]A\NEHHU[H ]H5w HDA\1WATAUHSHHt,HUHHH5+ 1WH[]A\+NEHLHU[H ]H5 HDA\1XWU[HSHHtHHO[u1H[]fD11H}HcЀ<]u܃t׀|uЃ~S t t @봐PHf.H9tCH< t< tfAUIATLcULSHdH%(HD$1$AT$LHcHHMBD%HDL-*Ht$Ht*HHHL-_*ILHLT$uE*)t!E1HL$dH3 %(LuH[]A\A]轲COff.AWAVIAUATUSHH8T$HtlG(tEHO@HL$HEHH1Mu@H8[]A\A]A^A_Ð@tHuHtf.HD$1MtD$E1E1M$FD$IHL5#*t H*LLHhL5*M?MeIGH@t9[tKs(@@t1HL$L3H5*NHL$LH1H`fD11HHL$zHL$LcN1A:]C(@u[T$HHLIHC H1HLHMtLJH(HCH@MdMsHH|$HD$H@H$HhfDND1A=t+PB|1=DDtys(@@A@*@At F@@J|1+?=D$u AJ|11DD$-7DD$HIDL%*HC(LT$H*HLLLVLT$LL *BIHt]HD$gH|$LHjAHy1LT$ HL$LD$({6LT$ HL$HIA]a8LD$(s(A@J|1+D$@HL$H5* *uH5 1rKHL$H1HLT$fDDD$IHqHLD$ HL$HL$LD$ HIws(AL@5HtLGvD$H:H2ATAUSHDHHHPHtHÜHtc([]A\fSHHtH[fATIUՃSHHtMt LHdH[]A\ff.AU1ATUHSHHHt W(1HvHcHـ9]skM(@t]*tXAA@uPHHXH}HH3Ht9HHD[]A\A]{uD1H}E1~HD[]A\A]1H3IH8H}H% LE1EHD[]A\A]@L- *HHL-o *HH}}}HD[]A\A]HWHDH H51A}HHH=H19@H5Z1AGHHuHH=SH19f.AH51HHH=H1N9LADff.AWAVI[AUIATUSHHxHI1HHI)DtAAD$D9}_Icǀ<]uVEHGHxHH6EE[HMtHI.MtE)E}HH[]A\A]A^A_DH訤MtI.1MtAEMtIf.AWAVAAUIATIUSH8dH%(HD$(1HT$Ht$ HMHT$ H<@<*|$H9HcT$H|$ HH@(@HHHyE(HHDLHHHHCHL$(dH3 %(HH8[]A\A]A^A_fz]TfDH1BLN@L|1A80A]Ht_8tjHELHHHnfDHUHRH7H1$1AfL1Ƣ!LHD$1豢HD$HBzEf.USH!Ht$HH7HHAHH[]@1HH[]ff.AWIAVIAUAATULSH8t$HT$Ht$ dH%(HD$(1sHcT$Ht$ H<@<*MtAHtK(ȃD@AHLeH9HCH,K(1Dv@=HHJHHD$@HD$~]kMt<*AA9HH{HC(D@HHHD$ 8*u D$Dt$HHHD$YHD$TfHIHHLef.HD$ L@oHD$ @[fD1HL$(dH3 %(iH8[]A\A]A^A_LH@u[HCHt1DMt롐HwK(twHCHPMdMxeHAHDH|$ 1,HT$ HHcD$D]Ht(}tHCH#K(H>DH;p1 f HH`f.X1HYH:fHhHHmHHD$p>HD$0fDL1Aff.@IHщ1mff.fATUSH dH%(HD$1HT$ Ht$HtnHT$ @t*u\z]uVHxHtM@(uEDtq@u]HHt0HD$8*uuq1HUHH誒 1HL$dH3 %(Hu^H []A\f{ HfDH=W1HWHDHIHLH={h@AVAUATUSG~pIAE11fDIJHt+@H{EHE{THHWHHHuIE9nHtH}t[H1]A\A]A^鑤1[H]A\A]A^S1HZH[[ff.AUIATUSHG~LE1fIEJHt)H{H{HHt;HkHHuIE9eHL[]A\A]fAUIATUSHG~LE1fIEJHt)H{WH{HHt;HkHHuIE9eHL[]A\A]fATIUSG~21I$HHtH{HCHHuHA9l$L[]A\Htfff.@1uYDATIHULHպSBVHtNHL9`tL:H{Ht:HtH=Hx(HH];HHk1[]A\øATIHULHպSUHtMHL9`tL,:LcHtHK=HxHH:HHkL[]A\E1ff.SH1HH{VHt&HxH9H{9H[9[ff.Ht7HHH1HTHtH@HD1Hf1ff.fHtG t1DHtG t;1DHtuW tnAUIATE1USHG~IfIEJHt)H{H{HHt8HkHHuIE9eHL[]A\A]1ff.@HtuW tnAUIATE1USHG~IfIEJHt)H{H{HHt8HkHHuIE9eHL[]A\A]1ff.@HtG tk1DAWAVAUATUSHG tWH1DD$AIIHt:HøfH9~3HHHuL藌HH[]A\A]A^A_D1@HH1 fDLI9~0LeHHMuEu[T$H޿@語HLe뒐AT$HHL$H*|HL$HH9\IHT$H޿*OHf.AWAVAUE1ATUSH8HO HH|$ t$,(SIŅ7HD$AAHD$DHD$ HL$HH,H1f11'>IHUHwHAH}11=H¾Mt A?HG:Ft2zFt)zFt H׉t$(HT$8t$(HT$DfD9HD$IcLHT$L1AD[%6A?HT$t2At&AtLHT$E8HT$fDAIcA^AD]AFHcHLAD=HEHHT$5HT$1:t$ztztH7HT$؍XHAD L;}tLHT$4HT$Hs4HmHcDsHD$HH}?H}E@50L}A7@@@*HUH( @AA fDLHT$7HT$pfDED9}LIcHT$ HT$I6A^ L;}L3f.MA?AA bDC/HdAL%/IDH}/IAu ,HL$ HD$IcHT$HD$9AE9E)LACt4Hc HT$IŋD$,AD)AD-uNH8L[]A\A]A^A_D F1fL 1ҍFL-LH2I뚽wf.HtG t1f1ff.fHtG tfD1ff.fAWAVAUATUSHHCAԋW Ht$H<$GE11fDH$HJHu3+HI@IHHKHMuKHHtSLsMtLEu/4HxLIH1LHHH5KHL0HHuH$ID9hXHtCH}tH1躘HHt*Ht$He|HH誅HH[]A\A]A^A_ÿ1HҿH1ff.AWAVAUATUS1H(dH%(HD$1HDG EI1IwIE1HHD$~]HD$HJHt5H{LL觤H{IHt/L{HHuHD$ID9pHD$ @ H|$HD$P t H|$1|HH|$1HyHH/H|$HL$dH3 %(HH([]A\A]A^A_ÅtcH|$uH|$1H5H릅zH|$|HʵHt 8d|$~ fEO=H`H1fDAWAVAUATUS1H(L$ dH%(HD$1HDG EH1AE1GHIƅ~NIJHt0@H{DHOH{IHt-L{HHuIE9nL$ AF ˁ txLEAV tL 1zHL1HHHK-LHL$dH3 %(HH([]A\A]A^A_Åt[LAu1H5CL\H묅uH|$YzHHt 8p|$~ fE[IHH 0f.AW1IAVL5AUATUSHXHt$HT$(L$dH<%(H|$H1}HD$@E1E11D$HD$;ƃ@<$EA9L$rEit$-{uPu4AD@<}@u <w/E11Jf.ADtƒ <vHD$(H|$HdH3<%(iHX[]A\A]A^A_@=9*~_A4tE1HD$1HL$@LLd$@H)Hq.HGHuf@ǃ"@@`9 "u$u A|(=T8*~ZA4t!HD$LL$@1LHL$@H)LL$H-H"HuDAfA|{S1A|( Ht$ L1҉\$tR\y,=2*SADHcT$dI4>uH5L0HL)1LHHD$@D$HT$sLHHD$8}HD$08~H|$8Ht$h7%ÉD$0HD$HD$pHt$0H Ju+ FDB#H|$01Ht$pHú ^%;"HD$(Ll$pM AE<.tAA}.! HD$p8;"Ht$L)H)Ht$D9{sHt$@LT$h)D$~#H\$8<0$ t<-u {0 D$1Ƀ|$HD$09L$0@0  D$t$9t$@~\$H9\$  D$HL;T$(]HTHMHLH9D$(HD$(L)HH1H)HH?HH1H)HHHHH9JX9zLT$H1LT$HIHD$xMHD$@L|$XLd$HMLt$PI)))Hc݃H|$M||$g(HD$xHtD @IH|$xM>HL)I9MHMyL9d$(MLL9d$(ALd$HLt$PL|$XIDH|$8/ H|$0% MHT$HH$H)1#HT$dHT$dt@z=-*|$d~pLcǺK4ADtT$d3HT$1HH$L)#HTD$dH$PT$d@T$dH5m1)"H1xDH|$8H|$0HcD$`A|CLLL"HxoLHHHD$H@HD$xHt$,LHD$xHDŽ$HD$T$x1LA謈HHqL|$8IH$HD$0@H@=,*HcT$xH=I4Hˉ\$xDEOHT$Ht$,LHT$xLAHHIMLLHcLDDD$(ApDD$ cHT$(LcD$ IDJH<1DHI H HJI9uJLHD$ /HD$ IMD$xX\$xHD$HL$01H$H)H Hs\$xH\$xD$xH$X\$xL|$8H|$LLHHD$~I9tLHcD$`I|HO?F`H|$HHHD$H9#HjDLc|$dHkWT$dDfHt$8DBd~ED$D$MfDVIHcD$ I\HHHx%HHZHIED$`)HDIEfHL)I9HcLd$HLt$PL|$XHf=)Ն LE15fDL$H|$@E1H HD$xI@LHD$xIH5<1L|$L|$8{HH1sHfHL$H LE1 fHD$0@t<. HD$0LhLl$pAHM"<%1E1,1L;T$(@Hl-HLH9D$(HD$8D$DHD$0HD$(1"L;T$(HHH9/|$L$H4L$@D$AMLt$PH$LLd$HL|$X1H5WHHH1ZrL H|$8H|$0A}.A}{Ht$pI}1ɺ DD$PDD$PHHD$pD$HD$vHcLd$HLt$PL|$XH|$t@-uHD$0x0  |$9L$@ ЉL$HgH?H6)u ff.@9uAWAAVAUATUHSHHL$t$,0A9DD$IUIcD|$EEHL$0D$<D$D$;HcD$IHDLHD$ LLT$bENLT$D9AMcf.J|EE1HtCAt;8@4H@8u@t AuA9IAAD9E|$9|$,D$;t D9 D|$D;t$zADL$(E)L$A~McHcLHt$0IHD$ LH011B0HHD$LT$ILL>LE|IcLHI`!LL{DL$(HfA t$1L$DDL$HIDL$AD}DL$LDL$LADHcD${HILI<T,LfTDL$D9EuD$<}LXA\HHL[]A\A]A^A_EDAc1@HD$ LHD$0DL$M4L HxtLHIL11Lt$UH|$IDL$DL$|$9|$,„T$;t~D9tyDt$D$Hct$LDL$(L$a{D$<DL$(If0L$HcHHt7Hc11H<EL1DA\D|$ H?11@ATUHS~HwNH1ɉھ1H}IHt H@HHCH;HuLe[1]A\@sH}HcH zAVHs AUL5u)ATL-)UL%)SH-T).)H)H(H})H6)H#)) L5)L-N)L%W)H-)҆)[]A\A]A^ÐHHt5u,<&t,HHHt@t<\uHBHHu1@O 1ÐAUATUHSHdH%(HD$1)D$D$~CLcNl'A}[t+AE<{<$)t B|%(Ld$1HLJ"1fpLHJ~991HT$dH3%(H[]A\A]B|%$hJ|%}uEHu(AEBfDJ|']QEH닐J|%)1EHu!B|%!mff.fUHXSHhdH%(H$X1HHq-)Ƅ$WIپHA1NH$XdH3%(u Hh[]ff.H H= )H)HH"* f.*1))HHW"*}){)f.b)|*HHAH=,)&)@*H!*H=קHSH5jH=X.H= H=` H=uH1.H=f H=9 Ht8Hu [f.HtHlT)[*f.He*H@HcHtHv-;*HDS&HtQH8t1@HH<u=)Ht!= *9|[D1ۉ[f.{[USHdH%(H$1*6x*1H$dH3 %(HĨ[]fH9>*HH޿u 8Ht.=*HW***{D1AH|x !뱋}gH51HHHH1QRf* 1SH=H HHt8u 1H[fHttO=0*9~ F*t6HV* *H=D$ * D$ fHV)*f.AH^qefUSHH)uYHH=Ww9-#( HIHA[1]XHH1[]H=)\)ff.AVAUATUSH=;))*})t t`L-u HWIIHH(H5)LcH LH LH|=HMSM$HHH H1ZYIT$HKHIP MtNL#)tFH1?[]A\A]A^f*H*4*w)u[]A\A]A^fDLcJL5\tPLc 1A};IHL-O | HLD@B|5\L-DAWAVAAUATUHSH*t ? et/HtH8E8uH=#)t s*XfDH:H8E8uHu_HtHr)1A =ff)HLAEوHz)BD" uju}H9k)MIHS)ILL8@ t HD$ HD$HtMHL&XtIpLD$D$t1H[]A\A]A^A_L Hx?LHtI@C Et6,*H7** HpfDD$ D$Xff.=q)*~9w)t'M)* ~)% t4H1U3)Hf.Htt t u!HHtt t t#uAUATUSHHD*dH%(HD$1EuI=O(t?t8 z)A8tz5z)@8tnH 8td@8t_Hu@tn)t ;u-DH|$dH3<%(HxH[]A\A]fDHfDHH%AŅtfH $HEucAAEE *HAe]=)H1.YfH$/ExCA*Aԅt uHH=.|)HV1H $H]HH=l1N^H $H p*tEx1*t=K)uH1Wf.Au5*u9u V1H7H<$HWH$ff.H )uHS x)HH=)0eS  Hy HtHH[f.fu F)H)HtHc 3)HHHt )D1fUSHHlxHcH=J)Ht#\t+uO'~"tyHHuH[]Hq't:S"t&tHH9u1DLB@uLA\HSLf.ff.AWIAVIAUE1ATUSH( )dH%(HD$1uL-)Hݳ)L1cIMt 1LHHFHxHHHD$H)HtH|$ЅH)HtH|$Ѕ%*H1LHHHD$HT$IHE)A|,HcHcHHIFIcI<,L7HOMt)t0L-)HL$dH3 %(LukH([]A\A]A^A_L-)HH\$5fD56*H|$HHH|$H&fDAWAVAUATAUHSHuy HT$4HT$HtX}~ILHAAL9LGHAHD<"H<'tR(H5)HHE1IHL|HcjAuH@LILu@\A$\EIT$AD$:LE1|H5HLcHcHHH/EtBD-HHĨ[]À{Ht{uHSCHHHT7AV$AUATUHSHH*H1Htrȅ)uY;.u{tNH=ǮHHI[LIPLIHt H3LeL'[1]A\A]A^@H@HxHIH1LD5D):)IID5+)HtZLLCIHt8uMLLJ`H)HDLhHLULeff.@UHcHSHHH9tHKHxHHHHH[]f.U1SHHHTH߉H[]ÐATUSHH=V)HtH8)<`x<$H߉-))HxHHH1H=)H-)Ht9HaH\H9#3@ @ L%k2H-)HCH9s@ @ H@tL'HtH-h)H9H{HH)<)< < H5@H)HH8HHxt)H)^)'ʙ)At'g)/H)HHc)He)Hg)e)?)e))tMH)L=r)L5c)L-)D%)-d))H[]A\A]A^A_fDHHj)AVAUATUS )It ) )Y)Hh1H80HcHH<uH,Lhf.HEH8)HHH8)H)I*@I6I˖)H4HcHI>5)Hcʃ9|ʃ Hlj5)Hc )H)QfDLc-)L%)H-k)5Hc )HtHHXLL)Hu[H]A\A]A^HH,I9-)H-)u"Hc5)H tH7H-ؕ)LL%n)Lc\)fD1[H]A\A]A^fHcH\HHxGHHHy[H]A\A]A^DH=i)HY)K)=)HSf.HATL%)H)HUH-)SH>)H7)HH9)H^)t, L%[)H-D)H)[]A\?ּ@ATL%')H0UH-)SH)H )H)虼L%)H-۞)H)[]A\ff.@?D*DATL%)H UH-)SH@)H)Hn)L%r)H-[)H)[]A\ff.@?DATL%7)HUH-)SHН)H)H)詻L%)H-)H)[]A\ff.@?DATL%ǝ)HP UH-)SH`)H)H)9L%)H-{)H4)[]A\ff.@?DATHGUL%O)SH-7)H)H9)H)ɺL%")H- )HĜ)[]A\ff.@?D )AVL5)AUL-Ȝ)ATL%)UH-)SHߜ)HԜ)HEH)H)HH5)HkHW))L5e)L-N)L%)H-0)tHm)[]A\A]A^@HQ)[]A\A]A^H9)H.)]f?fAVH+)AUATUSHcޅt&Hcϐ)SHtH[])A\A]A^@^)IHtHH=ߐ)H-)H9t HtHtHL1HHNj)Hx`HHHH{)xIHcMc5HIHH])`C4*CD4I9tHhLIHa)H9tDH)kHxHIHL%)L%)@[1]Hď)A\A]A^p)ff.@= )Su )H(H=H\)H\)GH\)[ATAUS);)}AH )Hc< t/< t+D< t< tELU)L)P*=\t[1]A\\@\DÉ>[]A\ÐBC5)H=)ډ)QHH{HQu ])H*]*z[?]A\fHH=HHH=̧HaHH=謧HHH=茧HHH=lHQATUSH)HH=)HtUI)Љ)$uELeҌ)<{uŌ)HcLdLqHxؽLH H=)HH)Ht RH)HcY)HZ)HHtgHcC)HHtWHHxiHË4)tD&)Hc )HcH߈H)HHʃtTH2i-)H[]A\Hcы)Hҋ)HH4H;H[-)]A\f.C{H2H\}fƐAWH5ǬAVI&AUI&ATUSH(dH%(H$1Ld$GHD$HqfHT$L^HCT$1tf.À #tLcù H=K4/0BD L$@xHcDHc< ]<#UQHcAH< wIs9tAI4 LA)ȹIcH=Ċ)Š)Ƅ,W9#L H!%tDHJHDщ@HL)HjH Lc])L ^)AHN D)sw@ktA@KHcKDDHIAIaHAEIHxHHItHtHLH)T H)Hpfp H=)Ѓ))Ɖ5o)>Hg)H|$H$dH3%(H([]A\A]A^A_K| ufDH< t< t< v@Hf.H< wIsAALLIHsӄ< v:SHcAӄH< wIs2ALfLCIsHz@HH=z`Ht#HH=+)t†)HDH=,HuH}ff.AWAVAUATUSHH/)gIAHtHH )A$))@u݆)I #)A<$h)LD$HE111HD$,fDH9)J0IcAHH9-)*D$L4t%H)H4A8$uHT$LuAED9AHDH{hHc=)HÅ~*H5)O1@HHHHPH9uHHHʅ))HtYHc)HHtIH{HxHc)Hc=)HËw)HH߈Ht)H4-R)HH[]A\A]A^A_EnIcH^{e)BH )1)@H1laH5-) {H=)OD1Hff.Su)t3;u)|+H)^([H&)H'H)1D9fHu?(x=)1)vHDŽ)(H)1H);)(| .)u9~(H=])Ht8HǶH=H);HL)H1)H)1H1DSH )H=))H=+)1ҾoH9)r)t HtHH5T) [ff.H)u) Z)thHȘ)[1H@UHcSHHDEA t A HcD;EHA tA tA""HcЉD\t[9t1Hc tȃ\tB9tT HuH[]ÉDuXHcЉ1t߃\uPHcʀ< t4Hcu붉MA"tA'uAtK@뎺H501HH1llH51HډH1@@fDH5)H 1HHHufHtHuff.fAW$AVAUATIUSHHH{HDpA(CA{$E1A$HlD$(5n)HAH8uHHE1AHI,$5 i)}.u }H=8HHILHHIHHH|/Q)D}AG<vA8"D8AH3M4$H'HD[]A\A]A^A_D$)A$fDH Hx臰HHH1H:HD$HdH|$A &I$8 EHHH|$-Hĉ)I,$H8H=)UH5 E1H_)A fA9N AA9@Au9$tD$LcT$EN HAЅuAHH/)D;~u+$E1A~fDAe`H HrHHH߉AƅN$A`#@HHE1:A$}A$fDLHIǃpLMcHcIB8/BD8w |)t|)HIHHLLI1MA MM@LH]DE"DHAJHBحI$@LH߈$ $fAWAVAUATAUHSH8dH%(HD$(1H= |)HHS)H{)HtH9tH{)HtH{)H{)1H=5{)Hs{)1Ҁ8oS H=,|)R{)Ht,H|)H9?+{)K}~ H)D=z)HxE%耬HIHL%{)D5()L%z)EtD-)E LH=z)z)Ht L%z)LHxLHHCD%tz)HUz)HFz)4z)E+]z)Gz)H=\z)>)4H)()Hz)H9 Hz y)Hxt =?) HHHx?HHHqHHy)Hy)D)vy)Et!D)Eu1HHy)@H=\H= y)?z)H y)x)x)Ht1H=x)Hx)HtYHx)Dx)iZD5x)D=(E9jHcx)Lx)IHD$IcH@HH(AH0D5Ax)E9(H{tCtL+Et2AA8EuHT$LLDL$LD$LD$DL$uLAD5w).Hx蕩LHIjfLc-w)Lw)L5w)MM/Hcw)HIHH tw)Et/A8uHLLLD$HL$/HL$LD$uHHL$HxHL$HIHfUw)v)D 0w)EEHcv)H w)PHH8v)H=w)HuCWH=v)Hcv)Pv)Hw)H"=h)"DA@McJ4A9 't@\u=)Af1A9AAvL)H="r)ADAvH_)H=q)A롐HT$LT$ 1LL)LT$$H)H=q)H@AHT$LT$ 1LL)LT$Hs~d)H=qq)H AHD$HL$1L|$ H)HHsHfDL|$ Af.LT$A)H=p)LT$ LT$A)H=p)LT$ tvfDr)1}fDHD$ L=}HD$LD"=)DA@D9~`H=H=j)$H5j)1H=)uHHtH(HhHc=0)H$ H=uHHtH(\(Ll$Lױ H5tHL9H=t]1HtHPH9t HxH=t8HtCHxHt$%t1HD$9~)t$)p)9|ty^)fDH=.tDH=0t8(Mt|t1lK1X@kfD)CATD%)UHSHc)H论A9t)9)~Hh))< t< u []A\)[]A\)[1]A\(USHH=h)Ht5HHJBHHHtHBH1[]fH[]ff.@HH=!h)AHtH1HHÐHH=g),HtH1H[HÐATD%)U-d)Su'Åt A)-j)D) -3)v[]A\ff.@xHS )5)9u=(t1[DX=(u)[)1 ff.xXS)|5)9u=()t!1[X=(l)u߉T)1[9fUSHHH?u'H;1<HtHH[]DHH[]"fHu$H5H&( H阪H5pH=p蝼H5@H5ִ(t>(:H "'@><=H@;|&(fP Hrh)Hff.fATD%G(UStkH p.(Hh)5}\)H-&h)uHH9-*)@HoH…8t0D[]A\Hó(Hg)fDH船HcH|HŅHg)HtH<@tHuH=pg) D[H-`g)]A\@tD芍(:H "'@><=H0@;|&(fP [Hf)]DA\f.@H5f)Hx=AATUSHDZ)dH%(HD$1Et HD$dH3%(jH[]A\H=aH5H=-nHJc)H+)Hc)H ,)Hnc)HmH))cH5H=mKH5/H=m3H5gH=mH5H=mH5H=mH5/H=mӦH57H=m軦H5H=m裦H5 SH=m苦H5H=msH5H=m[H5_H=mCH-,H=mH(H5H=mH5H=mH5uLAH=zR)9HcЀ<H=o\T$HH=@R)T$B /BD/&|u >W{u $I։T$i_T$H=Q)BP)Ic< t< [AD$H@AH t tHW]DH=O)DAĉD$ 1Ed$IL…SD$ Dt$ L$ |$Mxt]L$ u9D$|ODL$ D9L$9D$E(;\$ uL$9L$u EA8`D$$MLԠ|$$pH5HomH‹D$$u R)H@b@EBD/H=\kH=N)T$HB/MH=X:H{H=jN)MB/<<Hw(A@D$ e;\$L$}|$ 9q}u A@@A?EAńqEs@jH M)HcD)D$$T$et$H=M)H"D$1…`fDD$|$t ;\$ M|$!t$ 9AtN;\$H5L)Hc   5M`:=)'D$ DHL)HcD$<D<  < D$$D$D9EA8D$Dt$ L$HLLD$$DVnD$HE)D9tM;\$ ^VHLrD$$D$LD$$11HH=XmHfE)늋L$ 9L$$H=UT$&T$HuA?EEHL΢gjHD$E1rHT$AHrD$f.AVAUATUSuPHH=.B)Ht\H脟HxsHHH-1HA)H)؉A)VfD+HHLc-A)H]EtCL5A)E&D:#t_HmH]HuHH]HtD:#uLHL耜uHHxKsHHH}[H]A\A]A^ÐIcHLBuǦ[H]A\A]A^ff.USHuRHH=A)Ht>HfHxrHHHH-@)H)@)f.HHtSHc@)H+tH=@)E8uH莛uHHxYrHHH苛HH[]ÐKf.@)HtHL)H L)HK)HK)ff.fSFH=@)H轶H1[ÐAVIAUATUSHdH%(HD$1H=@)Ld$1LLIpÅt$LHHcA:t$t CHAHt:u:1ҍsLL t$LH ?)HHNLH5HlH1HL$dH3 %(u^H[]A\A]A^DH?)1H5T̛LH1HtH貘Huff.@)ATUHSt٩)5é)tH5@HeH.H5d@HIdHL9tL)HtH;tH5'H_H[]A\7@"t@'E@鐔HHt1HHHHHuff.1HtDH?Hu@ff.@HtHfHHHuH1HfDH@ATUHSH>Ht`HAD8Et0HH;Ht?Et Ht݋C[]A\DHHݜtHH;Hu[]A\SHHt$HF;~u(H9xtHHuH[f.H踙HxnHHTHH[ff.AUIATUSHH>HtnAH^1@A8Et7HH{HtFEt LtH[]A\A]HLݛtHH{HuH[]A\A]ATIUHc)SHcڍ{HcBmI4,HHC[]A\f.AWIHAVIAUATUSHHHt$HT$(L$8肘LHÉʼnD$qAD$$ۉD$<EE1E1E11ۉD$ HcHD$0IcLDeEt>EtT$HD$D8 t}SD9}=AE$HcIcLDeEuMAHHL[]A\A]A^A_fLD\$D)T$EtIclDeD\$IT$@HT$0HHLD$D\$D\$LD$W@D$$tD9}IH|$(t"CH)HHfATHcHTuD$8E1Dl$ A@T$<@AD9}LIckILHxOkLH脔Iff.AWAVIAUAATUSH(H$L$ Ht :2D$1L耖\HcjIHHcD$HD$(fL)E9}VA>HcIlA<MMAMfD9tB<\uAFD9uIFL)MIčE9|9}LHcjIf.T$tD$ L)D$9}?HcMI,7H4$HYHl$MaEH(L[]A\A]A^A_D9}LHc?jIf.zzHDD$fL4$Lu\L賕HAH<$HII(9}4HcLT$I,7LH腒LT$LIcH蒑wD9}LHcLT$riLT$ID$D$ff.HcxD7t< tD7fD< t< uFHyHcD7ff.HHcHH{f.ژ(AUATL%OLUH-(S1H賝IfDM H9(~'IUBu݅u!eH9m(H[]A\A]ÉLFHtЋE߃Eff.@HH5GH5LH=ĒH=)HSH=&)ύHH=)躍HH=)襍HlH=(萍H'H=({HH=)fHHt8uiH=(MHHtN8tIH=Y7)HtH7HxfHHӏH=47)H%7)Ht ?g[DH=7)Ht迎HHxNfHH胏H56)H6)HS>JH[=fDH56)H>蝗H5q6)H>mH5A6)H>{=lH56)H?>6 'H55)H>1覐`)[fDH[GH5)Ht8u+HbHu%Hf5)Ht8uHH8uH<5)HuDHH5%5)H>)1HH=9&b1HH=&LHH=&3H֕H=&H轕H=%H褕j$)H+H5T4)HHHD.H=54)SHHtHtJHHxcHH趌H3)H4)Ht8u[1[@>cH3)fATUHSH ;TtrICH~"f&`H0)wMH0)Ht8H=!1H萑HxS )+HQ0)Ht 8H=k!HBHf.)HInH5E1H踊HLHH11#'fDHkfD˓1H5]DIeLHH1-HH= \H= HH= AH=u HHff.AUATAUHH=i SHHHt&tCtPPH=/)Ht?uFA|$HcI^HH~HHtD#HH[]A\A]DxuHcIH9tH胉xHHc]LHHHt+HH[]A\A]fHƹH=B;Gff.fHt?t DHt1f.USHHHHH1Dr< EHtt<"t<\uHuHc\HH"#LA"tW\tRLIHA8Ht.ׅt% u\n" HA"HtEHuҺ"fH[]\H뮿}\HH"ҿif.AWIAVAUATAULSHc)߃H(HcL$ dH%(HD$1\\$IA9?f.KAƉL$A ALHc\$HD9|IcL _F)ukA}u4HtEHT$dH3%(LH([]A\A]A^A_fLHT$DLHՃIHtD$E@E)u&LH5u1HtDuzfHt$LD$H3@L{INjD$ID L$ MH5@HIؿ1蛌L3두E1蓆USHH(Ht8H+f=&)H҃0iuHtH;HuH1[]DH[]ff.H跑Ht8t HH舂Z.fHÐH=(UHHS1HdH%(H$1H{x?D$%=@t*1HtDH2ڃ@DH$dH3 %(u+HĨ[]fHuUSHH0t<@u 1҃t#tH裄Hx YHH?HHH[]fH1H[]@AVAUI͋ (ATIUHSӅu >~Zd))H1L[HHAAtKuPAA@tA@uAAA AE $AH1薀[H]A\A]A^f.A<$.Mf1LH=QL·()H1LZHHAM9CL,6tH={()Ed uE`A@L[H]A\A]A^At5Dtf1L֑()IƅM8.D%H=')HtH')1H>IH~HxVHHH')!ff.AWAVAUAATIUHSHdH%(H$19')ĊHc؅Ht}uNLHx]VLHHH$dH3 %(HH[]A\A]A^A_Lt$ H5ZH&)L謅yHD$(HD$ HD$|D$HD$f"") ")Ht$HGIHtoLLDHLH}Ht>Hfu"H=#&)H}H}Hc\$|`H%)HA HuMH%)fDC:fD=:!)DLuH^H=n%)1|H\%)@Zf.USHH=+HpHtHpHt>u&HHxETHHz}H[]HH[]`Sèt |1[HHff.HHfD$"f@fAWAVAAUATUHH=*SHoHH@*AH與DD$ HE1A$LHJIHt s(t AD$ HL[]A\A]A^A_HAŅt9HE1nH6~HxRHHI{DH蠒IHt&(  #)tLbtHLz苐$HHIhIHLtz-L{AEA8$uHL)t")LHߐLAWAVAUATUSHT$ dH%(H$1H-")tYHc")T$ HHHtDl$ AD-!)H$dH3 %(!H[]A\A]A^A_fHAH!)~*H!)HHBH HHHH9u{!)HLt$ H5H_!)=!)L5 H='vD$HHD$H$4H=!)!)HcL,HHtxH )HHcD$<H4$HIHtkHLDH LI?xMtHc5 )H )V; )eV Hǃ j )jHc5Z )H[ )V;HI )7 ) f.HD$(HD$ f )LjH)/H)DHHH)H@zD7H1ɾ )H)H6)HHH()1HÐAW AVAUATUSH LЉt$11E1xAŅ1Ҿ1x1D +)AH!)tHHHD-)A1IH)LϾLL$5LL$H‹@@EJ@!EHB@c JH &)HH H)H )I$L%)uwH[]A\A]A^A_@L裛H‹@JEHHBH)HH)H)I$L%)Eu~ B tD1XwH1[]A\A]A^A_ 110wAŅ^111wAAŅ@H521xH1H)HHH)H)I$L%)IH)HHH)H)I$L%) |$ ED-)H)1LϾ5Hf)HHHX)@zA  ff.fSHH?Hc!Ht@(@uH;若1[[fAUATUHSHH8dH%(H$(1ILztd޺H1@΀}Åx+H$(dH3 %(H8[]A\A]@s8u˻D$%=tH1l}ÅxL$޿L{u<$%=t)D$%=tLLHH7zH5/1E1JtHDOHc{ ux_H@3 :2HC H1}HH=`4HH1[]A\A]SH5.1sHH10MHL[]A\A]pDH5l.fH5.fH5.f=)|H5Y.H@H{ z(DoDt (u GcIHC LDhMoHg@H[]A\A]D5HI܉{HH=.3H1*DHGL LrHxGLHHJpIfHc{ 5HfUHAWAVAUAATSHHhDgLG dH%(HE1DwGDEAD$SLHMWHMHI 8-u xLHMA6C E9#AtMCsAD$w911Dot# DtfEu <2)uDC H{DdARAH11DGo A A Cƒ((u%A~A @t1ҾD1n@AAwD膩DqDfDE1HudH34%(DFHe[A\A]A^A_]D iAtC Av11Den\ DJBExDEq0)lDEMABMLE+HUH=*SA~lELEHED1LEmLEHEI0HAA@ HHunHuDHcHHMtmHMH9oHEu DUGpH}kH}5kHEUHEA)8DD ](Et=(FLLEJ58(IDžt g(Mz (t L4CH5~h(LEC (UEt A FuLLEMjMAefLs1ɾ )H)LH@DD萦Eu .)uD:D2A[jt Y.)DE{HuLLs@kHMt HEHcH9DЉ)AFv4AAH)1ɾL HfA H)1ɾLHHH9tHH$H9uH HL$Hy Ld$HMILLeHMLq I>kHLEHMHHH%H)HHH9tHH$H9ut H)HLH|$HMHLEI<$I6iHMLEDa@hHEuL1VrHEy*u% )u[ )uI蜙HE븅 LMgM HED@밐= )UL <LM_gM ACAED+)u 1MaMCtA9tDMjM A AAt As A9tAD$σkA AAAj{fDqfDLM=fMDA9GA bHEH}U9HEUH}116pE DjH}jfF H}eCAAtBCucuU9u7ҸDuL1[mHE f.H}Hbf*fD} 11dAƅHEH5< 1DDEeH1<}tgDE')E.AfDA.D1dD 1D1cAƅbH51DDEdH1蓾DEm&)EHC1HHAąHD~f11D__DDDH]D1M$_Mn1EM]H51DDE_H1貹MaDE!)E11D^HE~\3]HEDEaDED.!Lq\A_a\DuE1HGWHP({@}aHE )DEHE}DDE`DEDE`}`DEH}ذH}O^HE8uHE}HEH}^H}臰HEϋU=`U H5DHM]EHMHEH5D\EHEE\H}Up]H}U]AHX1H AąH6P]Lu}Am_H}dZA0LuH}AZH}CZD;_AUSHHtEH=%(HtۯH(H=(tHt@HuHHuH1[]fH߉D$ D$ H[]1HteAGu*OwwLH‰Tu6 tfDH?Hu@"t1҅Df.DSH=6a(A+a(~kH5$a(L1LRIHN0IH0HcHH~MtH6I0MDHL9uԉx IHC1 [L1ݐSH=`(MA`(~sH5`(L1L RIHN0IH0HcHH~MtFuH6I0MDHL9uΉx IHC1 [fL1fSH=`(@_(~sH5_(L1L RIHN0IH0HcHH~MtFtH6I0MDHL9uΉx IHC1 [fL1fSH=f_( @DZ_(E~QLApH K_(LI|H1HH0HrH9uIcID@ HHC1 [HE1AUIATUSHH=WJ(L%ZJ(1LHcHkHxuHT?LHJ(H8H@H2HHHqH9uHcH׉h HIE1AM H[]A\A]D11>HfAWAVAUATUSHH|$H1H8IAuDIIcIFD{I|u{>IH1H$IH(HtHXHx3-HHhVHIEH,HH9$uLHHD$LE} E}LhPUH[]A\A]A^A_@HD$H@H1[]A\A]A^A_f.E1=IHff.ATUHS 1I=LL H@GC 1H][M ]A\ff.@USH1H\=H=eM(H8HjGE 1Hk H[]UH1SH=H1HHt H"G‰S 1SH]M0H[]fUSH1H<HHEHFE 1Hk H[]DUSH1H<HdcHEHFE 1Hk H[]DSH=H=H=H=H=H=t H([ÐAWAVI1AUIATEUDSHcHH=7H8L$ dH%(HD$(1[rHt @tH(LD;U1HMtA}tA}fDD;H\$ HH=HyHt @tH(Hc=)H޺ jH=H[yHtf@taH(Hc=c)H޺ 9H=mH*yHtH(G(HD$(dH3%(DH8[]A\A]A^A_@Hc=9c)H޺ H=HxHt@uEuH=RGHP(1LH7Hc|$ H޺ `(nH=H_xCf.MA}A}|A}lL4TH\@P(eHX@LPH(H= nTf.AVIAUIATUDSHgj1HjLIRj1HjLI$I9j1HjIIHt$~ODE @D9t;HHuH=HiH1jjIEL[]A\A]A^f.H{HtHff.fUSHH=(ueHHtHOHH9K(U(%@`)uYH)HtM5`)HH(HHH[]d@HtHtM8(HDRHx&HHOHHt(H[H]fDttH=\)HtH(HyqM'tH"tCHhyDHOd5_)H(HH(f:Mu}uH+H(Tff.AW1AVAUATUSH(H|$H1H8IǽuHIcHEDcI|u{6IH1HD$IH0HHt$PHx3%MuHt$HbNIHIH9\$uIEEe H(HD$L(H([]A\A]A^A_f.HD$HH([]A\A]A^A_D1E15Iff.HH5A[HHff.HH51ZH1HÐHH5YHx1HÐHH5YHX1HÐAWAVAUATAUSHH|$tE1AGdd=D(5IHcD(ƒHcډH)HL, @HI9tyH(HHttD9`uH@HpHH4$OHxg#H4$IHLH5`LTHtIcG I7HxA L4I9uHD$L8H1[]A\A]A^A_ff.fHff.H1Hff.HXAWHIAVAUATUSHHt$6@"fD<&8HHHt@t<\uHAHHuHD$H$L,$E1@!AU3Aw HŅAE1DIJH$ALh H|$&H$0A}(H$ALhE12Ll$HAG L,$HcU HEHMf.SHW[fUSHHHoHt0t4t HHHCH[]fH}HDH};uff.@AWAVAUATUHSHHƒtHL{MA 0HLkIIH{8E1AU Ic1E1HD$@A8EHA9] ~.IUH,EuHIIcHAH,A9] IEg McJMtL|GHL[]A\A]A^A_f.HS xxH\JAM A*IAG Hf1fDHT$LHDD$GDD$HDD$IHxPHHGDD$HAE E1IAG Hf.AVAKf.HtH?tG t 1Hff.HAWAVAUATIUSH8xA.I$IHtuI|$AAF1L,fIlHtHHHx5HHjFHIH,HI9uAVIHEw HHL[]A\A]A^A_.fDHE1HXHHxHHEHIHAG H@fAVAUATIUSH1.e@À Ax @ǀT$ X@9t [H]A\A]A^@H=G(dIH1H0LH-f.LH=6G(!IHHH0LH-fDLH=F(IHHHZ0LH?-jfDLH=6F(IHIHH0LH,@3fDLH=E(aIHHH/LH,ÀfDLH=6E(!IHHH/LH,fDLH=D(IHHHZ/LH?,fDLH=6D(IHmHH/LH+WfDLH=C(aIH6HH.LH+  fDLH=6C(!IHHH.LH+@fDLH=B(IHHHZ.LH?+ǀfDLH=6B(IHHH.LH*{LH=A(aIH]HH-LH*GLH=6A(!IH)HH-LH*LH=@(IHHHZ-LH?*LH=6@(IHHH-LH) LH=?(aIHHH,LH)wLH=6?(!IHYHH,LH)CfDH5YiL HI6HHIX,LHm2L5)H5EL HIHHI,LH)2L(@H5>L HIHHI+LH1L(H5*LB HIgHHI+LH1Lf(QH5áL HI HHIB+LHW1L( D-7(LJO)]HEuHu=(u (HHHI*HH0L'[H]A\A]A^AWAVAUATEUSHHXHHt$HHT$LL$(dH%(H$H1UH{It^1&H{1IVH'M)IEH9HtH/AEAE LL*LI&(Lk MA}}L?HLE1jE11҉`AZA[IHHH8RLI譑L1L4$迤x7%H|$IZIH> 1ɀ8t'xtxtHY?H<$ L $HcE1H\$0l$8LEDd$@MHL$L|$ fDAEA8M$$Mt-ID$L8uMHEM$$IcAL1IAHcքM$< u5DHcՉM$A$t< ti<\uA| uۍifDLAuHIcE V9IUpAu H A$< HcfDHAD.< tHcքZIcU IELHU6LLj#LIO H{@aH$HtHSHD$ HtH6HD$(HtL$D$0UHsPHtFMSI?t7AO t/HT$L1HL9tI?Ht5LI5Hs(HS0HL#IHCM AW uH$HdH3 %(L!HX[]A\A]A^A_fLHL$pIcE HL$bfH{8D$0D$HC@D$0D$HmH{8fHfLE1+Hs(HS0HHHCfE1P HH@ IE>Dd$H|$P(P(Dt$LhAMEAuhH=f|lDd$D$Jf.LH@ H3H{Ht$HI%f.HKH4$HMD$XH$D$\f;Ht$ H@ HALHHC HI(HpLA-1A_H=m(HP(H=IP(\kD$/H|$8·L2H1ILINH=I$AEAD$AD$ jLLeLIJHC@D$0fL21H<$IAF 1HDHcUH5d14LH1@KmHC@D$0D$DIAF 1H蟆f.H=iDd$Dt$DHC@Dd$D$04DAWEAVAAUIATIUSLH(Hl$hHH}H9Ht H$5H$HHEBIEDHL>)LLL>)H>)HH->)L\$LT$H$L%l>)L-u>)L\$HLT$HL$`HD$H$LA>)L/>)H8>) UHD$H([]A\A]A^A_1ff.@t5((@ t5(@t )٣(t )(ff.Ht'HGtHcH Hw@HcH!HwH=q=)HuAWIAVAAUATU!SHHHL$Ll$0Ld$,LD$dH%(HD$81HD$(D$(HD$0HD$-t^yuHL$dH3 %(H[HHHH$H~GHc P(H9HN‰=(1DH= udDH51eHSHH:&((Kff.SHHdH%(HD$1HtHGHtH0>-t^yuHL$dH3 %(H[HHHH$H~GHc P(H9HN‰9(1DH= udDH51eHSHH:&((Kf.USHau5H+)Ht.HCH(HR#Ht%H-(H;H[]H[]@H fAVAUATIUSHdH%(HD$1HtHGHt H0>-H=6'HHt@(HhH=HHt @(toHXH= Ht*@(t$LhMtAMtHtSuAHT$dH3%(DH[]A\A]A^fD1@1hfH=)"耀ALAąL5n))MH\EQIFHH8H4$L趲HIH$Hp裲HHH$Hp萲MHHHILH5j17"fA1L;H߾H+H+H5HHDHHDH1H!vIFAH8ZSHH=(Ht;H(H[UHSHHHH=-x (HD1Hb71Ht?@(ƒuAu1O (t't HھH=V8*1$ (H[]H[]fAUATA1USHH-(HEH=8D- (n1H= HI6Ht @(EEu (t @(u|@HDHt(H9-(tHH[]A\A]f.n(EH[]A\A]H1FH=fDLH=) (eDH=Hff.AVAUAH5(ATUHSHH*"HE1HIH9IMtA<$L<(uTAEH-PIHE,$AE,$1H[]A\A]A^EIċ$tA$H1][]A\A]A^fHLE1BEdHuEu`HH߽[]A\A]A^HcIAtH3H=hlHtHDH=?HtHH50(QHtH= HtHǽJDH߽ff.AWAVAUATUSH(DC(dH%(HD$1EH)((YH5sHWULty~PtJeu]G(ːuKvzHL$dH3 %(+H([]A\A]A^A_fD닐1Yf @1cf5:!)=(E1H-#)Aąt (tA(tu (HH}HEH8?-u a;u(HEH(HHEAAEt*H IHtHljLP1HD DHHH=H1H9H߉$$mH=zH5HHt*Ht93@H5O1H1HIHH+LH=3sH5HHtHHEPH=ݿ4IH_HEH(HD$D$H$fDLH4$LIH&AHLD$PLILKt|$tLuH=*(HtLpLWff.fATx(E1UHSHʾ(UHHQtbLtPt@t#[]A\@~(@v[]A\fV(AfDH5I(H=2(HuCن(HÆ(tEu[1H9(tHS[]A\x H1HH5ܷ(Ht0HuH=HøHH뛋 M(t11H=ի1SuHtH9{(tHH=A;Hx11H=tf.1ffDAVAUATE1U1SHH#TH5HOtVtJ~pt3vuNu;tH[]A\A]A^@Af{H[]A\A]A^fH)HEu[A AE1fDHCDH8!ŅuEt HCH8ZHAHu1EAf(uH=b_-/HHL`[HU0HID$EHB H=lcHE1 aHH=D$ `D$ H=^.HHL`ZHU0ID$EHB1yH=~c@SaH=(HH1=׃(t3H (Ht9u[H=i(1[HݨDx1H5H=/(پH1ff.H?H6)u ff.@SHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HHھH$H=N($HD$HD$ D$0HD$[ H5$( :HD$dH3%(u H[,ff.PXH5=1H H1p^qff.SHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$11H5צ H=(H1HHھH$H=($HD$HD$ D$0HD$ H5ˀ( HD$dH3%(u H[ SH(Ht;uJHK)1Hp 3 H=l(HH1H=O([f1H5ѷ H=&(HپH1fHuPSHNH5.H4J1tt1[f.[o[@SH5$yH1U H[H1SH5H1% H[H1wSH5 H1 H[H1GSH5tH1 H[H1SH5H1 H[H1SH5VH1e H[H1S?0Ht+H5R10 HHH=1[{3KHDHu%xuH581 HH51 HSH5H1 H[H1SH5H1u H[H1SH5H1E H[H1USHHHt6HHt^H5a1 HHHH[1]MDHtCH571HHH[1]DH5u1H늺H5]1HSH5ߴH1eH[H1SHt&HH510H[H1f1H5 [H1bfSHt&HH5z1H[H12f1H5T[H1fSH5AH1H[H1S8 u[DH51HMH[H1ff.@S8t.iH5UH1H[H1UD;H5OHf.Χ(Su?ͧ(uJH=nz( (u(u5H=Nz(u:[Ð=(Eo(tfj@[jH=z(tH=y( H=y( [D="(nqHH19H(HHf.(D(Ð(p(t c(fHiH9B(tG(fD7(fDAWAVIAUL-D(ATAUImHSH`fDI}Ht 2IEMIFL8LBHxLHM6IEM IL9tMuIE1L9uuH[]A\A]A^A_ |fH=(VLOH(Et뽉DUSHHHtHHt=HCH8?-tDHuHCH8HtLtSu\)hH;uLH[]u-uHHtHCH8HuH=uH1[]"ggSHdH%(HD$1HtJHGHH8?-tSH;H;$HT$dH3%(H[H!H9(t8(ˀu-uHHtHCH8HuH=ޯ3)Bt~ )fHCH8Ht`@ff.11fDDH=r@vtuf(ATUHSH(HtHSH(11HHݧ(Huy8t H5e'1IHHt}uSHźH51MIHH=v(H¾1 1*fHoHHxFHH{H[H]A\SHH=)(HtwHHxHH;[H(fAWAVAUATAUSHHH|$(a-'D$ H ߍ(DEHHD$0HcHL$DAAt$L$$Dd$HD$l$ HHtt$$t%xtHy؉\$ D$ HH[]A\A]A^A_L`Hl$8Hl$(MKDMwLt MA8uKHcHL!u9DD$uuk\$ M9t&EuL$t%IHHuM?M9uHl$8SfT$ tIE8uHT$0HtM?fD1H=(H5t!Ht$(H1D$ Ht$(H1#VD$ D$ fHSHGH<%uCHPЀ v<<+tX~<-tJ(Lt$EtT$ ub LD$HHtP(D$D$dtKAD !‰S(LnM6fDrts9nt\pl) H9L$dfDuxtrt fD }D p h @X H 8  'fDD$4  |$Af.H9ڸED$ D$ f.Y" H9L$d@D$ t$`E T$41HD$hdH3%(1 DLT$`D(AԃED$eL$ 1LrIMAF(I~Ht t$ \wDd$`HUD$d D R T$ ~1LIM~AF)Lt$E1D$ LqDD$`EADHD$A@ Dƒ T$ v D$ DL$8 LI (DL$8H |$ (x(D$ M11ID$1D$ 1LLt$LaLD$0M6MXDD$0E|$H1t$  LqIH D1LIMMLt$DD$ I~`HI~aHMAE[LHH<$D$(;AL$HcH|IvHHI~LH|tWEl$D$IcMcHItA+LMcNl%H$=8uiAE1H ÅtoHL,$DLIn.fH<$AHc~H|(IvHH\HL1HÅuLLt$HHD$0M6fDH51LH1LD$0M6DT$ ED$e1LLI@A@vD D$ &u AL]IE1MAD$(%=IDD$`A8AL$(EDADDFGȃD$1AL$(A@t ED\$d!1Et E`11At A@@\$`c@ʃDB DAD!ƀAD DL$ DL$`!D߁ |$(@ D$dAL$(T$H4$LD\$8LT$1 FAL$(LT$D\$8t  l$(D$ D\$dՉD$`!AL$(MtAt AD\$dAE!Z(Lf FD$ LIH2MDD$`Lt$E1AD$)1DD$H5ALH1oEI|$DD$Ht DD$ID$E1Ad$(@IHw"fDd$`E1zL(IHcAF)tuEE1MLt$hfLH=2H=fHxHHt%K(LHC M64DE1H5I@LI{fDI|$D$eLALD$HM6@H51uH4$\$`z@H51CLH1LD$H)M6Pt$ LI1ۋl$4@諽u!M6Mt*IFH8D$`u:tIFH8HD$hdH3%( 1@Hx[]A\A]A^A_tD$eu[D$΃D\$dA A@Lp5HD$hdH3%(' Hx1[]A\A]A^A_ǮB,H5)1H10LfDM1Lt$t$ D Ή!LLHD$)LT$IMMԋt(A9B,7D$dAL$(@YM@T$H4$AE[LD\$8LT$,AELT$HID\$8xAL$(1.@D$ ʃDH5Zk8I|$H1DL$8LT$yAL$(LT$DL$8Lt$LHH(M1ID$΃gEoT$H4$LD\$@LT$8LT$8D\$@HAL$(́H<$D\$"D\$\$D$0t(DT$ H5s(D$I<$EHD5s(D$D$ LD\$dD$`kM6H%r(A9D$,&HHSH8HXHtHH{HuH!G@ʃDLDL$8DL$8Hm|$bs(x(sDL$4EHsL6H|$HD$HLDD$@t$8D\$(LT$ 菋LT$ D\$(H(Iċt$8DD$@ʃDH$'D$8.H<$tIt>DL$\DD$[T$TL$PD\$LLT$@DL$\DD$[T$TL$PD\$LLT$@|$8+2t$("( H$H|)D ʉ1AL$(l$ @I<$H5wD$HDL$8LDL$8HDL$8H|$)r(H(o΃1QDl$LT$D\$A @40;H $ELf(HL1AL$(LT$D\$(uH$H1|)|$8+~t$(11t$4@謵7I<$D\$L$L$D\$HMl$ML HxtLHHL$D\$I<$1HD\$L$AT$(L$DH,D\$ P(EɉP(~ P(HD\$L$iD\$L$AL$( ݉D$dAL$(ET$H4$LD\$ LT$8D\$ HAL$(LT$8\$ 9LDD$@t$8D\$(LT$ 蕇DD$@t$8H(ID\$(LT$ ʃDH5ݖVMD$ 1IĉH(D$H$D1LAL$(LT$D\$T$H4$LD\$@LT$8'LT$8D\$@HHD$Ht@( H@HD$H=fHD$ Ht@(H@HD$ H|$11ADž(HÉ+D$ t 8t H|$'D$ Dt$ At2H$dH3 %(iH[]A\A]A^A_fK8D!LpH@HD$(fLhHD$fHD$ fH$ƿLD$ D$<H'HD$@$%=@|$ yH5/=}H$H_=u HgH$1DLcLD$P0D0HD$Ht$Xt$XHT$HLD$P2H$MHLD$`Ht$hLD$`HL9E11H\$pHt$hHl$x\$(H=>(H=>(qH==o(`H=S(OH=S(>A$:o(1H=1H=(=(H-0(Ht-HSHx躝HHH=H1.H=7 11MttGEu"u/t r(H[]A\A]Ѓ7=(t蹵H= 1LEtH=j(f.H=<(f.H=Y11P:#H=L13ff.=e<(t1Ã=m(u(uH(8uރ?uSH1!t1[ÿBuyH{uHCHxu1C[D?tfDHWB- wSHHzRtHCH@H@H@@[fH=(uIu+l(HfDtH=MwHf.AVAUATAUHSHHt$H\$0DAT$HwdH%(H$1SH߃5l(11H8D + E:(=Ʌ(0D$ D$$u ( Ht$H1> I HD$0HD$H(8tHD$(f(D$$H=7vf(uND$ FD$$H$dH3 %(2H[]A\A]A^-:(*@&k(u9(9(E); fD1H=(ÅD$ c~Q8uLD`Q(Et'D@O(EtH=du/%O(DD$ 1ɉH=7u!=uID$ uD 9(E"=P(H=9(D$$H8(Q 8(D$$fHi(HVH;'t H;b'@=(0B8("D$ w(f.HD$(HH=;tHD$(Ht H=tzD (D$$(EHt$1ҿ7cfH7(HD$(HLD$HD$(8tF1H5sHt$H1D$ (D$$U K Ht8uHD$(HL$H@H@H8uHD$(HH@H@H0o +H=sHH=H1Ht$(H=1H6(ރ(t5:L(t HD$(HH|$(7HD$(H@HD$(H@@=6(u(tH(8u HD$(8tdH|$(I1TD$$H|$(.HH=?r D$ 8uH|$(tHD$(HxuHD$(@uHD$(H@HxqHD$(H@Hx]HD$(H@H@H8FHD$(H@H@x/HD$(H@H@xHD$(H@LhA}=/5(t=b5(u9M(I} K= 5(It==5(u-M(Mte1L1AƅxIL 1gHIHYHxHHH&z(EF諪HHË5{/(t y|(f|(T/( 'thHLL+E7tGL ;18H5sk1HcHL~H1讫LE1C{(.( =(tMtLVHtH9JD(tH@K#{.( -':D1ıHC(I>1I>H臶Iq1WI>{:HL2wI`HxǍLHHI>tGNI.1H5iIHL~H10I>褭l.-(t\^(P z(M^(t f.HH=}i H={iHfD ,(SH](HH<H9H9H;ѥ''|o,(HHD(AHBH41'uEt1ɃHH9t!HHHtRu̹HH9uߺH5ht*t=J(u_HuZi(YH5h1EH=~+(H1+(t1vH\(H\([D]x(ff.fSHHtHGHtH0>-tJP+(t0J+(HhuWH=*(1脿H=*(hH[?H=au<[DH5g1=HHHHtHWHtH2>-tG*(u-H5{g1H1HHfDHH@H=1a€u@A(A(ff.@AWAVAUATUSHH>HH|uW(]uv(+(9HHcH<u3t/HHcʼnH)HH9H<tD?IIA-DA0< LڴLc&Hcf.H݃tI܉H0D:>uLL,uH[]A\A]A^A_=V(+(9HcH<tnHtHfD?1IIA-DHNAEA3 1TAƅxjuFAEffD1oEHfHH|u"Åy,+2%(9N؉Hl lHff.@AWE1AVIAUE1ATE1U1SH8dH%(HD$(1L5Z(LH(Ht!H@H81?-1H藱H5dL`l~LrstnntYDAHL$(dH3 %(D H8[]A\A]A^A_t[euL%G(H(Z(G1HZ(6fAHZ("fDAAbL5(Mt A<$-EE1MwHhWHHIFL(LαHx5LHjHHC讱HxHHJHCMtL#M6IMwIF=H8HmMx״1HIFH8HHHHDH(H Hx臅HHIɰH`L)HHxaLHI蓮HUHuLLI萭HmMHuL|@H{H+HtgH{HtYHHNHuH=$(1LHbMt,A}t%LHHID8 胞LH5aL'AAH;HtAH1Hn1HI<$L1HGHmH<$6H<$HHd1H5@acH1蹠fH{H+Ht?H{Ht1HH&HuAxfD1H5`H1SHu@蓲H$H8H8D [Q(=}(H1 HNHxu)AEuAA)!p(DIHcH$IcHEL)fHH9H<AtA9EMIFH4$DD$ H8DD$ D$IHH@H4$H8tEDD$ AuD (E4|${ErD9|$EHb!(HD$Dt$D|$ Ld$Ld$EDED;|$ jjN(hN(H $IcL4Et45!(IHA_LHx1*IHe_LH1ԵAGEGADADžSD;|$NfD V(L1HFD艵P@:fD=M(EH= (L1MH^@$A|$SME1A}"L cLd$EH\$HðH H|$yMLH|$ H۫H|ALL$ MHHH1H ]ɵH5q]HH=]M(wHt$ H=1dHt$ H=`'1Q11H=vAH|$ Z7(-H=%]AKE rl(91Ƀ=TM(΃)A3E1eEDEǃID$H $IcH<BA@HHfDHH|!AuH5-\1A71HӭLH1AAkExED|$HT$ H=[1<HD$H1Y8H\$ HH H5[1螩HHH1H|$ H_{UD9|$ED|$qHH_11,蹡H|$ߨH|$ Hu n(H|$ HZH-ZHD,Hx}LL$ IHMDD|$D$ H|$ hH|$ >EED|$DD$ D9|$DD$ E9DD|$D$H$IcH<T$EYDD$趖DD$EA1E1Aβ(DD$脖DD$D|$E9/l@1H5YէH1+D|$AD|$AYHAE1AAf.AUAATIUSHdH%(H$1HH$H藪HH肪HH1L譧Å9'H3(HHH@Eur@1D% ''D%'f.1H|H$dH3 %(H[]A\A]D߾脁Åx1H/DtMtcID$H8讝yf1H1nf.1H5:XsH1@+1H5XťH+ff.HHHtHWHtH2>-twњ'tUH轙H=f(Ht(HHu @HHHuHBH8&taH1ٜHH=P€m̸HfD1x@HMHxDATHUSHtHWHtH2>-to'tMH͘ŅHt(A @HHt1HADHu[]A\1[]A\DH=O€u[]A\@HHGWH5EVH1+1H@ATUSHGHH8DH{I3LH5UHH1שHCL9 tLfH9ktHX[1]A\ÐAWAVAUATUSH `'HE1E1E11E1f.H5UHl~5rtXttCpuH[]A\A]A^A_t[duAfDfAuDH5T1hH1输@3yfL-!($@ADH-(HttH=T艖$@Eu^EK.(tMt/L膢HL50bHuF@L@"tlͪLLH1͒DHmHHEL8L,uMuLEt3vtLDD11LLѴHuLFHuL)L!HD$HHK!L覕H|$謝?H=Y(t蚳H=V?(HW H5Eռ1~LeL- S5MtHELH1腦L=LHmHt8HEH8IHt,EtHELH5SRH16뷃HE1H8讔맋 (tN1L螗H52R1膟H1ץH=H>(H5y H-`(1H5RJHH1蘥cLkD(Ht$L1̲H|$f.AWHc1AVAUL,@ATIIUHSӺL}HH'L$ Jt( 诞HУ'LHBT*LcNt-҃ USHc)A>H1BD-H5 V蹤w'C$9L$ A< H|$ 9H!%tDHQHDʉ@HH)A9~H5( A۠D9uLcd$ H'1O$dIJt 豝HҢ'LHBT"҃ USHc3BD->HAH[]A\A]A^A_郛H []A\A]A^A_xAT11UHS耤Ãt[]A\譚8f1H5OILHH1Pff.UHcSHHHH'HXHtVH3HtN>/tRHH-=1H萜H5jOHI1ҢHsHuH[]fH{uHŅxHǾH[]/ff.@SH=](1荠H(HtaH"'1H)HHHHHcH@HHt ƛH_](H5NH1 [[ff.AWAVAUATUSHHdH%(H$10D$D$D$(H51NHdtk~mtTsuoD$(Du[H$dH3 %( H[]A\A]A^A_D${D$kKH(HD$@HH\$@HCH8wD$0H'L=;HD$@HT$8E1AH@HHHD$iHT$8D$ HHD$XE11HD$HHH;(AHcT$ H|$H覗u_H't$D$0HOL$Hp 1諙HڿH5LH1D$(AąH'H0AH*Hi:(I=[:(\:(>;A9H|$H::( H|$HޅEnL`MSI4$Ht >/1ŘH=|HD$XԖILH5K1HD$XH!8D$8@ 1Ht$H<@tH5 (RHD$X< u׿ mH=BKQHR'1Ht( LH5KI1[H=KT$8HD$XHti81@u]DHtSH<@tFH5o (誚HD$X< uL1H59HD$XHuf.\$ 荔H=bJqHr'1Ht( 9LIH57J1{H=1J/I4$Ht?I1IH5ILI1*It$Hu1H5w ( 譙H=IL1H5IH=I蚔L1H57远18L1H57蝜H5NS'1*HBL1H57gH5S'1H H= (8Dd$KfDAuAu AHD$@HHD$@HDHH5~C1ޖ'C$9Dd$D9E9~#fH5 ( A;E9uMcHT'1O$dIJt 11HHD$ҎHL$HI&H9D$(LF|$0HLIW覎HPH DLHL Hv@ w HH9uT$LL踿LLcL PH'BD  E;T$|BD>BDHH51B1茕H$H9\$>1L$Ht$@D1 7=/( H̋H'H5ABD 1 H蕋l1 HFAAA./@A 踎AWAVAUATIUH-bCS1H8dH%(HD$(1HLtMn.aGcdHLˀL-(HuH-(Pt @a Hk59(u (R1Ld$ DfDH5(H|$ 藎H5( &H|$ HtHmHmHELH8+yHEH5*B1H݌HH1+~fr~UstpwjHL$(dH3 %(bH8[]A\A]A^A_ÃpuK F;+@ |zH> aÀbAAOHHEH8H<$D%#(-'05(H<$,I(((uD)')ڕ(Htw-(tCDڕ(Eu7D(Eu"D ^J(E~Dj-(Et=ۄ't Ryt*H&HHV~Hy(複1H=V'qH5@1tH1{Ht$ Lt(Hc 'HD$ HH9 (HcH9H5?1LHـ1-qx1ۅ`HO1HT$HMHD$HyHHD$^HHH8HHCHcH|uHD$HH9)HcL|H=rI?I1HcDl$ L5~MHlHD$ H$]1*(ujM}MtA<$uaMMI'IH5n>1Hڃ*1H})(t=)(L蠍HD$ HMMA<#H5=1I[MIH=.(1(M}= .(L.(MDMADMIGH;0u1{uM7AP@DHA詫M73LHt$LHT$|HT$tL|$(IcI9UIFL8At<%h:1LQL贇L<1LLzLg~xS9is'~kH (HHHtY@tcDx1LzD.xMD$ u1LLzIFH8tfH@DxfDz0tSDLWH=(H}f1LV~lHs1A+Hr?M6H4q%}DUSHdH%(HD$1HHGHH8-tnHl$HCHHH^T$t6HHuHHL$dH3 %(H[]f.fH=Y'H€tTxmx-cHHtHCHODH51{H1l\\M{f.AWE1AVE1AUE1ATAUSHHxdH%(HD$h1Hl$P}!( D$ HD$HD$H51HdkC$O#cH=(H[ytHD$PH~ HT$H9tHr(H504fsGtu_H=0(HxH|$PHHclj|$ H9}w8QH5 11Hyt$ HڻH15kDHL$hdH3 %(ZHx[]A\A]A^A_znH=h(H(xtHD$PHxAL9`fDH9(H5/1>yH޻H1jWH=(HwtHD$PHxAL9DlH(HD$H((AH=(HAwHLl$PM:DI9.AhfDHQ(H9H@HHH9RHHL$wHL$n(HHD$XHD$`D$$HL$HD$(H@(HL$Ł@&t HL$(A(A|$ 11xHy u1ۃ8ø|$$ Ej>HD$`HD$HD$XHD$0MtVLt$8Lt$0Dd$@Dd$ Ll$HDl$$ EHI9~HT$ADLDHyLt$8Dd$@Ll$HAAAHD$XHD$`Dd$8EL$$|$ ACl%HT$Ht$0!HtSL$8L|$XH|$tEtDHH|$HH|$(1LAMtDI9}H|$XK1oH=p-1gWH(H5,L0v^HT$$ID9GL|$X:LLnH|$IuLHD$@uHT$@t HHt$@LIH/hH~M$$M41f.r Hlj5q(YHca(Hb(>XjAVAUATUSHdH%(HD$1HHGIH;-H$1E1I+;D@+nH{L"hIF>H0M6Mt)IFH+@-u{uC H$H$8Hv< u<t H@uLd$H$(I<$~H$(H-FD$L$0H$H$H$L訜IHH$0L$lLHIMtLMMHM$$Af(I<$ID$HHBOt&H$(8]HHID1H>uHEH$%PHVLPHHH$]H$IHZ%.|$$1QDŽ$Hy@M8$H|$HHD$8HD$HD$D$D$ED|$$H$@HDD='H$pfo$@H'fo$PDl$H$fo$`H$$x)$)$)$$ED7$$y {GH5d'1H=q'輟-'ɰ==' Dd$ED|$$H$@HDD='H$pDfo$@fo$PH$fo$`H'H$$x)$)$)$$D$@ID$@D$lDŽ$D$D +Kt.VH5}1HwMt$$HH1>H=NJD$AH!Z(H5=RH|$XJDL$,E =' D$D|$0Hl$XDŽ$V'tD'E'AD='q4H|$PmHH@(@tC(H{"H$H$(1諪HHt+DD$lHEOMH1HHHH$(!D$@D$DH$(HLHxx HHHID$EH5u'=g'2x'D|$0Hl$XAH5'H|$HLH='DPFW(="' :DT$EZHD$1H@H89HD$H@H8@H$ >t$lH:H=l1HHFgHHGHC(@C(Ld$D$HD$H@H8kIGH$(}D$lH\$PtH$(HD$HH@H8HHmHD$H@H8xe(HtHGH$D$ D$2$ HD$8D$D$H51IHt$PH1;H$(EHl$XD|$0GT$8$m'@k'DŽ$u JO($wW$DD$D$AH$1H=ieH&|$$>脐AH5'=w'B'H$H$0H$(VHH$(8H$(H݋T$lt"HuWH-=H=bS(NHH=HDH$'$}HAIHD$LH@H8JLHOT$lH$H薗HH$(?HDŽ$D$xfV'uÐHH5-'='0'Hff.'DHHHtHWHtH2>-t?HGC((uKH5#1FH1:8HùH=9€u蓪׾H=`(+Mf.H1-κ't(H=@ |H=4p;1Hf1H5H=bfH1-H=a'{ 't,1H5H=2_bH=&s:1H@H=l{f.H-t#5'2+%'H@'2'P(u3+'HfH-tC=e't@H(H]AHtgA8uHL4C…uMcH-'KHDxuRH@ HtHKHTHBHtVLD1L85H[]A\A]A^A_DT$ 薾T$ uL5HB1A-‰1ff.AWaL=AVE1AUL-ATUSH 'H8dH%(HD$(1ILLfHCHcLЅtLM?EEtHH(Mt7M{LkEt`HtDEuHH(MufDA~H- 'E1HcHHL57LIIHtCHEIH(HA<$tIcLILPDDxHAD:HuLEt AMcKD=H=0HtlX(LH=ڃP(1Z5'P(уH(tt\HD$(dH3%(u\H8L[]A\A]A^A_:H81LH=|ZP(уH( 'ttP(=DATIUSHdH%(HD$1Hl$D$f-HH;:HL@IHHuHD$dH3%(u H[]A\z=f.tcUH=SH/Ht P(ƀtDt H[]1HhHl$X+EAŃEfDIA>Ati?oL;MIGH0HxՁt}tyu7IA>LAAufDHH?D$END$~D$<DɸA=DAr%DAZ|$2D$;-1@AFtfE1-<-A~HH33D$H|$D|$D$D$Z.,]9H+x߷+vзHu D$Hu3D$ff.AWAVAUE1ATE1UHS1HHdH%(HD$81n{H53Hwfta~ntJvuefDuS>AHL$8dH3 %(DHH[]A\A]A^A_fAAwD+AEAA!(DH-D(D$ D D$DD$Hm\$\$Dl$ D|$$BE=')Lq6L-D$ HmHHEDD$L0Eu1LdADžt[LA 8HPHT$0L6tL)HHH( vL*AEA8MDl$EEHt$0HHT$HT$1=\$ uEtD$D \$$EHmf.Lx0L$HHA?7AL =ÃuAEuEu؋L$ LDgkÃ\ESD$ALH{Ht5*HH5HH1H7H-fDDtH;.1HL$dH3 %(-H []A\A]A^fE 'u-HwH?AH.'H'Et|HH516f1H6U1HEEtY')H;Hs~H.H5-1%6HwH?~H-Au<$fAH6/AfAVAUATUSE9IMI}MuL%H-Hu|@II~HtkH'L9@H9 @J1#(tǻL+[]A\A]A^8IMv1ۉ[]A\A]A^f1ff.St&HǸHt0H0'HH9HH9Љ@ 1[DST(HǸHt0H'HH9HH9Љ@ Y1[DAVAUATAUHStJ Hu[]A\A]A^D#p(p(D t. '[H]A\A]A^6\fD{:IH@*HXHH-HxHHI9+I}1LIHHAE(I}% C(C,u AAM( tK( E e([L)s(D s('@HHHt@p(@,tׁ s(D s(f.FIB1H>%H'H911HHHH's(^s(PH9tAM( C,I} f[L]A\A]A^)AWAVE1AUAATE1UHS1Hxt$ dH%(HD$h1nD$H5|HIja~EnthptӃftN1HL$hdH3 %(Hx[]A\A]A^A_ft3AuAuDAeD@D$CH-7(H D$ D$t Y'D$ L$ E{|$ L$\$$D$D$DD$\ȉD$L|$D$HaD$[HD$`HD$PHI\M|A?+L/)W=1ɋD$ D$$DD$ -gLMHEf|$`EtD$brt$t HcD$\D`xHcD$LH|$PL$@L$[LL$8L`HcD$HD`@HHHD$0"AHHD$(HLL$8LD$0\$LMLzHt$(H&L$@tAt$ DLlHmHHEL(Eu31L+L(uLD$DfDL(#H5IHDL$EtED$ A!G(rfDEuD$ A G(ZfDL$#T$D1ALl'=A+1LL$(L$(T$}D$ D$ iL)QH51(LH1dD$Df.LhD$rfDD|$ DD 1HAt)AD|$ D$ D$DD$ 1HH}L}L5L%HtHl$l$Dl$A݋\$ fG(ttKEt@tBt2t.H'T$L9@L9 @U1. uZIIHuHl$1HD$ #D$ E0HT$ @*Ѓ࿃@D‰D$ Hl$&ff.@1Ҿ`1ҾPATUHSHdH%(HD$1HtHGHt H0>-g1HH!:1H<$:wH$H'HH9HBH$HH='Ht"H'HPHHH9uH-'HHEL L%HxLHM#HH'H'HH'HEuwH$HBH$H`{1HL$dH3 %(H[]A\Ë0(t*1H5$HtHUH*HH먐H'{H=)~耈m%H'u u= PΘ'uH騛QvH鍛DPAUATUSH]H1(HHCD 6'H(ED;'E/H$HH#HxWHHI!H=3rH=1LtH;t0aN1H=1tH;—'FAc?1H;L@mXH=tH[]A\A]f/H#HzHr+HCH(=6'56'H1].H51H"HH1HCH9(tH ז't ' c'9H[]A\A]H[]A\A]fDH8IHHC55'H(OKfH;NAbH-*(H'H!Hx_HHIH=*L1rH=XL1rAZAHsH[]A\A]fDH5F1H!H1'H5'{ff.ATE1UHSH-cHHk_t6tfuAfD蛄[]A\ÐK[]A\Ð'tGEuH=-('uQH5Tچ='H@'C%1뙺H5c1< HtH5M1 H1mMUSHdH%(HD$1HtAHt$|$HH8HHL$dH3 %(uEH[]DH9'8[uрxu˺H5 sH1fUSH8dH%(H$(1{HH$1H&H޿&H=Œ'H1H5' !H='Hu1H5' !H='H1H5o' !H=^'Hs1sH5L' !1H$(dH3 %(u H8[]DUHcHe$(SHHH,Htl_u H1KSutUHHH^HEH5K1A$HtHH[]fD^uH[]fDH=H€uHHٿHEH51#HH^JSHH=%H€t'$H=H€HHHHbHEH5O1E#AVAUE1ATIUH-AS1H_HLA[t\lt'ptJt%8H[]A\A]A^@SH[]A\A]A^AfH-9)(EHHEL(MtA}f'1HmH`AEAt E1<-St'L5CDLPHmHHEH8HAAu`V}SHuEDHmHt?HEH8HuHEH8qDuH[]A\A]A^6fDHEH8/,f.ljD$ SD$  IcL> J'5'H5dڀ1;]Y%'hL|'AEt><-uRAEuIHmH`E1A H5؂NHmH/ALFHEAHHAE댾LAF:AWAVAUAATAUHSH(A D'EE1Hax)AAA&Aޅ^A`H,HtgEAA@='H51HH1AA`E1HH!tEt~H-IHtnA-AA<LAH(D[]A\A]A^A_fH=+\H ADE1D$D%D$DD$DD$DD$Qf.|$t /D$AA~ALAQt$HIMA:U b'vL螑A?/lT$`T$L1AnLID$MD@H=ALHAjDDHpI>K)H$HHD$HL$IH6HLT$T$L謐LE1l@1H5LHH1 _LOfDӖHdAAAAޅ>@cIHAAAIEu:A0@H=^$HIHHAsH`XEAEAAHAfAHufH=$t&H\fDH=/D&1H5O LHH1WHH5FH/H51AHHH1Hx HH5lIH1Lp1H5hXHH1IwHEbHM1H5HH1cH=HHHH=%Lp1H5sHHL1@H3AUIHLATL-L%ULH-SHHO-p6au)LLuBaHPHBHHtHHPH:-u<JLBtuLLuBtHPHBHHuM̻H-\THLP@aptfH[]A\A]fLL]LHt1LLfDLHBpHPHBft+PT0 [tH[]A\A]D@D1DH-)(HtdAE1AHmAHt,HEH8D uHUD$ H:D$ 1E@H[]A\A]1@UHcHSHHH(dH%(HD$1H&|8~2uRH1HHL$dH3 %(uKH([]HPx.H$HEHD$H1 문fAVAUL-&ATIUHcSHPdH%(HD$H1HHA\u=#'ہtWHIHLL@DM@L1H HLH51IT-It8HcL1ҾHH HD$HdH3%(uKHP[]A\A]A^H=< f.EH L1@BhXAWAVAUATUSHHhdH%(HD$X1='uTAaSd'HH5&fD'H'cDH HD@8HH@;@D'Ep'1E1L-8'PLHKAƃ,AHt^DAtvA?|HL$XdH3 %(\Hh[]A\A]A^A_DASt"Aau<A|Alsp@''H='9}QHcƒH'HB(HD0HPf'H]'Hc='H 2'HH,'f. 'tmL'A2MJ1fDcH&d9ttH H5{1 H1wHb(L'AfHtH@HIBfd'e9AIYELt$@AdDDH- &L|$81A,fDEtcHt$8H E~MDmLLt<8tHuH=CH1fHt$@1qEl$,AEDt$(E1AΉǃD$ HD$8HD$HD$0|$$HD$@LHM|*cQHL&1۸d 9tH \$(EMHT$Ht$#AA:tuH5cLH=k/{H5cLA:uŋo 'Ht$1H=#D$D$fH5vLDH=/H5$cLXEf.@m'1y'1fDSH5H1 H[H1[ff.HS1Hff.H&m'''!1Hf.N 'tÄ'1HH=l'%" ''1Hff.fE>DHZ1Hff.AUaIH5ATU1SH&HD'HHsHt(A8uLuH[]A\A]H[]A\A]fDt+H?HH-H5,HD1HӯHH oH5HD1fDStWu'm'O'I'C'='HH@H&HDD %'Et&1[fDD'Et& 1[fD=ޝ'u5Н'tz&)n&(1[f 'tT&*f.'1+2&kDAUAH j'ATAAH=UH-ɳSH&HfDHt%HCH HHHEu1D3HuH1[]A\A]ff.f>'(j'ؚ'"'''p(j'&'X'"''i'l'"&~''~''(b&p':i''Z'`'&&&0''h'&'''&'j'fJ'&>' ''' ' wHHcH>'DΚ'DΚ'D'D'D'DAU3ATL%4&UH-װSHIŸ H@HxIHHIDIl$HcHHuIDHL[]A\A]ff.USHHtGHxSۺHHEH@Hi&HDڋ0H1[]fDEH[]!H(H[]ff.AWH=ƯAVE1AUL-үATUSH &HHdH%(HD$81IHpf'LHSHLHIDEEtEEtHMuA~H-&E1HcHQL50(IIHtCHEIHHA<$tIcLIL0LxDDxHAD:HuLEt AMcKD=H=߮Ht\X(LH=ȮڃP(1` 5j}'P(уH(ttLHD$8dH3%(uLHHL[]A\A]A^A_1LH=m P(уH( }'ttP(DAVAUATUSHHL%3&E1.fDHH@IHP*HPHtH8HHt)HCL0LyLAHHuH=Ht[D]A\A]A^DE1ff.AWAVAUATIUH-{S1Hm2HL".tmp~:s9uqH[]A\A]A^A_@ouHL-uL5'ڃ =؃M L%&trM6MIFL(LHH@ID0DuLDKRA1ۃ-fIFH0rM6ADMunH[]A\A]A^A_t1܉މ߃d11MkAAL=A/HѿH5-1M6MwIFH8Dt9ADEuIVHuH IEH51IFH8e뗺H51H1QL AAH-ſ&AAL%sAH/a'H=GAfDHUHELHIԋ0A9uEu Mu1wHL[]A\A]A^A_jމǃը17H[]A\A]A^A_fUSH1HUHHxH߉>H[]DAUL-&ATIUSHdH%(HD$1Hl$D$EfHhx(HH@IDHPHPHt H8HTHLYHHuHD$dH3%(u H[]A\A]tUH=ѨSHHt P(ƀtDt H[]HhHHxkHHHHHf.AVAUATUSHD/AE H[]A\A]A^fHg\1A0H!WJЀHH4 H9WHFlJЀv)DmsE1AuH|$AF4H|$E1McLHNT7WHcIH0@ADQ`L9WVI@΀vǃA@*7Hcf\    Ho[H|$HH|$1LHGDCDBt1H9t1DBAAw~WHDDCDBuHfH9@u)f.\1fD0HcDH9)Iw=DE@AD^DFЀDAGkfDDmjfHLHcDA$L@H5ק11H1E\H5ȧ11\DH1E\[ff.USH"HmH51HHHHH[1]QUSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Hc='HIH5'H$IHD$HHD$ H)H=ɍ'HD$$D$0'rHcH95'v9H 't'HcH\$dH3%(H[]H=Y'H?HH5:'轺IIHc='H$H5'H'HL$HL$ HL$H)HH$D$0ό'GUSH(H'dH%(HD$1HD$HCH8HJH2Hw,HCH@HH'HL$dH3 %(uAH([]HCHH8H-HHvHCH|$ HH0H-HcD$ ATUSH H1'dH%(HD$1HHCH(E<'tY<"tU11Ht$HIHT$:ufDIA$C< vD$(D$40H'H-HtHPHH'H*H=M'sm'T$ T$(  T$0t$4HL1fHH'z'Iz'+H=DM' D$A$MuAD$H'H HPHH*H߀'Ht } HXg H11DHHtH4tDD$0L$4HL H^Hn'HNHPHH*HT'H4}*HyH5'HIH5L6H=L'HL$ L$(-5'T$0t$4LH16qH'HHPHHH'HHT$ #tHc耬HT$ Ld$(L$IHHD$X\$ H$LfDELHHLb<\uڀztCfH$HHCHL$HL)D$TDL$THcLEDD$XE~1D HHM9D$XpH-~'H# HEL8A<' <" v11LHt$XH$;L$IHD$X8 A8"HEHA~''H5~'H HPHHH~'*H=1J'}'T$ T$(#= T$0t$4L1LH-}'HL HEL8A<' <" Ht$XLH$HT$XH$: 8" HEHj}'H5L<$H=qI'H9L$ L$(,$D=!}'E HH1T$@t$D<$]A^D$LImAD$HxHHD$ AE #@<)HHBE<(u݃H5d1DH1@u'u'N|'H?|'OH={'H= |'THtH=>H'su'qu'H=H'yyYH5s1$AH1H|$ A{'Ƅ$HZ{'$BA>H5G':DQ{'%H{'f$EtgL$LGt't'IL,$fDc7fD=Zt'<H5F'%/DA\$*-cIf.IA$C< vD$ D$0=s';\6XfD=s'u;6fDgD}AT>HD$ 8uA%X@fDH=y'HvH HD$XH=zALl$XLhHmL$HT$ HLH|$ IEfƄ$AsLfE$ H!%tDHJHDщHL)tDD$0L$4LLN Lm[5fD=Rr':Ld$`fHT$P1LI~)D$`1D$xH$HD$pgD\$PLcE0DHq'u^q'uDH9\$P~ZA<DNx'Ƅ$Hx'@$EuH5ZD'4f=q'E9MMu@HD$@HtiDfIl$A\$D$ D$0IRL$(w'a-t$4LH1A+HHH9=i'Htv i'H=h'H=h'H 'HSL*AU-n+mA+cA}Xʈ&A '(fD%h'Hh'AHSL*McCl5-':wH@l$HT$HZ@Hƀw>Kt5H >tqH52'H h'h'H[]A\A]A^A_<#AD%g'McC|%ug'HHg'H'먐HHQH<:t$<-t <+uA+uzfDHH'Hgg'OfEEEH=jLA-yA}nHHg'H.'<;`H'H f'H=&&Hf'HBHf'f'H<uyH?f'H'Hf'HsH?H'_KL5t40< HH W'H8f'*H='HHtHH@1T$H8T$t-He'HHPHHHe'H'fDH=&&?該e'H'H=&&?Ae'H'^H{fDHUe'Hi'3HI'HI'He'H-'H'Hd'Hd'd'AUbIH5ATU1SH&HD'HHsHt(A8uL蠿uH[]A\A]H[]A\A]fDAT1IUHH5lSH]@mD H]pG @zǀQ%@{@RÀ) V* H}Ht-褳HH5HH1dHH} Ht-nH|H5nHH1.HƷH}(Ht-8HIH58HH1H萷H}0Ht-HwH5HH1HZH}PHt-̲H~H5~HH1H$H}@Ht-薲H~H5~HH1VHHM8HtH~H5j~1+A<$_tLܷ[1]A\D H=WrL H=vLuH=~茷[1]A\DH}H5}1覿H}H5}1膿H+cH5k}1fHs}H5K}1FHK}H5+}1&_HtpH5 }13H}H5|1 HDrH5|1ƾHbH5|1覾HjH5|1膾Hy|H5k|1ffHI|H5K|1F=H&|H5.|1&HfuH5|1HCuH5{1H{H5{1ƽH{H5{1覽gH}{H5{1膽>HZ{H5n{1fH>lH5N{1FH{H5.{1&H] H5{1HzH5z1qHzH5z1ƼHHzH5_z1覼H`zH5?z1膼H6zH5z1fH zH5y1FHyH5y1&tHyH5y1KH=Bz贳[1]A\ff.fHwHff.@USHHt}H1fDHSHH:HHtEHCH8EHuHCH5z1H(HH1THHuH[]1H[]fUSHHteH1fDHHtDHCH8tuHCH5y1H(vHH1ĥHHuH[]1H[]DAWAVIAUE1ATIU1SHzH8HT$HL$H$fH5!yLc=HcH>IffI@IMAFDMAfDH-A'HQHH `w&HHcDH $nfDI\@I@L@I<@I,@I@I IIIHy'HZ'DHa'HZ'DHI'HZZ'DH1'HJZ'}DH'HBZ'eDH'HZ'MDMAF 2fMAFf.H'HY'DH'L=zv&1Ll$Ld$ aAL HT$(H5XIA@HHuAH+A8uLCuIcHv&Ll$Ld$ HHcDI jf.H8[]A\A]A^A_蛤H8[]A\A]A^A_HD$H $L(HD$HH8[]A\A]A^A_H=`u̥GH= 败/oHͥ]H=u臥BH=tl'DH5t1%Ht$(H1vff.U1HSHH5tHAHHs@H5s1HsH5wt1HsH5s1յHsH5ks1貵Hrs 1H5Fs菵HQs1H5 si}_HH[]H5r1=HrEH5s1HrEH5vs1Hr E1H5QsԴHrE1H5+s讴}_E H=fHtZ H=jH HH=r[]f.H5r1=HH=nr[]ޫff.AVAUATUSH0dH%(HD$(1HVHL$HHt$HD$HD$HD$H$H4U'H1U'H.U'H+U'H(U'H%U'H"U'=t?DD$H-'H=xiEu[|$uLT$HH_HL$(dH3 %(H0[]A\A]A^f.H=fDD$HH+'@L$t MtL L@Mt{HS'IH$IEHD$IEHtH訫HxHHDHI]HfS'HtHyHxHHHI] H/S'HtHJHxHHHI](HR'HtHHxHH跨HI]0HR'HtHHxSHH舨HI]8HR'HtH轪Hx$HHYHI]@HcR'HtH莪Hx~HH*HI]PMt^L1AHELH8a}HmADHuL:HDE1A[|1'@1Huk,ff.AUATUSH(dH%(HD$1H9HL$HT$1HD$HD$HHQ'HEQ'HBQ'H?Q'HH$EtmouxH!'HHD$,H$AHHAD 뒐uCHL$dH3 %(DH([]A\A]A^A_@ANDc@A.DH-'H=)aEEu~HE11L5i,DLq1DLqHmHHEH8]xIHt$D|$D uHEIt$H8H=\1HXIH t(M0L_H|$ O'@H'HDd$l$D HߺDp1H߉pD1lp1cp]fDMNLwAfHEL1H*HH1xH5h1H1QH=խ'HsHD$dH3%(u%H(1[]A\A]A^A_H.1fHtL7@tEHW14HHc@t%H@\upHcIЈBHc|uAIfHdH%(H$1HHt>axt fDGHHOt6GHDGH@G<(u޸f.1ff.f&u.t \tJ>.t-@1>.u.t\u1.fDVt!.uNjV1Ð.uff.AUATUHSH(dH%(HD$1螝HH蜝Ll$1HLIOHH\$HtK3HK14HHc…t$P\upHc‰HωAHc‹tuHHL$LLHD$lBD%HΙHD$dH3%(u3H([]A\A] fHfDHfDAWAVAUAATIUSHHWu`"&u6<.t<\A<$.@1H[]A\A]A^A_DA<$.u<.tڽ<\uӀ{.tːHH$1HLtLLt$-KHH$HtI9u5EwAGHDLLEwŅ_H4$|HJIHuH9\$;8fD{.!fAD$<.A|$@HD$8){|H՛HeLt$DLHAA)f.AVAAUATIUHHSH dH%(HD$1HHU1H|$HHD$AHD$LHuXDLHHL$HtHFH|$Ht7H\$dH3%(7H []A\A]A^@1H|$LLHtLd$HL$EuLH1HiH輚1HLtLJIII9ukA>)ue|H/HuSALHhA)HL$"DDAAH1L8DAHͅ|LHHHHuI9HL$Ef.HhHeDLHqUDSHHdH%(HD$1ߘH1HH8KHH<$E1H bHHpt!Et/aHL$dH3 %(uKH[fAXH@XHptXX(ufDHHoff.@UHAWAVAUATSHHH dH%(HE1H~?uA՗HIrH FHHv=7&D?'Et =B8't DžDDDž,%DHDžƒDDE1(DD7'7'2ADžwHIHH8t蔖IHvDLHuDLHz(t5H LmDHHAHHHHHE1E1HDžHLIHDL)HsLhMMlL0LDIMJHHuLLMt@H0HHuHAH f.H44H XHcHzImIH)M LpHI$aAEEE1L fDH{IMM9MDTI$LHHuE1KH 1HH9tHH$H9uH HL$Ld$II$萘HtID$HzDž,,xH^IH,t,,LVItL@HJHHHHH9u싅,IDHthMtcLL9tL'@MtKLI9uH+9fH 1f.L-'fHMdH3 %(LHe[A\A]A^A_]I|$辏M$$MumELMTMt$DMtL{MtLnLMuDAt HFLnLHHHQwHH9-HH$H 'H9tH׎vMLDIHDpMcLQMt HMtLHHHtHkHAYT@IHWDž,1fADAA,H B|(IHc苕A}HcI|IM HHH茎LH LuIcA|$LA/HcLZH0L趐L VHH9tHH$H9uH HL$Dž,Ld$II$Ml$1ۋ,xH諔IHMMILMt$IUH HL$L|$ILޏHxUHM}HtHIOLHI裏HLHPH ,LH>q,LjH HLȒHLHDHHMMD,ItLIMtL訋M\L藋O8MILDHLIGHLILLN,Ls6LE1+Dž, MtLHHAHHPLLAWAVAUATUSHH8t$]H7H/HI譎HH:D v.'EHH)DxHD$LL$IHDl$HHH]LDD$C,EL6}* L\LD$AA}* DLHIHƙ'I9%AMfDAH=IDT$LIEH8L[]A\A]A^A_/H#KHHE1L%;L,D$AAAyH5%DHIHtH'I9GEN,','}?L賑IHB=IHA$EIF@D$ƃ%D$(A<$*MDl$DAIcA|/A|*zA|*nID)f.AU~"x*uHDx*uAՀx/tDA;T$tAv }*sAEE1D$E;*~{*tD${T$D D$AH51$A3DDLH:IHH'I9~AH=D$eT$LL'IL܆^LφMt EtL轆*'J*'2\E1@L舆A8LmE1DE1MDl$MA}/uAELnLIHD$.MH &'I9.HD$H0H/Et }*D$LT$H\$E1LA%M։D$!DHL$AEIL4I6H|$(t }*ZD$>Au }\H|$DIHEHl'I9tDD$,t }*yI>T$LLL$ E1rLL$ IHH1@PI<HuDHH4LL$ HHI1DLL$ HuDWAHӍFHIHuHM9L蚄EHD$IHl$1H8Htf.kCH|HHuH|$Q@D8}*Dd$>AH5!DL$,j}*`}*V}LLރ?f}*}EtHt1f CIM1HBCID$ 1A<$/@D$ tD|t D脀AD9tEL9|$|D$ t A.Dt$ EtDi|t D-AEt$IL$A!A^ˆT$WD$ Dl$PLaL|$HED$8A[U1DD$ AՃD$0A\u |$8DL$ ED{MDEE>ID{t DnAEzA/u |$0qA-EnA]iMfA\u |$8E;E<$A[-DD$ EtD+{1DI~0A]cL|$H|$WMDA݋|$P1A]tA[A$=y:[1.LHt$dDIċD$dAǃbD$PDxPfDEA$MDIAE<$EDT$ IEtD zDDM},fD|$P1D Dl$PL|$HML$Et$EL$ !]t \>MAMa[uAA=wH@$Hs؃MfC߃HD$ Hl$(LHL$HT$AIAL9|$@DDu|$P1A-1@D$ Ld$DxfIL$Et$k|$ DxoDL|A_@D8|A=|$P1A>MDl$PL|$HE6x@A|$=[1A.LHt$dIDD$dIAED8AD$D$dIl$IIЅAW:u]uMM)LxHD$0HH\$0LHHHHyH=BH\$hBD3IuH\$hHH5c>Hp|$PzRLD$dMgIo oDE<$EA]!D\$ IE'Mf EnWL9|$@D$ A/ rfDMDL9d$@UD$ A|$/9fL9|$@%A/ DDl$PL|$HA[Ld$f.IED$$t L9d$>t$ A/6Ll$/LLL)HEzHHIDD$ u A\QDt$D$ tDl$Dju>MoL9ED$ Hl$(H݋\$$D$ @II9tA?(tIAwH=:<xHu4A[t.D$ A$t׉T$$tT$$t x9T$uMtMtDD$ HL$(LLHt$tt1DA|$ ]pl$ A\$ttt ExÉ\$dID$E|$;\$PE:\$ Ią.fDED$(sD$ hHT$/LL)HxHDt$0Dl$PLd$8H{H9$1HHH^1L|$HIDl$PL|$HA[tsHD$L9wgIL9SA<$/uLH?M6DD$ Ht$HLDvD$HT$1LL)HwD$/HHjH\$Dt$[MgIo IEDl$PL|$HML$fDAAMA!A?(DL$ HT$ILIO!DAAq0AAIAD$H5t9HkAŅuH9HD$hHHHD$pHD$pHD$XnImLI~brHHH|$hnImHL$XHHt$hLIV mHHpHI]jMLEuh\$Pl_… H|$0\$dMwIo jMMDl$PL|$HEv^D$PE<$Dh|$P[lÃuH|$0D$diLd$@D$ D$(|$W1ۃUilMfAWAVAUIATAHyUHSLHH9(HEHT$I9t11LETH$HtAD$߃w3Hj>HcH>HD$I}HH)H)HH9<HH[]A\A]A^A_HD$7D$7A?uIEH;$DH\$ HD$HD$HHHEՃt$HT$8H|$Ht$ H9I|HD$(H$H9T$ tH9wHD$(L|$8HH|$HD$AD l$7Dd$L9ECEu@HL$HT$ELHu$MtHL$ H$EHLIL9sHD$(HD$H9$;H;l$IEHDt$IHD$ DD$Dl$D$(Hl$@Hl$ G|HHIEu!DD$H|$HLHH/L94$LHD AH9uu$DD$H|$HLHE1HD$7D$7A*u DIUH\$H\$D$ IEIHD$(HD$I9$|HLHD$8H9HHD$MIAD d$7fEHL$ELLH1uuDT$ L9ECMtdHL$H$EHLDT$t.L9DT$t:H|$(t2HL$HT$(EHLu1HH[]A\A]A^A_DIL9[Ht$8H94$Ll$8HD$D+D Et}EHD$HPfD+nL9d$DD$DBD$(MtH$Ht$HL/YIL9d$EHD$(EtHD$HeHL$D!HeHH[]A\A]A^A_HeD+H$Ht$EHH1H$Ht$EHHz1HD$HD$8H9ff.AUAATUHHSHH5hHL$)hHEHHLLH[]A\A]fAWIAVAUATUSHxH|$@Ht$HL$D$dH%(HT$h1L9HDDI t$D$ L$IGAHD$tpHDXt pH1L9l$vAmT$ t A(?#~y[\HL$H9L$O$IGA_H93INjD$/pL AD\ pH*$t .( Ht$H9t$EwI_A?t A* $D$(Aă/uDd$L|$Dd$ H@A?trA*I9 D3HCA?t A* /u |$GHEuA?u1IE1H9D$vAmIf.;(uD $HT$MHL?t+HI9t"H1L5HHQf1f;(/L9l$ Dt$PD4$l$0Hl$Dd$8M IL9k EMHHL*u@tL$/uu<$t .L|$IL9|$ML9l$N$ @Ht$hdH34%( Hx[]A\A]A^A_D$ۅtmLcHBDpt mHB,9q@tL9l$t$t .D\$@l$PEtzmHDht[mHD$PEgIOA!A^ˆT$WD$PLyLl$HMHHD$XA[,$E1DD<$AD|$(\u @t$ A]MMP/u |$(-OEUA]M}A\u @EtAA[L$t DT$(dll$(HIDh~AA1DDT$(MoDT$(] MLl$H|$WMfEeE|$IfkAL8HL$0ADOtkHL$0HD$AMMMHADOLL$8HL$0fkHL$0LL$8HAEMA\$P1DDT$(DT$(A] A[AE<=<:,$[E1<.LHt$dDAIŋD$dAăD$PAD`@1AD8cMLl$HIoAG4$L}<[t.<] @t<\` mMLL}<[uE<=wH@$HsكLC߃hHY$LD$LHL$HT$AAL9l$@DDi @DT$PE1DDLL$8A-DDT$0&DT$0LL$8E1MnfD$L|$tNiL LcCDtt +iHB,9IOEgfT$A܅hAHDXhHD$hHDpfD1DDDLL$(CLL$(MtfDA-A}=,$[E1TD.LHt$dBDT$dIAmAfD$dAEI]IfIЄAW<:u]uLL)HfbIHHUHLKaAD.AaH5,L|$(AfDHHt@H#&H4A8uL;`uL|$(H 0HcH>LD$dZfDEeEA]8DD$IEfM}EUefL9l$@$MA}/BL9l$@$A}/L9l$@PA}/EmD|$P[Ll$HXL|$WfDIED$ t L9l$4$A/kHl$/LHL)E\^HHHD$u A\&ED$teAHDhuIoL9$Dd$I܋\$ $fA[tKAMD$L$ t1L$(eT$ L$(HDPHT$ tSeHT$ H D$9u+Mt&Ht!D$HL$HLHt$TIM9oA?(tAwH=C*[A[tHuNA}]`DT$AmEtdHDht dH,|$P1l$d5IU3EeEDL$IEFdDED$({$qHT$/LL)|\HfDDt$Pl$0Dd$8H{I9-1LCHH_1Ll$HILl$H|$P[VtqHD$L9wIL9A}/uLHwMnD$HL$LHt$8PFcHD$yHl$1LHL)[HHHD31A}/ D$dMoI_IbHL$XHf|$P_ ÃL\$dIoMoULMLl$H*bHL$XH߃bHL$XHzbHL$XHf `bHL$XHfrDbHL$XHY+bHL$XHf <bHL$XHfaHL$XHf aHL$XHf aHL$XHfaHL$XHf}aHL$XHf 1D$PMLl$HIoIfELA!A?(D $LD$IOLHT$!D}EHlE'D$PAADP5Ll$@x$D$(;|$WrMLl$HLMLI4Vff.@AWAVAUIATA1UHSLHH9(@HT$HL9t11LEcH$HtAD$߃w+H(HcH>HD$I}HH)H)9CHH[]A\A]A^A_HD$7D$7A?uIEH;$H\$ HD$HD$HHHEHt$8Dt$H|$Ht$ H9P|HD$(H$H9T$ tH9w~HD$(L|$8HH|$HD$AD l$7fDd$L9ECEu@HL$HT$ELHu$MtHL$ H$EHLIL9sHD$(HD$H9$HD$(EtHD$H WHt$D&HWHH[]A\A]A^A_HVD+H$Ht$EHHs1H$Ht$EHHM1HD$HD$8H9ff.AUAATIHUSHH5QLH*QHH4+EI LH[]A\A]f.HtHt렸f.H9tf1ff.fHtHt DfH9tf1ff.fATAUHHSHH0dH%(HD$(1~H5PHt1H|$HHsj1H|$ H{HsEHt$ H|$HHDaH|$D$ LH|$ LD$ +H|$LfDHt3Ht.DHHXHL$(dH3 %(u:H0[]A\ِH}H%DrOfAWAVIAUIATUSHH8HT$dH%(HD$(1HM>L OHIH1H|$u3qA<\u,I\IM>HHH9l$t@LWuLLLHOHPHvyM>I)IM>uIHL$(dH3 %(HH8[]A\A]A^A_f.B&L-C&$H0&& HI끐H<sRHHL$ Ht$HIEL|$HHD$ =QHHAHJ4Mff.@AWAVAUATUSHxH|$8Ht$dH%(HD$h1HHH|$IHD$`QIHFQLIH(HD$P1۽ Lt$`HD$(4D$PHSH9rZD$PM|IAbHLUAt<\HSD$P\H9sfH LHL$H4HT$RRHT$HL$HteH4LHL$HT$HD$ $RHT$HL$HLL$ +IM7H|$(LL{LHH LHLHHD$8HHHD$HHt$hdH34%(HHx[]A\A]A^A_fHD$8HtHHD$HHtHDHD$8L HD$L(fDHD$`HT$H11HD$(HD$PHD$0HD$XHD$HD$HHD$XHD$ fD\L[IIM)8HD$XL|$PIHD$`Mu A?\LD$(Ht$01L1zQIH.HD$HAHD$PHD$XHD$`N$3ID$H9HD$HLD$LHt$ H)L LLL$QLL$HL|$HMTI H|$LFSA?\ IHD$L|$H\HMYH H9wH|$H4OHHD$@fI~L|$HLH|$RtMyHD$8Ht$H0DHH|$LIFHD$8HAAHxfDL|$PHD$`L|$HHD$XAAA?lIHL|$HCLAFH|$HEHD$8HIfDAUATUSH.KA݃;vKAt*zLt ?PAĉeLt *PA1E9H[]A\A]@H@HHHuuaH;As_t)Kt OAĉKt O1D9f1*H[]A\A]D(_t)Kt gOʼnKt SOA1A9$UHO1E1SE11L "!;wIcL>fD(tHAHuD @[]wHWt; D@Hz\tY[t|:E]HDuD[]GAtHO GHpD@rH1]XDp:.=D]vAHOB .ut]MHBJ1HH뽃=ut]*HBJ1HHf.HBJE1HH{HBJAHH`J]t8Hzf.J]t@HzfJHz D@HC[]fJHz D@HHHHfH1wHufD1(ff.AUATUSH/M߀;vTt8NDL CDlt lNHBDCDlt TNHB,19H[]A\A]H@HHHuu9H;zoqf.1@*H[]A\A]@(t|?@1UHO1E1SL% 1!;wIcL>(tHσHu []tHOWHfwHWA@tDD EHHz@\t7@[ta@:E]HEȄuD[]HrH@7@]]E:.=D]uHOR@.ut]pHrJ1HH@=ut]KHrJ1HHfDHrJE1HHDHrJAHHgJ]t7HzfJ]t?HzJHzEHHfDD[]f.JHzEHHfDHHHfAVAUATUSHHAE11AJ߀w@LHt3{(u-Mth1H{LHte8u@[H]A\A]A^@D9HCHDHtSHÄu[H]A\A]A^fHXf.H@Lt뉐HC1fDAVAUATUS?HMHHtSH=\&Ht=H[HtH9@HxHH=HH#&H[]A\A]A^H=H&Ht+v2Ht@(t HXD1H[]A\A]A^f?L%t&AI$HtILcE8t(II\$HtEuB<+=uJ\+a@LHHHuHr1[K;[f.@]&~ÐHbE~]&Hn]&@@Hff.HE]&H~H EH#]&Hf.@ 1{Cf.HE1H PfSE1 H dH%(HD$1HbPHH&t1onHH[]A\A]fAVAAUIATIUSLLDh=HHuj88uu[H]A\A]A^@7=H&H9&SHt8Ht3HtH&HJH &H &[H5&1H&H~ Hv&@He&[HU&H9V&SHt8Ht3HtH:&HJH /&H @&[H5$&1H&H~ H&@H&[H&H9&SHtHu5HH5&HG1H&H~5H~&HtHu&HJH j&H {&[HE&[H1&H.&DHH5&H+5&H%H&H&Hf.H޺9HuH?H?ff.@&&tÐHH5u&1>?H5'&-?&Hff.&uÐHH%&1?H&?&H@&t"H&tH&HE1ff.fG G ࿀GǃGfG1ff.F H F ࿀FǃFfF2>fHXdH%(HD$H1&t^H7&H1fo&fo &fo &HD$0&)$)L$)T$ D$8XHT$HdH3%(uHX6@g 1Df H{=ff.HXdH%(HD$H1&tnHw&H1fo5&fo =&foE&HD$0R&)$)L$)T$ D$8d$ ;HL$HdH3 %(uHXfD4@࿀GǃGfGG G 1ff.H࿀FǃFfFF F :fHXdH%(HD$H1&t^H&H1foZ&fo b&foj&HD$0w&)$)L$)T$ D$8XHT$HdH3%(uHX43@AWAfAVAAUIATUSHxdH%(HD$h1& v&Ld$ L)D$ )D$0)D$@)D$P4HD$PHXH<6HHE1HHLLH7LD$A62Ex HD$Hc6H=sHgH=dMAHT$L$ItuHtpulI@ E1HD$HcHD$DHT$1HLD$ 3JctBTH)LHc"/H|$LHI>L9|$PLD$sfAH(HC.H;.LC1HL$hdH3 %(DuaHx[]A\A]A^A_ÐE111LLE1+6LA1x Hc5H=cHsfH=TLIo*1f.USHHH/udtHH[]4H= HuHHT$Ht0H=&Hp 4HHH&H/dev/fd/HEH}-HT$H|-H[]fSHHdH %(H$1ɀ?/t7Hƿc.H$dH3%(8HĠ[dH= H€uPiotieuHpH= €mHH1gm&u tD$Iu;D$u+\$tw1@HpH=fD|$ ?EH=9 H€h@HpH=p?+ .f.DH8dH%(HD$(1HT$ Ht$D$ -y'+Xk!Ѓ!1҃ !HL$(dH3 %(uH85.DAVAUATUSHHPdH%(HD$H1-Hx/HIHa+Ml$ /L?.H{Lp1{tfHL$LHT$L)D$)D$ )D$0D$G6H\$HtEDS s{b7Ņy\H[(HuH= 1蠆H|$7fDL)HL$HdH3 %(HP[]A\A]A^DSHsb5yH{(t'.H[(Hc롐H|$6@)H=. D(H1;.H|$q6D+Yfǃt`$-LH=H1萂)H5 1+HH1VL(,LH=4H10 ,fH H+HHHRH+VxHWÐH@BHWHxHHHGH HRHHHVHH?BHWf.H@BHHWHff.fSHJHNLLH?B~ H@BILHwAH k)I4ׂCIIHK/t IL9uMAALD$1TD$ADHID|$/tHI9tA/IFLp..f0LAD$M\@IAALL\$D$1UL\$D$AA|${/D$u1{/@1H{/D$I,7D$/4#HxHHI A//T$AG#LLc$@/ALf8\MHDMA~/PE1A~/A1IA~/KL$I92MLHAELA?/A/AG xMtI$H[]A\A]fDH߉D$ MD$ t1USHOxKH5H_HD HHt HH[]QHH[]1HH[]@USHHÅu#H@C HH[]@} kH~ٍUHTfDHHH9uff.HtoUSHH9w|HH[]DH?vM KH9|+Hc)HHL>HHHH9ukHH[]Ht'HHtSHH3 C [f.ff.@HtSHH?Ht H[DHt7HHt/G uSHH tk [f.1ff.fAVAUATUSHI I$AL$IHt1ۅ uDI$H,L,Ht$HCHxHHHAD$IHJ,*9IcD$ ANAF HtH[L]A\A]A^IE1[]LA\A]A^fAWAVAUIATUSHHRDg H<$HF A|D$ 0EH $Ia1fDHL<H,Ht'HH $XHxHHH $HIHJ,8A9IcHt$ FMc1HN<H$fDIEH,HtHHxJHHHIJ 8H,HH9$uDd$ IcHEf HHL[]A\A]A^A_fDA|$EH $D$ I2@HtF E1xD$ I1IIE1|It1E1DAWAVAUIATIUSHHHt^ uHL[]A\A]A^A_Ðo DpD$ IąCHc1L4L<f.IEH,HtH{HxHHHI$J 8H,HI9ul$ HcHAl$ SfDHDHH[]A\A]A^A_qHff.AWIAVAUATUSH(Ht$HT$HtkIHHt`_ tYHHtB>t=~~H$MH$AtA>u9E1`fHD$Ht8uH(L[]A\A]A^A_E1H|$^dH$3H$AD u AH|$t HD$8uE1~Ic1H$yfDD$ AEf.A|Hc3IEIH4(H$I<SEuNIHH<(^IL$*A9_  H1HI,Ht%LcD:}uHL't0HI,HuH1[]A\A]A^A_DKDKIK<uH H[]A\A]A^A_1ff.fAUIATUSHH?HI|uzHcH3ImIHtg1DHHxHHD IHIlHuLHHL[]A\A]f.fHff.H?t6 HHFH|uH R 1ff.AW1AAVAUIATAUSHHrB| HcH*IE~"AT$HTHHH9uAl$HcHuIHMdAHHt4HCL EtLX HxLH IIcIMtEeHL[]A\A]A^A_fAWAVAUATUSHHH?HGE1fAHHhAL$Hu9AIL=Hc=L!H8HD$k ITHD$HHHH#HōCD9}EtI|E!Ht#H}tHH1[]A\A]A^A_,q@1HH[]A\A]A^A_@AWAVAUATUSHH $HH $HhH|$8HHLl$@Ht$(dH%(H$X 1H$PHD$0;/ELIfD1DHtUtNHH & fH9uDH9tB<=t<:tHtu1ff.@HtGt@"<:vAH!Ht"t"<:wHs1DH!HsfDAWAVAUATUSH8T$HL$L$H?H< L5 LHckT$L$IHHˈEHHtatZHK<\uDcEtAD$LkAA HLHD&HufDEMtL)A(H8L[]A\A]A^A_E1A {D$$LD$T$@<$ <$AT$H0LD$1@DNt;E;DW@A WIA}A@DNuDT$$HuEAE\LxAHuAE\LHEt HHAщHuAuAAHuA0Da!CHЀw.@σH\  DI9tIFdAEHЀvLHAHHPuLD$ÉT$ۉ $1 $T$LLD$f.AWIcHIE]AADAACHE<vAAACABHAA A zA oAdH|$AHuA{@@υLk\u E?ALD$(T$$DL$Ht$@<$t $Ht$HDL$HϋT$$LD$(DHH<$Ht$LHDL$T$$LD$( HHHŃAfAHuAu0E\LHncfABHlDHLHH_ADYDQ@DAGL$$uaALHAHnA 9HAHAALH{@{txЃD$$ WIA}@DFt^DO@AvԃADQDI@DAGAHuE\LAHqLk{D$$ȃA1@}LHHE1HLD$L$\&$LD$HHHLH@HAHLHAHEHD$EM{\xLkoff.@AWAVAUATUSH(dH%(HD$1H7E1?II<Hc$'fA.IHX@t]HD$L H$L=Ef\HCHX@(LhLp@u'fMt HL)A$H|$dH3<%(LuH([]A\A]A^A_@E뙐rfv~fDnnfDt^fDbNfDa>fDAt&g@L HDP@HAH<$1LHL Hsd|$HD$eHt$L itFHHt~)N1Hy HAHPH9uHID6\H0C0CE0CLWE1tATHI1U1SHøHtSHH<HLHH}t2HDH;tiuH[]A\H[1]A\ÐATUSHHtoHteH-,DAtXL$L$H"DH t%Dt#DJ@uHD[]A\HE1D[]A\ÐHH1[]A\ff.AVIAUAATUHS)ӃHcID9~IcLH)D|@<H9D)HcLA<$uMtA[L]A\A]A^@ML1ɺlLHI[]LA\A]A^f1f.fAWAVAUATUSL$HH $L9uHdH%(H$xA1HHIHYADžAn%=@HH=AoAoN1IAoV Ao^0L$p )D$PAof@LAonPAov`Ao~pH SAoL$)L$`)T$p)$)$)$)$)$)$LLou$%=@t8H$xAdH3 %(DHĈA[]A\A]A^A_@ L1IH LLu$%=@u L1IH TLLU$%=@>H$8HD$8Hj&H9$fo$l$H1H$p!fo$D|$LL fo$) &fo$fo$ )&fo$0fo$@D$,fo$PH\$0fo$`H$HD$ HD$Lt$@ILl$I)ŝ&)%Ν&)-ם&)5&)=&) &)&LD$0 L1H LhM LH 1JH!%tLDHSHDډH~L)HHoIHD$fDHHx.tLxLHHwH|$HPLHT$LuH$HD$ HL$H$(H$8H;$qH9hI9HH$LL`HhH/|$,L ;HL$l$HMLHDD$8Lt$@E1HD$`H$HL$ fDoD$Pfo$H$H$H $fo$l$hfo$fo|$`H$fo$fot$pD)ߚ&fo$)=ߚ&fo$)5ߚ&)-&)%&)&)&) &)&EA~Av An0Af@A^PAV`ANpALA$H$D$,ZH֚&H9$dH&H9$(OHD$8H;&=H5&$LE1@D|$L6USHH;F>/EHL AmE1A DLL CLcλ@A_0HQL9r*HH1IH vH#FWHQL9sAMFAukDƒfDA0H XAf.EHHH[]fH0HQuA0t0H1HiHL$H5HHHfHL$D 7HHH[]@AHHAtHuAHHAuAA#A6jfvH0HAuAAE#)ƃ0@qHfDEHL AHAHqH w'0@9Hyf-HH[]HIHHHIHHHH)ǃ0@~HHufH=w fH>DDtD AA!Egfff#))É؃0A ̉H0QDAE1@HAA-fDHHA-fHHqHHHHHH)ǃ0@9HUSHH;F>/EHL AmE1A DLL CLcλ@A_0HQL9r*HH1IH vH#FWHQL9sAMFAukDƒfDA0H XAf.EHHH[]fH0HQuA0t0H1HiHL$H5HHHvHL$D GHHH[]@AHHAtHuAHHAuAA#A6jfvH0HAuAAE#)ƃ0@qHfDEHL AHAHqH w'0@9Hyf-HH[]HIHHHIHHHH)ǃ0@~HHufH=w fH>DDtD AA!Egfff#))É؃0A ̉H0QDAE1@HAA-fDHHA-fHHqHHHHHH)ǃ0@9HATAUSHdH%(H$1H@x.HHD0xHމ}Hu1 @H$dH3 %(u HĐ[]A\7AWAVA@AUATA@US1HHt$Hl$dH%(H$1I@I|HLD HDͫIHt=HcIcHH9|)LH$EIcH$ICD9|D)LAHcIHcADHD$HtQL(H$dH3 %(uCHĨ[]A\A]A^A_LHD$HtHLxUHSHH=%dH%(HD$1t}y!HD$dH3%(u|H[]f.1HTu<$ftt$ft t$<$Ht$EHtD$DH=Z&p H1Hf.fAWAVAUATUSH8|$L$DD$dH%(HD$(1HBHH6L6IMHD$'E1HD$Ht$|$蕩HEIWH9w@HHH9I<$HHT$ٹHT$HII$HUD$'C>I;D$tzD$DMcpHt$|$کuAEMtE~ C.HHt$(dH34%(uxH8[]A\A]A^A_LfDHcDAH:HDI$DHEfDHEHuAEvIfH#HՁA<.wHE1 v<.t*HЀ 0K HLHHu҄<.uGH1E1Lcلt4DXA 0OHHNPHLcلuH/JcLHt McMLHtLf.E1<-HAGL HGHfAE1Ht McMLHtHfDHt McMLHtH1fG5<IGHt McMLHtL1E1E1}@HXdH%(HD$H1HT$ 1HD$HH$HD$HD$ ¸xHD$0H|$8HHL$HdH3 %(uHXfDH(11dH%(HD$1I1H$1HD$HT$dH3%(uH(AWAVAUATUSHHt$dH%(H$1Ht?IuF蜵HD$H$dH3%(HD$HĘ[]A\A]A^A_fDHD$`HÉD$|HcD$84HD$%l$D$<BHD$h1L4$E1HD$@HD$\1AHD$HHD$`HD$0fD[HcH,$DeHtaDH5DuEH<$4P9~5HL$@)H|$HHHcHDd$\HHvDeDDd$XMcXDDLd$H|$=u&D{~/MH=zD<fDH<$DFH|$ HHD$(\HL$(D$ H*D$ |$|$g|$@|$ND$Aǃ|$8T$XAKAtA u#׉T$ T$ A$A=a&~MH=t&@;\$IcHD$JfDT$HL$01HLd$`)HcHaH|$8eAAT$HL$0H|$XH)Hc^HPHHHt$XAAut$ t$ @,H=AA4$t$<4E+|$83T$XAT$ T$ HDHX=GHcT$ H2fA&@Ld$`KL$<Ep|$8AT$XHDH=T$ HcT$ HfDHL$pHT$0HHL$ HL$ IHc~DpHLEjf|$8AA@UT$XD$XA6_A4At A t$ t$ t$ .t$ {@AtA tT$<E#|$8T$XAifT$LD$`1HHL$0)LD$ HcnHsH_NLD$ LD$`AD$<EAAfT$ GT$ DDHLA)HcHAD8|$8+E|$8T$XABDE1A fE1AA@T@Bf.At$ bt$ D19ƅE1f.fD|$AWHD$AVAUATUSH dH%(H$1Ld$1HLHL$HLHLcLLHH l1ҍ{ILLH ĐH$HD$H$dH34%(uH []A\A]A^DHHH&&tH=&HtlH&&&HHv#Hw2ff>@@>fDϸ>DAHHAw)H H1HDH |H1f Hff.w@>Hvp1xÉHF?ȀF?ȀF ?ȀF?π?@~ȀFhHF ?ȀF?π?@~ȀF&?Hπ@~FfDH F?π?@~ȀFHF?ȀF ?ȀF?π?@~ȀFxwf>H1ff 1wH1҉f f$f-(f~fFfATUHSHHPdH%(HD$H1HwH&&1HHuyH=&HtlE1111HLd$ Hl$L$$HD$HD$tH=e&HHT$Ht$LD$VHTH$LH $D)HL$HdH3 %(|HP[]A\H=kjCIH8.HHHpH=~&'d@H=~&~&lHt=m~&UujH5_~&H=ҷuLs~&HHg~&N%f~&ASCII= ~&Uf~&tH5tH=}&>H~&HtQ ~&~&>@HH1kfD'LH=}&l}&H5H=H}&f.DAWAVAUE1ATIUSHdH%(HD$1H$kA $trE1L5HIIA $tPʸAu1HcHLHt#Hr L<$IL<$IA $uHt$dH34%(LuH[]A\A]A^A_fAUATIUSHdH%(HD$1H$A $tSL-HDATu!1HcHLHtHsHu3IA $u1Ht$dH34%(uH[]A\A]fLVfDAWAAVIAUE1ATUH-CS1H(H4$dH%(HD$1HD$HD$HD$DHcI4t/A=W&~uDt.@D9~H|$dH3<%(Du\H([]A\A]A^A_ÐH$HL$1Ld$H)HHsHu"f.Ld$fDOf.DHAWAVAUIATUSH_H?L~IE13IcLHcH)H9t?w]IAIt0H{t%HkyH[]A\A]A^A_@HL)HH[]A\A]A^A_HHL)[]HA\A]A^A_1øf.AVAUAATUSHHdH%(HD$1@/=&~wH$L5(HIHuD9tDHI)tn AuLHH1HPHv D9uH4fHD$dH3%(u?HDH[]A\A]A^f1Ht$dH34%(u H[]A\A]A^\f.fAWAVE1AUAATLcUMHSHHT$LHD~)Å~$HLcHfDu&AA~D|$A)HD[]A\A]A^A_f8tAf.@HHx&t H@Hx&蠅H%x&HHPHx&者H%x&HAWAVAUATUSHL=H%H= %H=fLL5wH=TLL-QH=BLL%H=0LH-H=HH5H= LH=tLH=eLH=VLH=GHH=հ8H5H=ư%H.%H[]A\A]A^A_ff.@SHH=Yw&HtHu2H?w&H"HH{&A[w&1HHxHHDHHv&HDHv&SHM&Hv&H_&Hc<&H#v&Hv&HtЋ59% v&H=v&tH=_u&H_Ht&ugH=&tnə1-1҅u&Hu&HhHxϝHHH[H]A\f.t&t="z&]VH=%uHG%H9%&t;&~p5&u.9& s&x&t &uHDs&tHϯH9t&u܋h& &uH/J9& Vx&良l@ .LfDHEs&&&&Hs&ff.Hs&Hs&ff.fH0.Hr&HH@HP @(*HלH=r&Ht0H@HG Hmr&訜H=ar&HuHff.@GAVAAUIATUSw D%Euhr&HcHL<E1<%uH%H9%u [D]A\A]A^Ðr&&Hcq& yq&Hzq&r9J q&@I[]A\A]A^PYr9@H{RH&q&Hcoq&H[HHxnHHHu9fDLcMcL;%\%Hcq& p&L-&-&Hp&r9zJ p&@,Hcp&Hp&=o%H p& =\%R&Aԋ=p&H%p&7&AąuHCH;%tHp&v&C=v&KR3fDkE1[]DA\A]A^@H{i5%ƒtH%I9JHc p& o&Ho&r9J o&@,HC &L% p&Hl&tpA3I%~ A\Eu 1IH5&[DL]A\A]A^QAtA AAEH&h LhHHP҉PH ?o& Hn&HHc n&\Hcn&Hn&fIHn&8EmAfI+[L]A\A]A^H9&VG%5%Q/@H&h HPLhfH=m&H%H,n&Ht#HG Hm&ЗH=m&HuPA@vnHHc Am& Hcm&H6m&fHHc m&ܖHc]m&Hm&_ftH&Hi=%ukf@@HDXt tH%|  j&19j&&Z=o&5LH&Hcj&HfDbj&9tu&f.=o&K(=)j& oHff.Ha&t1Hƿ!AVAUATIUSHH;ū%tCHcHHHD3LkHS1H=&D3Lk[]A\A]A^@@HDXt H<[L%&L1]A\A]A^DSHttHu0u[ÐH߉[i&t8hHh&h&tgHL&븉VpMpff.USHH(u2 n&H h&Ht@(H[] S Hsŋm&y9fHG Hg&H=g&HuH%h&H[]Ãt{HC Hwg&Ht h(eH螑H[]D xTSHs @=m&MIuVfD=l&%I!KJHHf&Hh(fUSH=Pg&Hf&_&&[&Hg&;&H%f& H%Hf&.f&˼H1[]fHf&H f&HHif&HH=f&H&H&H=e&H跂5%Y<1H e& uH=.&YH=%M=f%pH=%4HM]H&H=H-H%HA%H)HR%HH=H!% H=4h&H- %}h& sh&uId&UHd&HtHOe&he&HHH9e& @;f \fD*&D&-M&)&f.H=Y%TPH,&Hd&=DH,&Hd&DH *&H*g&DH9%1H=vfDH=NbķHHc&Dc& Hc&=c&SyH5)&Ht=Jc&= ,&uL@s&tHH(&Ht,@HtHMH[f.fp1H&&G&GHb&HGb&G Hp&HGHb&HG Hc&G([&G,H%HG0Hb&HG8`%G@[%GDHUb&HGHb&GPHb&HGXHb&HG`db&GTH"p&HGhT(&GpG(&GtHMe&HGxH:e&HHd&HHe&HHd&H1øH&G&Ga&HGHa&Hb&G a&HGH[o&HG Ha&HcG(Ha&G, &HG0HI%HG8Ha&G@%%GD %HGHHa&GP`a&HGXH}a&HG`Hja&GT)a&HGhHn&Gp'&Gt '&HGxHd&HHc&HHc&HHc&HHc&1øUSH3^t]@H=a&詋uH[]Y^fUSHcHa&H a&9~$SHcHH54`&Hc茲DH[]Éߍs ;)H)Ɖ5da&Hc訉HHVa&ff.HH D`&@lH%7`&aw &HH`& 1HfDHÐHo&_d&DHH _&@lH%_&`tBaw"HH`&t&1H@sHf&&1Hff.fHAo&c&bfU$SH ~&H(P&H@HH PX@ H[]Ðf&9<&|ÐS:,&Ht p&t&[fF&9u&[&ff.H5&H=]&&Hf.H觲Hv _p&t-&HHfHtt_&~ H^&Gw )ƉǃfDAUATUSHH7tDH=+1DH%]&H[]A\A]o H=臲HɻDIHBD`WtC;&~&-&bH^&Ht 8=g&5Q&TH=]&Ht ?1Aw H==#&5 &H'N1 w H=ݕ豱Ht|Y5پ&=&1MYVCɾ&@cHB&U9{+95]&5&DX5&=&"MCIUDJu \&%#%H $%F\&Z&%%H %%hD1X[XfDAUATUSH \&~`AA1fD[&A9tBt^-8&[Ut-[&9-"&uD[&A9uDu [&u"H1[]A\A]Dc~}[&WT1r[&H[]A\A]xHcHH%8t9$0 wM/Z&t %P}% Z&ÐH )H9Hu%X%fDShc1[ff.fSHH=Z&gqZ&~=H%Y&;HgZ&5Y&[Hei&]&鶠fD[H%OY&ff.SH?Z&t~ 谗Z&H1[ft$ Z&-Vt$ UHSHH X&@eH%X&x>'Hv j&tH[]fDHHߺ[]gfHX&HPhHH9uH%VX&D%i%%Y&=%5%%fH%=%Hh%BW&5p%f%=X&uCt&HH=贬HHfDff.@t&HH=ĐtHHfDff.@5>W&ATUSu%%%|%&=%iKRtNIaAuHW&Ht 8:H5C%>[]*&A\HW&HtҀ8tHǍ]ASt5Ҹ&H=kW&AT4ևuS &R1&[]A\ÐH1W&Hf8]Iȋc&~1HV&H8 &1jf.HV&H8DAQff.@7THZU&t1L1HD1$L1HDUSHU&tB裬&)؅~H1[]D11跩H1[]fD1衩H1[]HNtnu971HfN61Hff.@S/t$?u7ʥ߾?n61[f.諥߾/o61[x1[ff.@S1B8d%%%v%H%HX%2S&T&u1[@;1[D!&L .S&EP&A9SfHcA9A @ƀ AÀ At>BH2&A A9@H À ADt@uр AÀ At6BH@t,DR&A  €  A9Huكt$&A9C1[1ff.H55R&te&Ѕ~XLcB  tk tfBD< tH< tDBHDH t t H&y &u1fB&tHc  t u-HD‰X&~ H t tq7&ff.DA&H5NQ&EHtpfD &A9~_Hc< t < t  &A9~;Hc< t< u(AH@&A9~H t tu u1Hc&H t u*HcfJЉm&A9~@ H t tރHH t tH-&A9 "&xDAVAUAATD%(&UEt$SH.P&ED-&A9ܮHcH0 HV_  „tLA9UHc҄t<@& HNu#_t < @!A9@H@u< t< u=A9~8DEHc)HHLHH9t!& t tAE[1]A\A]A^A9~DU)HcH|ڱ& HNu _jHH9uAff.AVAUATAUH-N&SE4&%HcDlDtA tA tA ]A SNHAAfA_ AQA_ft &HcT t u-CHfÉа&~jTH t tA_tHc%TQu%_t H t t{q&yD=b&AE[1]A\A]A^f7f7A_-CHx&xtHqu@_t@HcÉ&DtDlxhUSH&tD迫@ՉHDPuH1[]H1[]f.pH1[]f ff.xhUSHd&;7&~=8@ՉHDPuH1[]H1[]f{pH1[]f f|AVĮ&AUATD%ݭ&UAD$S9L-K&DwHcAD< < j-v&A9HcA\ t u.EHDPʼnE&A9~pA\H t t/H0FEH_u'A|~u,@_t&H@ t@ tPʼnۭ&A9fDʭ&At AA9[1]A\A]A^@-&A9,E[]&A\1A]A^DEHPʼnm&A9~A|H~u@_t1DUSHxB9@ՉHDPuBH1[]fH1[]f{nH[]ff.@ά&;&S}EH5I&Hc t2 t-T t tEE&~&*tq=t|\t1p1[f. VjX%%t%j%Hs%HL%&I&J&t71[*j@?i1[fS/% %%%H%Hս%H&J&u1[Ð1[S4%%%%H%Hz%TH&I&u 1[fD[1[S~޿1[ff.@ =ff.fH%57I&H%G&u1H1H%5ȼ%%%H%H%lG&5H&u 1Ho1HH H&uNH=/U&H&Ht,ƒ׃Au"#E U&H@CufD=ff.HJ&~ ${H%HV%F&@t "F&u%H F&@1H@@E&tf0u=%u F&t |ff.ATAUS螤@HDPu5&;5&|BA\$Etq3u0z[1]A\fH=iE&&f&t;(&t 1HHv W&t-ا&1Hff9=Ҧ&|1=&H{1Hff.AWAVAUATUSHHcFHD&y&K&D=h&D9~ D=8&DD%&L5D&A9AHAHHf%uhAWAA9ߋE@A9@@t E)ctdA9} D%Ȧ&&At &HH[]A\A]A^A_eDT$ H $3H $T$ H&/E $HÅxH=?&hH?&HL$dH3 %(u9H[]A\fHt$DcE H$@ATAUSHdH%(HD$1HH}>&&Ev&艜AHDP&t]>&cE cm&D+&sH=>&H%=&ÅyFa:DH=&tbH H=&/E $HÅxH==&/gH=&HL$dH3 %(u9H[]A\fHt$DE HMđ@ATAUSHdH%(HD$1HH=&/&E&)AHDP)&t]=&yE y &D˞&.rH=<&H%l<&ÅyF<`:DHI<&tbH H5<&/E $HQÅxH=T<&eHD<&HL$dH3 %(u9H[]A\fHt$DE Hd@|USH&tP=ݝ&Hv M&tU;9&N&1ۉ,&~;Ȝ&tJH[]Ð_H[]DH=:&[=]&4ofAVAUATUSH0dH%(HD$(1F&9&|*1HL$(dH3 %(iH0[]A\A]A^HvL&E1\軘HF$E7D&9} &DIu7_R-f&;-&@]H 9&HcHD,Bhmt(ӊHF$Eh1nDDn낐Hl$5&H=9&HD$HLd$Ll$)q苕D$HLD5&KxHD[61oq&A9~ c&Lc~69,Hc5?&]&9)HH5]8&LHc袍HsLHtgDt$D D?誉tDD$31fmxHc&H7&D4Dt$fDD$E1ff.ATD%s&USEtx~fHv J&tFQ=C&Hv J&tk)߉=+&y &1D+)[1]A\@߉k=&s[[]A\ffH=6&lj&}AUIATAUSH@DKrDtL-n&;-&}>Y[&9} N&QHv I&uLa kF4H1[]A\A]fATIUSH dH%(HD$1HHL7&x\:&E$$HQF&t<t73HD1HL$dH3 %(uH []A\f.Ċ@AWAVAUATUSHP&D$ ,ADl$ L5h5&ANDgEIcIlI@ A@ A DŽ_AEHE HXuLEAD-Ɨ&IcIlI@ A@ A ǀ   葓HYEiAEH#fIT t% t HQuAʼn5&ufAA|$ D&&H1[]A\A]A^A_DIHP t HAʼnՖ&AAfAD-&A{f t A]HcfIlH@ t@ teHhtA݉K&uAA@HPLDWfDIl@ A@ A H.iЕ& &9}:H52&Hc t u"H&9~H t t1Hff.fDATUS;tW,tRTA~ftu#3&3&DD%9&Et| 3&52&*fD52&tN h3&tD؃;E52&[HZ3&]A\yfFu2&2&DAD[]A\f;2&u/H= 3&V@2&5\2&fDHG2&HA&XPH'HA&H 1&2&2&1&1&ABff.AWAVAUATUSHHc&H0&I<[i<{<}<]茅-~&H :C&H0&Hc<[7<{<}<] ޿e &9@<(X<)rAAAD$ @ۄHtB&AEH/&Ic<[~2<{t^<}tR<]tFuD=&1H[]A\A]A^A_f.<(D<)u19sDD;D$ Q@H=Q/&1D'AWD9DAEG|SH[]A\A]A^A_ftfDADAAA@蓃HtKA&AD9=&mH.&Ic<[~<{tR<}t.<]t"u<(t$<)uDu@DDA9kfH=.&D1ɺAWfffDAA޿c-{&H-&Hc<[t~/<{t<}t3<]t/v&9 ADA<(u<)uD="&Q<(S<)tf.[t'~5{t }t1]D@f.(t1)f.USH(&dH%(HD$1tJ-&D$$xxtstn)*H1HL$dH3 %(uNH([],&uHÉ-&D[CH<&HH<&@4@&Su1S@Ǎ|c5߾c[H=L-&SLܠ%0-&tU%%%%l+&L%,&uH,&,&[Hf%1[H e%H,&LAD<uI<H<HHuHHH HH HH9uHgH FH5_=x%HHHHH5mH95P%HfD+&t#HH:&H:&1ff.*&t#H\H:&H:&1f.Hc+&H&ATUHSH5+&J9}GL$9SHc j+&Hӌ&I$HH4ʃH.H^H+&HD[]A\f@Hlj50+&HcHHSHc+&H&UH=c1SHU%HH5# Hs7HH{Hu-1&*&H[]*&uff.@AUATUSH*&usH&H(HtdAE111-DHHHTHIT$HDH<t.IE9AHIcH@RHH~&@E1H LHV{HH[]A\A]HQHH@HHBH9uHSH1Ґ  HLHLHHu[HH gHHfDH HH9uHiHHHHHfH HH9uHff.@HtDff.@UHSH_HD<uH;LQHH9t"C<uH;HH{&QH9uH[]f.SHHtH[PDAUATUSH~HA~A~tcH &&;^tCHDXH%&&uD~~H[]A\A]Ð[~H{D$뺻fUSH#~5Ո&'&'&5'&H'&tD~'&H-'&9}@HtE^H}Hc&H5%&xx&HcDH[]}wDH5$'&Hc4OHH'&HR&1?WV3%t+H=d7&HtuHO7&Hf.fUSHH?&&~tZ&&|=&&|-}HË%uXH;8&`&J&H[]Ðuv4&HH1[]fDq|ff.@AUAATE1USHuuq(5%&H=%&DDH%&|=%&|R|I{H=%&I,$HtE8t0H-q%&tD)&t=)&zf.H({tH-5%&uMtsI<$%&uIHR#&H5$&HӁ)&Ht $&H) &ׅ&H1[]A\A]f$&&ƅ&@3t>G$&&Ȅ&&H[]A\A]fDUSHHG4H=u$&_&i&u%HtdsdH=Q$&H[]nfDC8/$&HttH-^"&H6wHxKHHtH$&FzH%"&H[]t`UHSHHX"&H9tHH9t1#&t.1؅@H1Ít6[])l@1DH[]wthUHSHH!&H9tHH9t 5"&t31؅@H1Ít6[])f1DH[]yuft`UHSHHH!&H9tHH9t1r"&t.1؅@H1Ít6[])\@1DH[]tthUHSHH &H9tHH9t %!&t31؅@H1Ít6[])f1DH[]iufUH  H~=ui%H]ftkt;tat$ Xtt$ Hv 2&Z@uʋ&t&w`D1 uH]{Cfp!E0&E4ǁ&ZH%j&H]@A"@1"H}pIfATAU1S+HAuHC8DcdC`?pH&HS,&:1&DH&襺H=*HH11HiHH&H&HЀH&1t3fHxt HxuH1*Ņy[]A\f.1H1[H%(&H=&]A\S1ҏ1H%&H&[f?E/EwHH=&HtH@KAHÐHH=&HtH@ AHÐUSHHH߉tH[]@H1Ņx1H覎1H%&H&H[]ÐUTSHdH%(HD$1HHxrtHD$dH3%(uH[]DHTIrqfUSHH n8u&HھwxH1[]@H[]@@t@HH>tHH:ttEtEIIA8tN,%u$t>HHπ?u/HHGDtHHπ?u H&HGÐHVI@HIHB|H)]HFYUSHH l8u&Hމlvx1C u H[]H[]f1H=\c H[]f&uÐS:H=&Hr&uJ}&ugH=q&sH5}&&x^H%j&[&:f.H 1&H=[Sw=}&t1"?H=)%j[ff.<&t HH8ty'&t HH8tR&t HH8t+&tHH8u H=YHPH)YHPHYHPH YHPwAUATUSHXD &dH%(HD$H1Et&HD$HdH3%(HX[]A\A]AH=&H3qHlj7jHIHD$0fo$foL$foT$ H&5%D$8)&) &&H&)&t:D%HEHtH=%PHI&5% U&G&H H%& `& 9&R& N& & B& & 6& & *& & & & & -& & & & & & & &f & & & & &t6=%t$T$L$DD$ H=%DR&C&%&D$  &t$$00tEtρ$ʹfL$T$ uXHD$ yx;y& &H=&oH &&eJ%D$ fΊ%UDHH=Њ%KHD&5%fH=9%,AEu _}&nHH=WrH=&)fD:H=)%&[Cjf&=`&ff.@HH=I&mPq1HfHH=!&lm1#q1Hff.UHSHXH=&dH%(HD$H1'mlj.fHxDD$ L$HT$t$HD$HdH3%(uHX[]MABDct K]HB,HD$ B48DsI@Ht$t"]Ht$HA-uA-tA_t9tH\$@Hl$HH=H&zHSHxg'HHPH=&H&?~萦H=&AH (H$&H-&HH&HtH=&ЅH&ED`&EH=W&H'H-j&HBRHx&HHOHHT&zA$.H<&@LQxHHcLZ&H5&HIOH&Hc|8/AEH|$XHD$X8BD$E1!Ht$P=%Hk5%E1t+H%Ht %[&t%Hl$PHct$<H H}IJLd$XLLt$9ƉMEALt$HcILl$Mf.ID9l$<K,HLEHIuHD$PLl$HLt$H8LID9|$<MtLHHD$PHB(/{IFE1Hl$pD8HD$xHD$EXHLI=f.D97AHEMcB HEF< E xKHvD/ &EuHD$pHMELLL$H}DH$螗H}Ht$LDFl(DNjD9SfHD$pHD$xHHJHxUHt$PHHHHH$dH34%(D$<HĘ[]A\A]A^A_Ht$PLHHvHyLt$Ll$HD$PLHpH8GILcl$A}Hc-AD$5^X&H|$XHD$XINaJAWAVAUATUSH(Ht$dH%(HD$1HB5Ⱥ%IH%HD$H{ZDHH|uHL+MHKHCHu =DHVHxu9}$=LHLFI$HL$dH3 %(H([]A\A]A^A_@H+Ht#HH<u %eHHHxDHHHD$tFHsHgIE1Hl$f.IIvAHt(M.LDKuLIInIvHuAHcHHSIHHKADIcHI4H9t HAItHHQHuHH;H9tKHD$IAtHL2DInHHJuH IF1rfHhDI$1RfH HcH{xEH+{fDHl$H@H;H9t{HD$I1H HCIGfUSHHHt~H= %Htr %th%t^2@u@H5%HT$HtCHKHt6H%Ht*HT$HH[]@HT$GHT$HuHH[]f.AWAVAUATIUHSHHD1HtۋT$$1ۅ1(ff.AWAVAUIATUSHHD=%t$EaHD5%HE//HH>IH HLA=D$ D9|"9l$ =)%M%A9D$ Z%;LL&~%H=Ht 8| (L&9Mˉȍ]\$T$T$8D$t7ډЍ@9E9 K&D$G?D$D$D$8%uD%E DJ&EOM}E1MDd$Dt$Dd$ PfA W%D$T$tM|MuHH[]A\A]A^A_ HHA;D$ E1) fDH5% AC>D9uHcD$8KDL$HD$HD$$ED$ D$?HHD$0HD$(DL$ 9L$|$?HD$(MdM~\$ \$81L|$(HcL|$09T$H5E%9 =9\$|?H\$KD=L$Mt,D%LEtnHNjT$ L;l$| k%t a%uK56%D$$L$$tI&9 L$ 9L$8afD$ D$ Hl$0HD$(;D$8HH[]A\A]A^A_fAE1A) DH5a% A&D$&H\$ D$t ET5>&D H{D5>&HHLt$L-fLHI8L0L;#tL#HH;HuH|$ HtHn,%E1H%%=&=&-DHtH&,%H%%k=&Q=&t%1HHL$DLǃLd$ ID$HtBN%u(LH %Ic:DA+H|$ I<$T$Dt$H|$ HL$DLLd$ ID$DHAH=<&H<&%@H;HT$.HIsH=+gL;#GLV:H]<&HZ<& .D<&5;&EuZHH9D%t2\%uHN%t@@ ~fD %uĿ?d@!Nff.?5q;&,ff.*5Q;& ff.USHdH%(HD$1HH9n% H=%Ht)H=%Ht\-:&P%H-%%%H%H %@}%C%%%?%9%% e:&%H= :& %1%=%D$[=%59& D %DD$H%5%HH%H%H_5%H=%}EH=%H%%y%H?t2fDHH|uT%t%y ;%)%Eؙ%~Hcҋ5%H %H<׺Hc%H%H=%HH-%5%H߉7%H|$H5%_=q8&5{%m%}H-%HRHHD,fDH=L%Ht 'H=C%H0%Ht&H%%H%b%1H\$dH3%(H[]ÐxH=%HoH=%Htj&H%%5a%H=y%H R%)ATHUSHdH%(HD$1H%H9HDH9H=%Ht%H=%Ht%H$%%%H%%H 8%@%l%%%h%b%@% 6&%H=56&%1%=%D$$=%56&3D %DD$Hً%5%HH%H%HH0H=%*5%H=%f%Hr%H%%P%H;H@HH|u? )%tn1H{5%H %ƒH %L#L&'%A$H=%%8uL)S% %5%bL%H=%]׉=l%_W5@%HP%H 1%H8 @=B%GH#%Ht %}H=%Ht"H%q%H|$H5%=3&5%%~%1H=%Ht"H=%Hv%Htd"H%%H^%%1Ht$dH34%(H[]A\DxHc5%H %H;(%6H="%Ht!H %%fD%}% %5%H;e%b$uDATUHSuiH=%Htp E~%H%Hy#HxHHI"#L%%L)%M&D&HHy%Ht|Hcu%HtH=w%8uH uH#HxkHc=@%HEH߈H!%H0 ="%~u %H[]A\fD'H[]A\f.AWAVAUATUSHHŃ1L`I1ɸSwR֍AA\HcA$20LcZ0@t IA$HDHH[]A\A]A^A_"ƒ\A\\e@ff.\CE-ALufEA@LeM+L8CotF)HBDCDou3wM7fDt#.+IHB(뻐\C-?@@1Ҹ"ff.S1Ht?u%1[D1 $$I1k%[DdHt?u %1@H 1#H‰t%1HfHt?u O%1@H 1#2%1HS1Ht?u@%1[D1 T#I1?%[DHHtCH8u*1Hf.HǺ 1#Džy+@fSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1 H$H (%HD$H= HD$ $D$0HD$'%uTH=%HHھ H5֒% H=Œ%`#HD$dH3%(u:H[D9%H :%1HH=%('%t"H%%H2%1H1H= ~1HSHt?u=%1[H5 Ht]H5HtJH5 HtH5HtH5 Huw=%[Df=%1[ø[ff.Ht?u@SHH==*&HtH+HxHH[H*&1ff.AUATUSHHHc% %H%r9|.HHHc \%HcT%HQ%r %5=% -%@t?< < HCfH  HuL%q%MtH57 H H5! H u@HH5H 9;%%H1[]A\A]fDH5ь%H%H1[]A\A]HL%%MI`LhHxLIH-LHtHLH=tH5Z%H*@L@-%UH1[]A\A]%LHcy%Hv%r fDH5{H1҅9:%%fDSH5AHtCH5Ht [@H z%[B:%H G:%fDH Y:%[":%H ':%fD%tB~&H%8t(H @H8tH9u=%%1fH1H= 1HHVH1DHH9t zuH9:uHHH9uff.AWAVIAUATUSH(HT$bE1I1L= ED@;>A@DžUMcHcKIt \uDžAT$CtMuA| -tOЀHAIc L>@H=]HcۉT$L_"3HcT$HHHt$DptHt$HcT$H AA ;tHcA|@DžDIcILHD$D1H([]A\A]A^A_MEHEdA?tAT$!A̋T$H0DHL$DNt.HL$T$H@AHcA|nfAHcA|UfAHcA|5fAHcA|f\AHcA|f}0HcL1DFA}DHcL1DFADHcLA9 AHcA|} AHcA|ef AHcA|EfAHcA|%f AHcA|f AHcA|fT$@|$|$T$1LAHcAtMLDCDCEtnDNDAwEApAHD@;AHcA|UfEAnEHAp@AG@;AA9 4%EtH 5%HA|\t'EHADȀJAEHE1A|CuA|-uɍEHEdA?t:T$A̋T$HHL$DHtNHL$T$HȀAHcA|DAHcA|-DȀff.@AWAVAUATAUHSH8dH%(HD$(1H>HHHL$DD$ H|'HT$$HHIHD$OD$ D$$E1E1DD$ HL$mD@@|$ tLs)|$ HCD$$AHKMt#EL;5%tDLE1H N!&IA9}uA]{w 2%tu HHcAHH;A9V@@tfHD#IHCD$$H &A9|H|$Ht$(dH34%(D$ H8[]A\A]A^A_A9#HKHEuHuH-$yH{HL$DD$ eHDD$ HL$OD$ AbH8UH|$)D$ >H 1%HH1HdH%(HD$1x2WH 1%vCHcHHȀ8HpH &1HL$dH3 %(HHc1%u=HcHHȀ8u@|H1DHD$HH 0%@u$HHHHp1rf\uD$\f.1ff.@UHSHHtHHYH1[]SHT0%HM0%HA0%[ff.@SH$0%H50%1fH0%[ff.f1EDHHH1ff.f.AUIATIHUSHHdH%(HD$1H|HT$HHHu8LHL;HL$dH3 %(u H[]A\A]fDHkT@SHH=I&H;u3Ht O&H&1[Ht HH|H&HHH&;Hc&H&1[DHt6 H&1[&ff.fSHH=&H;u3Ht E&HN&1[Ht H H|DH &HHH&kHc&H&1[DHtf H&1[&ff.fUSHdH%(HD$1HH@ HxHHH H=%Ht 3@"@'D$< HC @H@ tT$HuHH H|HT$HHHk%>HcD$HZ%H1H\$dH3%(utH[]DD$CHk@8tKtGHC DnT$HH@8uSDHHCDH6+ ff.SHH=1&H;u3Ht&H&1[HtVH~ H|H&HHH& Hc&H&1[DHtH&1[v&ff.fUGSH\M%-@f s%t.A\t "H L%PB\fe2%\H #%@4HcHH %[]f.z@ǀ|$ \Cع%-fϹ%*|$ H(@D]H<@D] HH< t;E1@eO%\H C%fD\C?)%-f%H %f.1H %DL@dH Ǹ%Icff.@AWAVIAUATUSH(t$  H<H)H^AIIńuR\MAE-Im$fAuM}tZ"\tE\MoIAAtJÍPvtVvy"M}L믐eIE\MoAAuAEH(L[]A\A]A^A_DM}AE\eItMIhDL$ AE\t C-ImM}@fAUHH8OH|$tpHL$>HL$H|$HD_kH H\CM}AE-?fAEIt3HL$HL$HHH5ImM}R1TfDAWHIAAVHIAUATUHnSH(HHEHD$1H $~<u`1H}1ILL$MH $HILEEH=%H1,LLHE<uML0HcHJ1HT$HL$mHIHL$H<dLHIHT$LI|LHuLD1HLWH([]A\A]A^A_ÐH=%H16tc1IDHL$HcHT$LHIHT$HL$IDH\AD eADBfDnIff.@SH53Hu,$%HtHH=HE[@H5HYH5HD[u%H5\HlH5HUD"u%H5H7H5H xH5H H5HH5HD#%tgH5HH5HH5}H1H&H[HHDD%H 8 H=%\ H%[H)&H[HHDf#%H,mTHH=[HD@H%H*1HHHtnHH=%*HH %#%[f H eE&H=ڱ%A1 Hɱ%[H%%[H I"%Hb%H9H2$H[HH;JdHBHu!%HlEHH[HDH.&H[HHDH&H[HHDHk[ff.ATIUSpH&H+Ht1HHHkHtH}L_uHE[]A\f[1]A\fSHHtAHHSH1 @HH9t zuH; uHHH9u[1[fHHHD %HtiD %Hu3UDDHH1@uAHAEtPHOt$yEtH@u3f1D1EuHt2HADHtHtщ2ff.HtWSIH1LI#HHH;s$uH;$t[@HLL1[1ff.fHdH%(HD$1@|$H|$D$dHL$dH3 %(uHf.HHQ%dH%(HD$1@|$H|$D$ HL$dH3 %(uHCH%ATH5IU1SH$HHsHt@LuHcHZ$H5HTmHDHʶHD[H]A\fH$1H5fDHHsHtL`uHcH$[HTm]A\HHHuDJHcHـ9EA t A u@IA$< t< tLf< < HCHSuH1L-M$H5@IIuHxLouHSHTH9r  HHyt H9wAHLE1NjH@k@ t@ [H+@D@ t@ t3B< t< {HHJH9sj :HcL$A$A"HcH -< %HDfDH  HuLcAE1IE,$1SH{ t HC HH t tIt-HcHD)fDH tf ta4IDŽuL-f$E1H5LHH3AHHtAƅuMcLICT%FAHL<At t uHDDIDŽuH t tbL-p$H5<IIuHLu@"VSLSL[LЉхtT\:"tF~HcHAхt3HcH)LH)D\ A"tQHHAхuLDmD$  H9HH=1Ab@D$ LDl$D$tHID8uH%It$H|$DytA$ADAMcHcAI E,$HH=1E1AD$  AA@HH؀8ApHcHхLDHmKHHxgHCtCH1 <"t6Hc1DHHH<\t@tHcHA$L't+"t&H %H1HhHftHID8uH]%It$HHH1^LbfAWAVAAUATUSHHdH%(H$1H=%5%EHHH1H1ADžLl$0I#I}LDHIDIIEj%McHMAEI%ME%LA %M9fI9KHAD1H)ǀ9 ufHx tHI9uLH˄< t <  H)؍,t< t< tt <#tH.HcŃ$%HLL9fL1%H$dH34%(HĨ[]A\A]A^A_H=%H9HtHHxnHHH%L/:HHɠ%t =%|a.L1 =%|)=%|:DHHËHHt3?uH=1H=t=1Hf.H=ɞ%HuH=HHtfD1HÐH1%tuH5%H5%HH QO%H %HD=%ucAU ATUSHHL-"%-%D% %HtuH%L-%D%%-%H[]A\A]fD1ff.fATH5,XIU1SH$HHsHtLuHcH$HHt([H]A\fHHt H %1҉HfH%N%H9t$Hy$HfHH9ztHBHuHnW@HtH=@ %ff.@H% %@ %tuH& %H %fDHM%H %f %HVtHsHHEDATUSnHtNHIHt6HXH-H=%H1HHKHu[L]A\[]A\ff.AWE1AVAUE1ATE1USHHH|$H4$D$#f<PHIILH$Dl$ H<uH$HtHtH|$HHD$ HtH8HDIcDl$@HDl$HH HHL$(HD$0'M4/HHI/H;HP;Hx袿IIA;|$D$\"D$AFAH3LAH;&D9d$kD$ Hct$LH腿IMDH$HL$H9LD1A\$H;\$PMcIK,KDAIuHHL[]A\A]A^A_fD$A\AFAFH[鵷DUHSHH ۍ%@薚H%΍%El$Hv ܟ%t,%u H[]Ð= %EoH[]@}lHup觜ÉElAWAVAUATUSH8HcLwPIHHM,AUAG{IUH ,H9H ,H9CH;$H;$&H;$H;$z q Egl$fDDglHDHt]AG1ҨE9IDzH!A1GAlx߃~VG=wQ31hEgl1pD1ȓAh6AOluAOAGQ9Hg5c%YA_pZAqOArIp{Ht$1A\pIcWIwHzA9IcGIWAOAGL$AGl!u ȑI1KIcW8IG1H#$-%Ao9-%H=Lj%+k|HvD3%Es]9y%~=H=%+kt$=Hv=%_9<%ÉIcWAO)IG|9.9HcՍ|HNHHH5 %DBEG6@4HIGIcWH9uIcW% %9)AwIG| 9Hc)ˉIcWH=%DBEGHH?@<9r%IGIcWAOAGL$%AWdAGdAGD$AGOL$D$AG2D$HcL$EEHL$ ÃD$,LL$(EI@D+|$Hl$ 4@Dt2I~IcI8EndEuE9u΋T$(IcFdMcN`H MIHHL$N$YfDDu_M~MI?I(I~@HAAHtI78;T$Ld$AEn`uE9n(tMD$AG<AG%HLt$(L|HcRLHIHHD$LI<LpwIE14H|$MI)DDT$\LT$PfLT$PD)DR1ft$\H|$1ɉlD$L%%Mt*Hc%H=L%%MttHc}%H"L%[ L%KH|$BH|$Hx?Ht$(HHD$mL%lE1E1111ff.ATUSHH=y%Ht4H=y%Ht#Hy%1Hy%y%sy%qy%Wy%my%H; HHHHxL y%Ly%H y%Hy%$DeE1HE1E1Hx%Hy%H=x%DeHx%1Htjx%x%[]A\fHx%L x%1HLx%H x%1Hx%Hx%Ht H [dx%bx%]A\fDHH=Is%\6s%HÐH8%HHtw%H@w%(x%~w%HtHw%1DAUATUSHH=r%Vx1H5el%IL9uf.p%99=%AUATAUS)H~U1H5 l% T9uHyH=2%8Vp%D%Kp%H[]A\A]@H=A%Htހ?tD)Å~1L-% H=%Lٽ9uff.@GATH5Xk%USw2j%H=.k%a[]A\f.@ǀu̓ tHAH=6A@EPHBD`ܻH5j%HBufHH=7H5j%n2HH=?H5Fj%f@H5.j%@xGS@@ tL~"txHDX@[Du[fD=Qi%É[)@Hm/%HHtn%H@ n%n%m%HtHHSi%H66n%Pn%HHDHm%1ff.@Hn%Hn%Hm%Hm%Hm%Hm%m%m%m%m%m%nm%m%m%dm%m%m%Jm%hm%^m%(m%Jm%@m%m%DUSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H=l%H$$HD$HD$ D$0HD$HHHc5l%IHI l%Q9HEl%H/H=ul%H9t&Ht辸H=Wl%Ht譸HJl%H=Sl%H(l%1L k%Ll%H l%H=k%1Hl%Hl%Ht H耻‰k%,%1H\$dH3%(H[]fH=k%Hck%IIغH$HHk%HL$HL$ HL$ k%$qHD$0HcUHk%H j%:k%HH*k%WغHH=j%HtGH=j%Ht6Hj%Hj%Hj%Hvj%Hkj%Hj%Nj%Dj%j%YL\$ u0L1DDL|$1HcLL\$ HcLL=nn%fMt$M}I9KI9BAEA:D$2A1D< DEIII9I9AA:tEE1E111LLL\$ |L\$ A?t|$~5m%W IA>|$~ m% I9D$HF|$ LL$fMLEI)H)A)L$ED$(A)|$l L$Hu_%9D$(_ +D$(ADDE΅EI k%C9}H=%_%;D$H;D$Ltp %A?D=#Z%Em|$ D$(91_%}H=%HU 1D$"HrHnD$DHD$;}|$~D1l%ED5e^%DH$dH3%(HĘ[]A\A]A^A_%D%SY%EjD$H;^%W|$ -k% H%HcD$H9B~HR<~L\$ L\$ Lc|$HD$lHt$H$HL\$0LHL$(HDŽ$HD$ L\$0HH@Hz Ht<|$l?%{GoL\$0蟱L\$0A[H5X% L\$ L\$ ]%\%A;tHD$t AfDj%5DD--%EAD+|$D94$tfDIݺD9|$ |$HL\$(|$L\$(j%D$(D$5\%9ND$HA$\%DUW%D$8E3|$ LL$MLEI)H)A)L$EA)|$Zi%[%|$8~;[%u K\%H|$t$0LL$DT$@H)LL$8DD$L$Lt$ L)LnL$DD$LL$8DT$@)ËL$H |$h%DօH|$t$0LD$L\$8H)DT$ LL$DT$ LL$D$L\$8DEA…zH=%HACAD9U%t%Z%3[%DZ%tL$EDHy|$L$~h%AD56Z%D gU%EM)L+d$M9Ht$DDL$D)L$CD1L\$82Z%|$L\$82Z%tg%v Y%Z%L$8L$8 Y%DHD$pL$HD$x9 $D$EA;HD$pLl$LE1HD$(HD$xE1MLHD$0QD1ɺLD1ɺLHcILHcILD94$;~LL$(HT$0ELDLuAAMD+|$E)mfY%t$()B9kDf%eDA؉ZHD$wD$DYX%|$EDJX% e%D$H9|X%X%X% XX%9T$H%5GX%)HcH;T$0y)Df.M)L+d$D$DD)T|$ce%~tA55%t|$L9|$H} R +W%HL\$ vD$DFW%|$ED7W%|$tD|$D d%Et EHD$uD$DV%|$EDV%lD$H ~d%\=ZW%NW%@HcV%H;T$0.0W%A)D=zV%D-nV%ED9V%vDd$(Eh|$GHD$tD$D(V%DA5c%fDHD$tD$HD$DU%EDU%p|$ LL$sMLEI)H)A)L$ED$(A)Hc%L$HL\$ U%tDV%Et A91DLbH|$1DL)=b%%9U%rD$H b%DPU%EHcA6E11HD$L1ɺL\$ H)HL\$ LcLt$`L1LߺL)xL\$ A>HM<1 DL\$ QH=s%Ht ?H=V%H?H5fEH$H=*%H$uEj1DHD\$HQ%Q%EL$&R%D[R%Ex9pHc Q%H;L$0^6R%)ЉQ%GDH=pL\$@DD$8PLL)H9~L+t$L9H|$LH)ÅL\$(DD$ o|$L\$(~-^%DD$ P%kP%D$8DDHL$FHdDH蔞L$ED¹1L\$PH=Q%DL$@DL$@+P%*Q%DD$8L\$PDȉkP%D1HlD$JP%E9D$H ]%5P%}P%HcjP%H;T$0)O%P%HD$L\$0H5SK%AA8藢L\$0HL$(H|$ LLO%L\$(D-O%HDŽ$L\$(HHPL\$ HCHBM,)LLL\$ LHK<#踥L\$ Ht$LL裢|$Ht$LI,$G9"H;%HHJHc)HHHT(HH9uALcL\$0E1LAHD$H5"J%<HmA9DL\$0A9_~GAv!HcbDD$DcHH$DD$Eſ A3bAuH=%EHt?uD$lD$kH$Dl$›DD$H|$DL\$I)D $M%9L$L\$NM)݋a[%DD)HcM%H;T$0,*N%A)D=tM%M%;D$(tf+D$(A|$DA؉臝|$ LL$MLLI)H)H)L$EAA)|$DDAf.AWAVAUATUSHxdH%(HD$h1蹜D2H%HD$@Eu(HD$hdH3%(Hx[]A\A]A^A_D&H H%H=xL%zDM%EL%+L%E1L%L%iG%Hf %lL%HHD$lHM %H8t L%H-K%H;-[G%tH=aL%KH-LL%HtDPL%E-)L%~3DlAE9 %HD$H5L%HcDJ< Mc HD$B +-K%-K%HcD$@D K%1E1$H %HPHxHcPD K%HDL$耜DL$\$E1 %Hl$ DD˙D$ef.5X%uK%8 H %HRDD-X%EuDYK%E  %)IDE9|[D=J%MtE19D$uDJ%D+J%ED<$Ih_H %HRDf|$@AHl$ DtJ%\$Hc-%HD$~DW%E HD$\IDLl$D$0E1ED$<HD$HA9_HD%Mcԃ<$FD~zD gW%EunH|$ H|$#|$\?%GDD$ L$LT$LT$L$DžDD$ IljD$8f5Z %S9%D9u I%l$DF%EtD kF%Eu D9%HuMcE1H% F%6F%LAD-E%CF%H:1|$@5E%~&DF%Et(S% F% E%<%E E%9~9&)Ӊ9ŋ=E%ND)qE%HJ%H0LD%E%H=y@%謙H-%H%D%5@%H%H%t VE%1uE%E%H%9@%"L-%DD$,5%HcI}T$ L$LT$;iHc5%IEL-%I} iDD$,T$ L$LT$IEHb%L(f.DA))‹%)A49vA9},KD= JL9LD HH9uALcL<$Š%3aQ%%Dd$H|$HHL$`D)IcH5>%Hc%HD$AD$8_G D5j>%DCOL=H"%H8H9%ACP9HCMcE1HcLDHK|=H 1ٜ%AF9D)L5%AAFI~H9B ;AHcE) LcDCOL=DAFA^A9.%PDD$L$"L$DD$H΃@LBDxtDD$蚎DD$HB4DMcCtD95Π%LcL5%AFI~P9LcBAFI~H9MD$0E1BLcD$8CL%D)AA@Ixp9HB43D)HcAΉ49KD= JL9L HH9uVCD=^AF9%DC~A?@L5%AFp9MIFI~LcFAFp9D$0A?BT@L5%AFP9IFI~LcBAFH9AFHH4eIFHi%HxCL=AD95%~!%LcDAHD$`D$8HD$H=Q@%DDپ %D))fD-@%E9 H@%\$,EDHD$0IDA9DLlD)9;%}AH|$01ҋ\$,D;AHa%EEH@D,JfDL$ A@HH4T$LD$cLD$L$ T$I@H%HxuDDD$ AFHH4T$L$~cDD$ T$IFH$L$HxI~DD$ AFHH4T$L$2cDD$ T$IFL$L5x$nAFHH4bIFL5P$I~T|$8%D$0A >9A9)HD$I I9s3MLM)MH8%AHH9uD)LcD$81҅Dd$ALl$A݋\$8L|$ A2@AIcD,AFI~pD9~]D$0E1AD9tzAD95'%L5f$AFI~pD9AFHH4aIFL56$I~AFHH4aIFH$HxzDDDd$Ll$L|$ %I~AFHH4gaIFL5$ AD981D9A<%E-C D71EE1<%DHL$`H|$\DL$H5*7%HD$`l%DL$HD$H؋H~ZfZ<%l$ D%9H-$EH}HD9D|$EHH4@_T$HEH-$H}hD9=:%EuF :%*:%9T$bT$)ʉl:%L9d$H :$MHyffDEuׅH$HRRAFHH4^IFH$Hx(D)f9^):%P959%D)R%E,9%@2%99%|$ F% 9% 9%9a9%5S9%)Љ)91+H9%8%DEHH4]HEH-$H};H2H=A%$HD$A*8%AfDH$HE11GH$HHt/8%H@%8%8% 8%HtH_8%fDHC}H7%sDAH|$01ҋ\$,DH=;8%1ɺAuD\$,Ed@ HIxHt=7%Lh'LiHʼn7%C9u$L|$HcLHcK<'踄A/7%k7%f.T$EHH4HL$[T$HL$HEH$Hx9 7%D$97%<$=%5HD%)DžZ 6%JfH$1HCLcD\$0MLT$ Dd$,LA΋$%E!6%ALt$ ]9~Y9|UfDHI$HPJc,2H(/1H95%=є%u H߅I95%}D$<95%D-5%D$<q5%D%5%Aԅ5%L-$-6%IUD"D)9|$@eC%x45%9DB%EE9-5%L-A$IcIu賿D w5%E|$@~DB%E^ |$<|$@thB%D$<k4%D%4%}4%AA9954%D9-4%+54%5G4%MHH$I)DRA~H$x H=ڒ%HH HЁ3%)R-3%݃|$@AD$AAA9AEEE1'L=$I?%))Hc5$+XHc5t$IL=z$I?XHD$IL-^$HcD$<-3%IUD$D)==3%)օ;5M3%w)]EH$IcH0{豂Hvi@%2%t 2%P2%9H=3%H=?%HtHsF92%H=2%DP|$@2%D5z2%-2%L-]$~D=?%EED% 2%IED D))1%@L-$-2%H|$1H-$H}L-$-T2%IED D)H$1IcH8蚰+1%:CH=wPH=1%D1[IU)D41%D"D)9 s1%&DE1=ff.fSHDH=%~=0%0%0%x@߃ֿ1u1[fDH=u%HtHyD?~O=F0%St C0%t/r(0%OH=+%ׄ00%[fDHI$HcHJHHc<u=/%M$tH5$Hc/%HNHHcT<);=%wO0%HHHN1Hcx%H5+%|O8f.H=$%S=G/%肾HKCH=%H}H=(%/%HtAHھ|/%~13H=.% Ht=Hx[C=%襭H=%Hھ|N뮐[ʸf.*%t:H=x.%4H=)%c.%1H~fD{fHH=%HtH%B{ .%1*H=Ì%HtHA{-%H=T)%H郂H==)%p %-%H)%)H9-%t1~Й+(%H)%H0%=h.%̀H(%Hv(H1H(%H(%Hf.H(%DATAUSHHdH%(H$1HH}H;DŽ$tHHD{H$dH3%(u HĠ[]A\|ff.fAUATAUHSHHHdH%(H$811H$H$L$$(hH{_HLDazH H9fo$H$foL$foT$ )fo\$0fod$@fol$Pfot$`Hfo|$p)Kfo$)S )[0)c@)kP)s`){p)H$8dH3 %(HuHH[]A\A]H9,$e{ff.@AUIATUHSHdH%(H$1II|$[~HLDŽ$Ht%H$dH3%(u!HĨ[]A\A]@LHy${@HgBH4%Ht HDHff.HD$dH%(H$1Et=,%tt5B3% $t &3%t*1H$dH3 %(JHĨfHY-%H52%@H=+%}H=+%{H=o+%jH=^+%YH=M+%HH=<+%7H=++%&H=+%H= +% $t+%5"2%H=W*%b|1HI*%H5*%uHV1%H5H0%H5H/%H5uH.%H5]H/%H5zHHt z/%umH-%H5OH,%H52H6,%H51ҿH5W)% 1%tHH5v.%LvzHH5V.%,vQ2xfSH"$dH%(H$1t =0%tn$t =u0%t+1H$dH3 %(HĠ[fHH{zHڿH5*%u0%@H|$fzH5o/%H5.%H5 .%H5,%H5K-%H5+%H5I+%H5*%/%vf.HHL$Ht.HH-$HtH=>!%HH3yHtH@"7Hpff.&%D'%u '%'%tÐHH=e(%xH='%xH=H(%#H'%H55(%1.r'%Hff.@j'%uÐH1ҿH5n'%qC'%Hf.USH &%dH%(HD$1t#֔$tt,%%t'HD$dH3%(H[]fD%%~-؃uVD$^?\$D$H|$4CfÀu)D$^@\~HDhtpH뵐D$D$벋.%%ntff.USHdH%(H$1Hc%H %HtH5T%H?%H<%w'HH @uv0uKu8H%%%H$dH3%(HĘ[]@1&5HHvvH|1H1oCvIHAvH11oH[zqމv1HoyD@1Ho sf.#%t ff.$%t2$%r#%t=h#%^#%t4@c:#%u =,#%"#%fS{HJu!*%tH=f{rH[S4vu#*%tH=f@r1H‰[@PXH@蜸k)H%%H=g*%tDcH=S*%uH=M~%H%%H%wfPXH1fHc@1Hff.USH9~){HcHc*EHcHH5%H%nH[]f.5%H%9|;SHlj5y%Hc)E5k%Hl%9~[RfKff.~%H?%AVAUD- }%ATD`USA9EIcD *HA~tHA VA LDD*A< (<  HuH1E11DHL D D9DC@ @ @ E9@H@uA~tT[1]A\A]A^ÐD 1E11Ic̀< ~0H=fDDHHLH^D@AE)A}AHcMc_CH5%LIHHWlC.LLHDDHKHC[1]A\A]A^IcHH4 HcAH4*HSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1 H$H $HD$H=[HD$ $D$0HD$jvHHھH=$jH5$ oH=$6r衧HD$dH3%(u H[mSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1 H$H $HD$H=ZHD$ $D$0HD$ZuHHھH=$iH5$ nH=$&qHD$dH3%(u H[lAVAUATIUSHH6lHHA(l9HH-h[ff.AVAUATUSHH $HH $H@ dH%(H$8#1IKtxL jHHH #v-H$8#dH3%(H@#[]A\A]A^fDHXLt$1#LDkkAI~HL #Dl$D$dlLD$1A 1LHD$fA@ fT$D k$kRif.AWAVAUATUSHH5%H="%H?!%DhMcIJ'$L0LhHIhI|<=IDž!LHvhHH[fL=H=H!%N< \fDHD-\!%A tbEeD%K!%McILI$=H=!%LH %;HD-!%H1[]A\A]A^A_f.H?X=H %HHpPf.HJHHJH9uA AH널E1E1 %&H:H9q [1]A\A]A^fD3[]A\A]A^DDH=3o:ff.fHHH9%t`%=8$1%%$t$=$1҅‰%H$@j%u^$x4^%X%xL%fD>%4%1@ډ$"%%yt$ |$3 t$ |$f1f9t8ATUS މI>19L@[1]`%A\ÐU%1fDxHSp%D5~p%9u=$t1[Dy=v$uRp%[;p%1 ff.xXS)p%C5p%9u=/$ p%t!1[=$o%u߉o%1[9fxXSo%t=C5o%9t=$uo%[to%1f01[ fxXSDo%B59o%9u=J$(o%t$1[f.)=&$o%u܉n%1[ÿ&fDH 5m%1n%n% 1HfDH=n%AH %AND@HcD< t< u-Hcf.։@n%t;DH< t< tHcTH t t Ɖn%uAAu =$t1HËm%m%1HR/1HAAtAA;벐HDm%EL %DINHcAT/w-Is'FH:m%ATt^/}  uE/VHc҄u 3H A Au/tl%ALu\D=~$t1H@HIZpl%yl%1H.1Hff.H=Zl%u-1Hf1Y=V~$0l%ul%1HD1DUSHk%9k%Nk%w:k%H[]ff.xHAT1D%k%U-k%S.?k%1vk%9?1[D%bk%-lk%]A\ ff.xHAT1D%5k%U->k%S>0k%1k%>1[D%k%- k%]A\If1DAW@AVAUA@ATUS1HL1H d%@I8IA~@!L9thE4@t HI8tjLŅ%uL{ uL9t!A f.y1A MLL 1IDHH=&Q€wH%%I9t;LI2L?1H[]A\A]A^A_fDH%`%LIu0IJ(@AUA ATAUSHH/H~%DhHD`h HXHe%H[]A\A]fHtOUSHH@HH0Ht#CH+uH{u0HHj0HuH[]fDSH%HH1ҿH%[dAUATUHSHLgDo /H@HmHDhL`HHtHZHx.HHXHHkHH[]A\A]fATUSHtKHkIH HEHHHtHIMuIHEL[]A\E1AWAVAAUE1ATE1U1SHf%H%H%HHz% ]HH@Ha%Ht H9DH0cH.H1%HpH%S %H H%>DcAAuD%e%Dk AA D-e%DD4D%f%H7%H%L=%HT$[HT$L8aH8I-IHt/UL-HH%td@H{D%f%x.H%Hxh-H%H%bDD-e%,@D%e%@K'Hd%H%%H1[]A\A]A^A_H[]A\A]A^A_@H}%Ht;xu!f9xtHHuDpP 1ff.@H +H%H@HH@@H%1%HH N+H%H@HH@@H%1-%HATUS9 u[1]A\ÉމI2 *HY% hHX L`@H9%*H-%hX H@H@H%![1]A\f.HH=%t>fDH=%uu$uc%c%1H@%1H@~Stu$1[1fDHm%Ht %tu%HfD1ff.fH)H'%H %H/%PH%HPH@HH= %HtQH= %H % %Ht6HGH %G %HH %)H= %t H@H%%HHm %HtvHf.[HL %Ht?Hc` %HtH5$ E %tHt Hcɀ< tHf1HÉD$ D$ 1Hc %5 %SH %Q9|*Ht9Hlj5 %Hcu(Hc %H %Q %Hc҈[f %'Hc } %H~ %QfHH=a %Ht(HL %H=- %3 %- %HtOH % %H%w$HfUSHH_$uz\$u  %H<$H1[]H %HtHRHx&HHH%P@H$H-j % %H[]ff.@ATUSHH=< %$um_tUfDL% %LQHxU&LHHOH- % %H F$uH1[]A\fD ! %H % %HH1[]A\@|$ |$ Hff.$t;U %HV %1+$= %HH%$HoHDH= %SHt_GH Hڿ1H53VH=@$[UHtHiM贊1[%fD1[SH3Hd %[y %H $Df.AVAUATUHSH dH%(H$1Ll$Lt$L$D% LR1LHHSHSHcPH ?)ѺHH ĐZSE111ҍxMLPL   J%;%,%tg!%t\% %tQtF%t;H)%HЋ$=$ $t=$fHhRLPtdH$dH34%(uKH []A\A]A^@HRqQI$uD$TN@AVAUATUSH H=z$dH%(H$1Ld$QLLcH1HL$HLHLzNDLA ?)HH lXN1LA~H ĐILHc$H$HD$XQH$dH34%(uH []A\A]A^hMj%9`%ff.:%0%9~<)ȃufDx;%HcH%@<f)Ɖt%$x=$ff.Hu%HtfD#Su$x=k$HD%HtЅxS$[ÐfUSHJ 5$%Hc!%H@(L@9tbL%E1D)BA<=AOHc@HHk$8uEL6L9Xu8BA8I9u%LcIAH!HH[] %Ez%Hco%9~[)Ѓt,t-JHS%@<Mʉ 6%D=$ H Z$)AVAUATUSH0H=$dH%(H$(1Hl$ D$ D$ @NHLcH1HL$HLHLA KDLA ?)IL l J d$CHL ĠA~LD$)Hci@BHD$)1HcHL$LMSGHT$ TDI1!KT$ Ń% %96)9~D$ =<D$ u?fDH=$$lj   D$ PT$ $t=$0fDA<$ts1ҾD1D$ GDA1qGHt$ DJDDD$ 1IGT$ tpA1H$(dH3%(u_H0[]A\A]A^f)ȃfDt |$ ffA$ t1@5HD=&$1H i$$1H%E$@S$t!H%&$$[ ÅuH%HtAHtHc%9%PH %MЉ[%Hcu%9k%}PH [%MЉG%$Y=$IDxWu$u4T%u7$H$6H=$$딋=$뿻 BT%C8uH$Hۃ@AWAVAUATUSH(dH%(HD$1HD$HD$DnIIL|$Lt$H r$@k*H%b$x)ADLHLL&FHt Ht:Ht%HT$dH3%(uGH([]A\A]A^A_@A$@HD$HHD$L9o1EAVHcAAUIATUH1SHHdH%(HD$1ZFEx]E~XI1fDH x$@3H%k$AA9HtDtLHI$}tHL$dH3 %(Du H[]A\A]A^DHLj%u(H.$%Ht=9$Ћ$u%x:$uHÐ=*$HakfSHxHtR%1[H ~$ifUSHH=FR%oP%o P%1H=P%oP%oP%)($o%P%o-P%) !$o5P%o=P%)$oP%o P%)$oP%oQ%H Q%)%$)-$)5$)= $))$) 2$);$)D$HM$HLDDU$EH=A$o@$H=8$;$y$DeP%E=$t$ FP%h$5$D$H$DIO rHs$HH=[$H=Y$3H=B$H H)$ @ʲ$fo%*$fo-2$$fo50$fo=8$%N%foy$fo%1$-zN%fo r$fo-*$5sN%fok$fo5#$=lN%fod$fo=$He$$%XN%-aN%5jN%=sN%|N% N%N%N%HN%uH[]ÉyvHHo$HtH$O%H$8$H=N% 15$C$F@="$]H$H=$luH$%H=P$ H[]Ð=$0H=1$HH$cwfDH=$L-Ht;H=t$HH$ sHv)$~@C~n@H=41E<D;fDH=$DD=$EH=$ө=$uH5e$yuD $E=M%9H$uH%H=u i^UfH"$HL%H%$u8Z$t&H$E$HtHDH=$S H@[H$t~Hu6unkL%H$H= $1fH$t H%H$H$HH%H{$fH=$1RH[$f tH%H<$|SH5(<H\$H=\$H=S$~=H5=H=8$k=H5H=$X=H5!H=$E=H5~H=$2=H5H=$=H5%H=$ =H\$[H5I%>AUATATUSHdH%(HD$1HB=E$cAiJ%oJ%H={:]J%Ht 1H>CJ%…G#J%5"J% $$u 5I%5I%HD$dH3%(H[]A\A]I%-I%H=$tH=/C=I%A݋|I%\ED-dI%EqH={$H=/<5KI%É3I%fD.I%PP $H%u]5H%H%@l$$Eur5P$A݅F-H%H%AH=8H%Ht 1H<nH%ÅL-bH%LH%$E1@5:H%DH%G%AZ9AD-G%D0G@HtG%HtG%ÐHH=A$<1Hff.@HH=$\<Hff.HH=$,<`$t'HOH9`$tHMrD$tHf.H闸AVAUATUSHdH%(HD$1H_HF%H1H=@$HuF%HF%Htp;HHHDHH9$H={$Ht;4H=l$Ht*45$$E%E%E%HQ,HE%HE,HE%HE%H[E%HE%H$HZE%HE%HE%HQ$H>$HC$H@$H$H$H$H$H$H$H$H$H$Hz$Hg$HlD%$8$$HzD%H$H`$1HL$dH3 %(H[]A\A]A^D1 iD%WD%Oh8D%LHH=P$H/H8$HH$ 7H#L%$ILH=Q*H;LcHL%39u[1]A\ÐHH5>% g31H$StikP$t61ۃt[H=Q$HtHU.[H5I$1]2H=6$4[D뢐$t2H=$Ht&HH-?$Hfff.@$tH=$Ht $uHHS-$H@u H= $Ht HU-H=$Huff.H$Ht0H $Ht$u9= O$tHuH,H,`USH=<%%f.H=$5<%Hv V$ ^|蹼c<%u.f^|菼9<%4.H=]$5<%Hv$uH=6$f^V|/v;%n-H=$5;%Hv$u~H=$ft5;%H1[]@~H=$1D?5J;%;5h:%SH=i${m5;%5:%9u-;5#:%5:%}_H=($S{,tH,5:%HvNj$uH=${;59%5:%|t5:%;59%I1[D9%5i:%9PH=$z薺)I,5;:%Hv$uH=\$ {1fDAWAAVAAUAATIUSH9%b1D$ fDE~ 98%|$ H=$1ɺz1ɺzz9É„t>8%ELH=$eyuQH=$@t1҉\|9É„uEtLd@[H[]A\A]A^A_fA@uEAtP8%E H1[]A\A]A^A_1{IAt8%nH=$1҉{H=$1ɺxy̅tD$ =AUAATAUSH(dH%(HD$1HH~x/Et HDHT$dH3%(u#H([]A\A]fEtHD%*DWwHK$$?Jf.ATE1USH?H)HAą56%<;=$Hc I7%90HcIc)DHi$ HH :Hc 7%9~H=F$HHcH&$56%u,uH$HtxtQ.1ɿ256%H$-5%-5%Hc56%(D[]A\f55%89p u+PVP fAWAVAUATAUSHXdH%(HD$H1H(Ht -$tpCDd$0D$1= (Ht$$)D1DD=$ELc5$H$H$H|$(H $HENHD$IcD $HDL$ F$3HD$'DL$ H H"HHl$Lt$0HLDL$ HG*DL$ D,0C$DDC=ݍ{HcqIŅLcHLt$0E1HLLAO$HLD9McMA$L1$LAA A~Dt$ HcIE~.LcILt$0E1fLLLA#IMD9|$ A@ELDNAHADeD)uL1V $HT$HdH3%(HX[]A\A]A^A_H|$.D$/1Dd$. $AfD$0D5$H$d@H|$0|$kHD$Hg$Nf.LHD$1Y$H5S$D56$D$0'H$I70%USHH p$@+Hd$HHHT$x`u;t$~Hމ[]!H1[]軼DH$ufH[]@?1H$;$>ff.ATAUS9~Aċ1%D9}9AODID)0%)9~1HcLc@L$M 0G E 0D0%HA)A9ً$u7HD10%H$)؉0%H[]A\fDHfD.1%L0%9~,1%t 1%9}0%Ðy 0%Ðy0%ATIUS9~ 0%1A<$u*[]A\Dߍu0%1A<$tL[]A\fAUAATIUSHw"9$HʼnH=$L -]/%Eu\.0%9~B$0%0%9~0%H[]A\A]Ðy/%H[]A\A]y/%.%In@H5/%H=$p5.%9 A$ty .%HHQ$H9A$uH=$_r5e.%xh*/%t9$)/%1Ðy /%1H.%u.%y .%1Hf. ff.-%t:=.%…~$ @$uHP$H9@$)щ9| =j.%x1z-%1HF.%_-%y Q-%1HfDUSH HtW$uMxyt=-%~MDH=$ƃp„u܅u -%H1[]ÐH[]a-%H1[]H[]fUSH]HtG$u=xIt.],%93-%u =F?$tPi9-%t7-%H1[]H[]AH[]c[fW,%1ff.@+%x,%1ff.fx ff.xff.AWAVA1AUATUSHXHc ,%dH%(HD$H1D-+%yIcADE1HD$(FD9HD$(HD$HD$$HD$HD$0HD$qDAHt Q$u @ŀoAp'@HH$DPtI'H$H,Hx$@,IcA9~GH=e$k'Hv5$DcHXIcE1A9D-*%1HL$HdH3 %(HX[]A\A]A^A_fEt3H7j$)@ŀ$AHt5$u @ŀ#[&@HH$DPH$H,H=Y$kAD4$DHcHL$H|$H5%$)HcHhHHti\$$ڃ<$׉$tow$#9eHT$H|$H HcЅ~D0H=$Ht$H/11ۃ<$D$$׉$u$R#$(@HY$(\$$GeDHS$HHHH4$1Hff.f'$u@HHH$HHH{H$1Hff.f9=B%|=%1fD$u=%;=%=%1fD%;%~%H;HÐt%%1%fDSH=ġ Ht*8t%H1HHt8uV1[f.H=T Ht8uH=n> Ht8u11KHvHHDUtf1Ҁu$t|BA>BfDDH=IHt A|(#HcE<EH=&DHE1HcA4@HNb$E1HT$j@E@(@D9Eu-H|$/HH=HADA߃HcA4@f@\uA| tA'tӐEu@EtE1A9DDfDAfAED똃(u]D<A?3+|$t1HD1uDH1DAWAVAUATUSHHT$ [$Ht$dH %(HL$81Hc8 DaHIIcH4D>Ht$D8_A-PAG< E1A?uAAIcLHD$D8EHD$0DH\$H$~A:wHLnDH=HVH=$HtDH9;T$ , #HcLD;EEHv$Ec< t AAHCA9fD1E1E1/|IAWHAVAUATUSHHt$dH4%(H$1H=9T$IOLIA: T$HʼnD$(HDŽ$1DŽ${H$MHl$HD$H$H$K@AG\u "6 5$v$HATA Lc$MK|5HvD$EfCl5%$D/S$At8D8^tH=S$,HSAGjf.L踶L`HxǵLHHHD$H1H$dH34%(#H[]A\A]A^A_fDxECt5@t4H=mR$DD$0T$,@l$ zDL$ T$,HDD$0D8 $AGtb"u ',\s't E8e]DH4$/,Lc$MK|5s1)f"u HK$HcDLЅHc$Hl$MATD]Q$D8kDŽ$M1Lt$ A1H$D$,AD$D$0D$4$HL$HJDAED9{AFMc$HcC, AA$C$9D$( $HA,uHvȜ$@:-~P$@:-\$t$@"@@RD$t$$<$t'HcAt@H=P$3H |$()߃HcHc$HHL#H)A,D9sIcHALH芳\$(C$9D$(fHD$Lt$ L M9tLV|$0t$41DHc$IlD$]tGH=HO$YL$Hu0"uD$u$H$HDLЅ%DAED9Hc$AFMcAAC HcA$@@'@\uAED9AFMc$HcC \AA$fA@LIc豱InfA@LIc葱IFf)ىf$@D8OfH$f@@l$8Ht$H$H$Dl$PHHILd$@I)$A$HLHE'u!$I$HAL9ul$8Dl$PLd$@HL$H!%tDHqHDΉ@HH+L$HA,D9IcHt$AL+$$!1E~ 1C|5$Ht$$L1$fD$,AED9G AFMcD$,HcC 'AA$@+D$D$AED9AFMcHcC "AA$TxHcA:sLIK$fEOIAGAEDŽ$D$(HD$L M9L肯D$40DAGfD$a^$$wHc$1Iʅ~ 1A|$ABH$LH $$16$D)ӃHcHH $HHHI4D+H{A,D9 IcHAL H襮$D$,$f.A@LIcIfA@LIcѭI;fAGfLD)EIc蕭IjDMHl$D!J$AED9fHc$AFMc$AAC HcA$Hc$HIlD$,'u |$Ӄ"HD$HL$H荬L$HD$8$m@[@H=(L$HAH$1DŽ$$6I$H$Ƅ$$$J$L$HH HcÉA1:uKHcA%* $-[^N r@ A1Hf |JAHr@ v^*-$H HH2 HF$H9" HHT$HxHT$HHH4HT$HG$D$TD$@D$hH$D$PD$HD$`Dl$lHcA<:ADLD)EIc}IH$LL$?$L$HAED9Hc$AFMcD$AD$,AC HcA$A@LIcI$D$@xh$/HHhHHHx9HHIkHL$h뤾.HHtR$h냋$D$@qhl$D$ThX/H;HufD$h1.HHH>֋$nHt$`L1LА$&HH$HD-$D-$1Ic茧H $H‹$ 1H\$X0@\A9B4 HcŃ@49I$"LcȍXB4 @&u0$4(D9HcH5&$HL$xHHT$p<-$HT$pHL$x롋$Lt$ IݹPpL1DH|$8H藧L菧HD$LHM9L$f$AGHl$MHHATu$@D$$HcAD/A@LIc聦IH\$XHcHHT$XHT$X-$H$D-$EHfA9D$X1D$pL|$xD$AL$AHIcEH5$H|8D-$ET$CDD9D;T$X~`D\$PEtVIcDt+< t< u#AT$HcDA҄t H< t< tDHD$eD$D$XETIc gD$E)G<3AHcǤHHHIHc$I|H5$Hc5$Hc=$EA4HHA)HLIcMcHCDADL$ED$PL|$xLD$D$L$$H$$$HH$H9HHoHx֣HHH@#YL剜$$^$$=$LLEdD$AD$p1QHcAp@ 1LcэtPCDIHЀ v$9 ȉ$Lt$ L1dH|$8H跣#fH-$$HH>Hx襢HHHeD$@Dl$l$t>qm|$@xHHxVHHHHHHHl$8HH\HD$4}$t*H|$8A,D9QIcHt$8ALH|$8订1|$TD$0|$HL|$xD$L$$D$HD$L LLDd$XD$pAHcALD)EIc臡IAMHl$A@LIccILt$ $H$$HH踠HQLD)EIcߠIB| & LcˍXEHLL$pIc譠H V$LL$pHH|$8Hc艠HD$8<$$F,hHIcWH $H$H=$L-Lj$Mt A}d$Hڸq@v uHt t 'uڃHckHHH@E' t"H'ttIHxZHcHcD IHEtD$8%=WD$ODHT$|$ H?HH讙D$|$ $H<$H<$LLÅ;H<$$LH$HtH @KH$dH3 %(ZH[]A\A]A^A_fDHD$|$ /$fx2u2H<$K|$tT$@t$DIcH<$LD)LHcKHrźDIEAD9DHL$(dH3 %(unH8[]A\A]A^A_|$?/%}GuT$ ͸T$ AE`fDA|݃_IG=1sUHSHHHt61HHHvHt;Ht5HDH[]1HHHtHuHEff.AWIAVEAUIATUSHcHIHHHLL$LLL$~{IcLΉD$LH.T$9u^~ZE8uR~@AAMcMcC7C8D%u3JHDH:TuH9ufD1H[]A\A]A^A_AVAUIATAUHSƲEA9EA1/@HHH1HPHvVHED9}5DHc)LHcHu1蛰HPHw˃D9|fD)[]A\A]A^fHE1ܸD)1D9|EE~1HcH1@87u2ApHH:TuH9u1ff.fUSHcHHH(dH%(HD$1;o$u ~P9HL$dH3 %(uMc$N,# $9L$0hIcHl$LHHHl$(sLL%$$A}/DpLl$LIFD|$ AMHD$EnM)I/HMgIIl$HHnHHHuD|$ DLl$A EkLcK\5}Hc~LLHH蟧BD5HIHt HLNH $D4D;t$0Hc<$HH|$胧HD4$IE1E1 $9L$0D$0H|$BD8pD$0HcY~HD$qEHL9t$~;/IFtuIDID$L9d$ t4I@T$0H|$DpD$0Hc}HD$.fDt$(D|$4Ld$8C&Mc$N,#DDLl$HD$(HD$HH[]A\A]A^A_@1eHcD$0}HD$HH S$H5n$H=j$H S$H5Z$H=[$Hf.H'$HH1HHtHwHt HtÀ>0fH=\HH JS$HH0qHnu HDH S$H5$H=~$1H R$H5$H=$H R$H5O$H=P$Hff.@H=$HulH }R$H5$H=$蝯H ^R$H5Z$H=[$~H ?R$H5$H=$_1H ff.AUATUHSHHdH%(H$81H=T$HD$t.AHxzHHݣH|$HD$T$Hl$HT$H&H=$Ld$L订fDH$HH{tjxH !Q$H5$H=$AH{H3H P$)H P$H5f$H=g$ 1H$8dH3 %(^HH[]A\A]DD$(Ld$D%=s=tl=@=L===`= 蒡fDAt'MtLLAt'tLoAIVH|$ v&tL`6fDHHa$IHt(HL9wLHsH)HftH[ HuٻPLH|H$H諧u?H5$H=Ld$Lp#vfDH=$Ld$tLOD%=AtOtAL0輟L葟@AuL`rDD$Ld$D%kfD.YL@)|@i YLt 8۞)̞`轞 ff.H=$H 6M$HtH5$XHH5$H=$4H L$H5$H=$H L$H5R$H=S$HfLAVE1AULL͘ATUHSAH~=tC\tX^AHMhDaA>w\IIIAIA=u[LLLU]A\A]A^DAHMhxw2DOc$M>A?M1A IAHIM@ ff f f f f fEpE1MDANЀ6wGIIA~I+At"EpAIAANЀ6vfE!IAI\@fDE`0MDEl$AveA IAIffDt$:tA IAHIIfDfDIALE fAIAHMIAIGd&E0f.AIGd&E0f.AWH=AVAUATUSH(dH%(HD$12H$Ht8Hu1H[$HD$dH3%(H([]A\A]A^A_??HD$H-hfD$L5 i#˝Hx2rHHgH[$HD$H$*$:qHPH$D8D|$xmHPH$PT$HPH$x=K1۸lLl$HfHI4HtBA8uLӟuHcH$1HHH|$H HD$HAuZ1LH=p/H$Ht,:t'HHt:tH$Huf:"H$*(IL|$pLLHHZ$H$HH Z$HC HD$HCt,H$HPH$8=HsHtH=1.H=H1.H=Y$赘H=Y$HtfH_ 藘HHuH|Y$6J$DHH$HD$1HKLLHC6XH$^B蓛AWAVAUATAUSH-F$dH%(H$1u X$u9輁E1H$dH3 %(DHĸ[]A\A]A^A_D~ $$XA]A}tA)eADD$ {xL5E$L=~ $A+fDMtLT$T$HEtHcA9uǃtHcA,MtL踚HuA99l$ uAuLd$ DLHH=cE$讝H=WE$蠝Hc蘚L-$$?)ѺH $H T C)Hci@BHD$)HcHL$ $LD$11LQ-3$=fDD$ (D$ [fAV6fDSH#H5){Ht#]H5hcH\#}H5PKHĸ#)H583H#]H5 H#H5 [}fHy)HH޿]H#؇H޿}H#ćH޿)H5#谇H޿]H!#蜇H޿}[H #采6 $~=, $f.AWIAVIAUAATL%R#UH-R#SL)HHt1LLDAHH9uH[]A\A]A^A_ff.HHGNU bash, version %s-(%s) x86_64-redhat-linux-gnuGNU long options: --%s Shell options: -%s or -o option run_one_command-crbashI have no name!??host??BASH_ENVPOSIXLY_CORRECTPOSIX_PEDANTIC\s-\v\$ > ~/.bashrc%s: invalid option%c%c: invalid optionlogin_shellINSIDE_EMACS,term: (term:dumbemacsetermPS1PS2SSH_CLIENTSSH2_CLIENT/etc/profile~/.profile~/.bash_profile~/.bash_loginFUNCNAMEBASH_SOURCEBASH_LINENOmaindebuggerdump-po-stringsdump-stringsnoeditingnoprofilenorcposixrcfilerpm-requiresUsage: %s [GNU long option] [option] ... %s [GNU long option] [option] script-file ... -ilrsD or -c command or -O shopt_option (invocation only) Type `%s -c "help set"' for more information about shell options. Type `%s -c help' for more information about shell builtin commands. Use the `bashbug' command to report bugs. bash home page: General help using GNU software: /usr/share/bashdb/bashdb-main.inccannot start debugger; debugging mode disabledcannot set uid to %d: effective uid %dcannot set gid to %d: effective gid %d%s: option requires an argument%s: cannot execute binary fileУУУУУУУУУУpУУУУУУУУУУУУУУУУУУУXУУУУУУУУHУУ УУУtimed out waiting for input: auto-logout PROMPT_COMMAND/%s TMOUTreader_loop ; ;|&syntax error near `%s'syntax errorreadline stdinTZ%a %b %d%H:%M:%S%I:%M:%S%I:%M %p%H:%M%s.%dHOMEPS0esacdonethenelseelif#%^,~:-=?+/evalletexpected `)'=~-nUse "%s" to leave the shell. "$@"COPROCcommand substitution-p&&||<&>&;;;;&<<-<<<&>&>>>|fiforselectwhileuntil[[coproc((k8Xkkkkkkkkkkkkkkkkkkkkk`kkkkkkkkkkkkkkkHkkk@X@kkkXkkXkkkkkkkkX8H}}i zyjyGyuLu uttWt^zzYYxY9YXXwwTwvx4xv-vuuoo=onnrnj_*_^^n^/^]]g]$]\\V\\[[ZZi[@[[ZPZ4ZkuklkkkXX`___bbba3a`n``2hgglgff%feEedd:dcccZcll/lsssZs srrrZr9rrqqqq}`q;qqppppqpJp*ppx{{}z}z}{zI{-tnn}}mmm}}7mllHn_i"ihhhhth1kjj3jjiiy {();&| '()   !  =>>>>??@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@AAABBCCDDDDDEEEEEEEEEEEFFFFFFFFGGGGHHHHHHIIIJJJKKLMMMMMNNNOPQRRRSSTTTTUUUUUUVVWXXYYYZZZZZZ[[\\\]]^^^_____`````aaabbb ' ~75<=%?><BE 53 !<0E5  D3 ;!"C334;12|}7x9;83!"9;234;933=>993!"339988~333993998;28()*82342342()*#$%&'+,-./<)67#$%&'5+,-./=>67"#$%&')+-../<:5<679::? ::!"#$%&'123+,-./:3467:9;  ::::4#$%&'+,-./234679; #$%&'+,-./3679; #$%&'+,-./679; #$%&'+,-./3679; #$%&'+,-./679;#$%&'+./67@AEw (v)&(85=rs5><wKv F|} d?eyz~LB !f|} !GHIMhiwGH-9bc=gjk?55lm.:no>wpq t  GHI55GHI#$%u,38B4NOPQR7S;<TUAVWCDI  !"*+/10 !6D 2EF JK LM@ 'GHI !  !  !  ! C !XYZ[\]^_`a"#$x%&'()*+,-./0129:{J;346733l3333334333333T3363433345o69;<@JDA>F?EGHI4jf& /)#,23 4:7=hgp("1+%. '!0*$- ne8cbiktUVBCd`m_z|~u]KLWXal{}^MNSTYZqvwsxyQRrOP[\43%339.f6-3G3fh#kPp3333333333333333333f333333333Q~  33333333333333333333333333333333+3D3=3333H33)3333333333333333333333333333333333??333333<33Jl33,.33)3333339333833 333333:33)3LP333WWW3333 33;G*333n3V2W?3+333333333Z333q333333v33333kA33333oE33vM3333331;<827695:  !"#$%&'()*+,-./04syntax error near unexpected token `%s'syntax error: unexpected end of filemaximum here-document count exceededunexpected EOF while looking for matching `%c'unexpected EOF while looking for `]]'syntax error in conditional expression: unexpected token `%s'syntax error in conditional expressionunexpected EOF while looking for matching `)'unexpected token `%s', expected `)'unexpected argument `%s' to conditional unary operatorunexpected argument to conditional unary operatorunexpected token `%s', conditional binary operator expectedconditional binary operator expectedunexpected argument `%s' to conditional binary operatorunexpected argument to conditional binary operatorunexpected token `%c' in conditional commandunexpected token `%s' in conditional commandunexpected token %d in conditional commandOLDPWD`%s': not a valid identifier/dev/ttyPROMPT_DIRTRIM:~getcwd: cannot access parent directories/bin:/usr/bin:/uabcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZsyntax error: arithmetic expression requiredmake_here_document: bad instruction type %dhere-document at line %d delimited by end-of-file (wanted `%s')make_redirection: redirection instruction `%d' out of range%s(%s) syntax error: `;' unexpectedsyntax error: `((%s))'environmentexecutableclean_simple_command%u{%s}<<%s%s>| %s<> %s<<< %s{%s}<&%d%d<&%d{%s}>&%d%d>&%d{%s}<&%s%d<&%s{%s}>&%s%d>&%s{%s}<&%d-%d<&%d-{%s}>&%d-%d>&%d-{%s}<&%s-%d<&%s-{%s}>&%s-%d>&%s-{%s}>&-%d>&-&> %s&>> %s! ) && || xtrace_set: NULL file pointerPS4%s=(%s) ''%sfor %s in select %s in case %s in case %s in [[ '' ]] (( )) time -p for (( | if then else function %s () { } { coproc %s print_command do function () cprintf: `%c': invalid format characterxtrace_set: %d: invalid file descriptorxtrace fd (%d) != fileno xtrace fp (%d)print_command: bad connector `%d'lԡSignal %d[%d]%c |%5ldStoppedStopped(%s)RunningDoneDone(%d)Exit %dUnknown status%*s(core dumped) & (wd: %s) %s: line %d: (core dumped)(wd now: %s) notify_of_job_statusstart_pipeline: pgrp pipe[%d] %ld [%ld: %d (%d)] tcsetattrSIGCHLD trapfork: retrychild setpgid (%ld to %ld)fork%s: job has terminated[%d]%s (wd: %s)no job control in this shelljob-working-directorydeclare -%s %s=%s$($[<(>(?*+!@#%^,~:-=?+/@}#%:-=?+/@}%:=+/%s: bad substitution%s: substring expression < 0%s: parameter null or not setprocess substitution%s: invalid variable nameno match: %sQPQPQPQxRPQPQPQPQPQPQPQPQPQPQRRPQPQPQPQPQPQPQPQPQPQPQPQPQPQPQxQ <<<<<D<<<<<<<<<,<<<<<<<<<<<<<<<<<<<<<<<<<<L<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<-HHHI+JHHHHHHHHHHHHHHHHSJHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH?Jbad substitution: no closing `%s' in %scannot make pipe for command substitutioncannot make child for command substitutioncommand_substitute: cannot duplicate pipe as fd 1command substitution: ignored null byte in input%s: cannot assign list to array member$%s: cannot assign in this way%s: invalid variable name for name referencecannot make pipe for process substitutioncannot make child for process substitutioncannot duplicate named pipe %s as fd %dbad substitution: no closing "`" in %s%s: invalid indirect expansionYou have mail in $_You have new mail in $_The mail in %s has been read invalid signal numberSIGinterrupt traptrap_handler: bad signal %dexit trapdebug traperror trapreturn trapEXITSIGHUPSIGINTSIGQUITSIGILLSIGTRAPSIGABRTSIGBUSSIGFPESIGKILLSIGUSR1SIGSEGVSIGUSR2SIGPIPESIGALRMSIGTERMSIGSTKFLTSIGCHLDSIGCONTSIGSTOPSIGTSTPSIGTTINSIGTTOUSIGURGSIGXCPUSIGXFSZSIGVTALRMSIGPROFSIGWINCHSIGIOSIGPWRSIGSYSSIGJUNK(32)SIGJUNK(33)SIGRTMINSIGRTMIN+1SIGRTMIN+2SIGRTMIN+3SIGRTMIN+4SIGRTMIN+5SIGRTMIN+6SIGRTMIN+7SIGRTMIN+8SIGRTMIN+9SIGRTMIN+10SIGRTMIN+11SIGRTMIN+12SIGRTMIN+13SIGRTMIN+14SIGRTMIN+15SIGRTMAX-14SIGRTMAX-13SIGRTMAX-12SIGRTMAX-11SIGRTMAX-10SIGRTMAX-9SIGRTMAX-8SIGRTMAX-7SIGRTMAX-6SIGRTMAX-5SIGRTMAX-4SIGRTMAX-3SIGRTMAX-2SIGRTMAX-1SIGRTMAXDEBUGRETURNrun_pending_traps: bad value in trap_list[%d]: %prun_pending_traps: signal handler is SIG_DFL, resending %d (%s) to myselfcannot reset nodelay mode for fd %dcannot allocate new file descriptor for bash input from fd %dsave_bash_input: buffer already exists for new fd %dunwind_frame_run: %s: frame not foundunwind_frame_discard: %s: frame not foundoLooooooooooooooooooooooooooooooo7oooooooo7ooo4ooooooooooooooo7ooooooooooooooooooooooooooL22222222222222222222222222222222222222222222222222222222222222222222222222222%s: integer expression expectedxh0`````8``P`````````````00pH`` ```pH `argument expected%s: unary operator expected%s: binary operator expected`)' expected`)' expected, found %smissing `]'too many arguments4.4%s.%d(%d)-%sreleaseGNU bash, version %s (%s) Copyright (C) 2016 Free Software Foundation, Inc.License GPLv3+: GNU GPL version 3 or later This is free software; you are free to change and redistribute it.There is NO WARRANTY, to the extent permitted by law.@(#)Bash version 4.4.20(1) release GNU ;|&( ;|&()%s: cannot convert indexed to associative array%s: invalid associative array key%s: cannot assign to non-numeric index%s: %s: must use subscript when assigning associative arrayarray assign'()'bad array subscript%s[%s: %s[%s]: %s%0*dbrace expansion: failed to allocate memory for %d elementsbrace expansion: failed to allocate memory for `%s'brace expansion: cannot allocate memory for %sHISTORY (TRUNCATED): PID=%d UID=%d %s500%s: cannot create: %sHISTORY: PID=%d UID=%d %s%s%s%sC-xC-e%s %dinput-metasymlink-hook;|&{(` "'$include /etc/hostshostname_completion_fileno closing `%c' in %s \"'@<>=;|&()#$`?*[!:{~completion-ignore-case"'\fc -e viREADLINE_LINEREADLINE_POINTbash_execute_unix_command#comment-begin$@Bashshell-expand-linehistory-expand-linemagic-spaceshell-forward-wordshell-backward-wordshell-kill-wordshell-backward-kill-wordhistory-and-alias-expand-lineinsert-last-argumentoperate-and-get-nextdisplay-shell-versionedit-and-execute-commandcomplete-into-bracescomplete-filenamepossible-filename-completionscomplete-usernamepossible-username-completionscomplete-hostnamepossible-hostname-completionscomplete-variablepossible-variable-completionscomplete-commandpossible-command-completionsglob-complete-wordglob-expand-wordglob-list-expansionsdynamic-complete-historydabbrev-expand'"$<>()<>;&| _EmptycmD_%s: missing colon separatorFIGNOREfc -e "${VISUAL:-${EDITOR:-emacs}}"%s: first non-whitespace character is not `"'fc -e "${VISUAL:-${EDITOR:-vi}}"bash_execute_unix_command: cannot find keymap for command/usr/share/localePOSIX"" setlocale: LC_ALL: cannot change locale (%s)setlocale: LC_ALL: cannot change locale (%s): %ssetlocale: %s: cannot change locale (%s)setlocale: %s: cannot change locale (%s): %s#: %s:%d msgid %s%s msgstr "" redirection error: cannot duplicate fd%s: cannot overwrite existing file%s: restricted: cannot redirect outputcannot create temp file for here-document: %s%s: cannot assign fd to variablefile descriptor out of range%s: ambiguous redirectsh-thd/dev/tcp/*/*/dev/udp/*/*x  DDDDCOMP_LINECOMP_POINTCOMP_TYPECOMP_KEYCOMP_WORDSCOMP_CWORDgen-shell-function-matchesCOMPREPLY_DefaultCmD_completion: function `%s' not foundprogrammable_completion: %s: possible retry loopprogcomp_insert: %s: NULL COMPSPEC%s: cannot allocate %lu bytesxmallocxreallocRead lines from a file into an array variable. A synonym for `mapfile'.Read lines from the standard input into an indexed array variable. Read lines from the standard input into the indexed array variable ARRAY, or from file descriptor FD if the -u option is supplied. The variable MAPFILE is the default ARRAY. Options: -d delim Use DELIM to terminate lines, instead of newline -n count Copy at most COUNT lines. If COUNT is 0, all lines are copied -O origin Begin assigning to ARRAY at index ORIGIN. The default index is 0 -s count Discard the first COUNT lines read -t Remove a trailing DELIM from each line read (default newline) -u fd Read lines from file descriptor FD instead of the standard input -C callback Evaluate CALLBACK each time QUANTUM lines are read -c quantum Specify the number of lines read between each call to CALLBACK Arguments: ARRAY Array variable name to use for file data If -C is supplied without -c, the default quantum is 5000. When CALLBACK is evaluated, it is supplied the index of the next array element to be assigned and the line to be assigned to that element as additional arguments. If not supplied with an explicit origin, mapfile will clear ARRAY before assigning to it. Exit Status: Returns success unless an invalid option is given or ARRAY is readonly or not an indexed array.Modify or display completion options. Modify the completion options for each NAME, or, if no NAMEs are supplied, the completion currently being executed. If no OPTIONs are given, print the completion options for each NAME or the current completion specification. Options: -o option Set completion option OPTION for each NAME -D Change options for the "default" command completion -E Change options for the "empty" command completion Using `+o' instead of `-o' turns off the specified option. Arguments: Each NAME refers to a command for which a completion specification must have previously been defined using the `complete' builtin. If no NAMEs are supplied, compopt must be called by a function currently generating completions, and the options for that currently-executing completion generator are modified. Exit Status: Returns success unless an invalid option is supplied or NAME does not have a completion specification defined.Display possible completions depending on the options. Intended to be used from within a shell function generating possible completions. If the optional WORD argument is supplied, matches against WORD are generated. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Specify how arguments are to be completed by Readline. For each NAME, specify how arguments are to be completed. If no options are supplied, existing completion specifications are printed in a way that allows them to be reused as input. Options: -p print existing completion specifications in a reusable format -r remove a completion specification for each NAME, or, if no NAMEs are supplied, all completion specifications -D apply the completions and actions as the default for commands without any specific completion defined -E apply the completions and actions to "empty" commands -- completion attempted on a blank line When completion is attempted, the actions are applied in the order the uppercase-letter options are listed above. The -D option takes precedence over -E. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Formats and prints ARGUMENTS under control of the FORMAT. Options: -v var assign the output to shell variable VAR rather than display it on the standard output FORMAT is a character string which contains three types of objects: plain characters, which are simply copied to standard output; character escape sequences, which are converted and copied to the standard output; and format specifications, each of which causes printing of the next successive argument. In addition to the standard format specifications described in printf(1), printf interprets: %b expand backslash escape sequences in the corresponding argument %q quote the argument in a way that can be reused as shell input %(fmt)T output the date-time string resulting from using FMT as a format string for strftime(3) The format is re-used as necessary to consume all of the arguments. If there are fewer arguments than the format requires, extra format specifications behave as if a zero value or null string, as appropriate, had been supplied. Exit Status: Returns success unless an invalid option is given or a write or assignment error occurs.Set and unset shell options. Change the setting of each shell option OPTNAME. Without any option arguments, list all shell options with an indication of whether or not each is set. Options: -o restrict OPTNAMEs to those defined for use with `set -o' -p print each shell option with an indication of its status -q suppress output -s enable (set) each OPTNAME -u disable (unset) each OPTNAME Exit Status: Returns success if OPTNAME is enabled; fails if an invalid option is given or OPTNAME is disabled.Display directory stack. Display the list of currently remembered directories. Directories find their way onto the list with the `pushd' command; you can get back up through the list with the `popd' command. Options: -c clear the directory stack by deleting all of the elements -l do not print tilde-prefixed versions of directories relative to your home directory -p print the directory stack with one entry per line -v print the directory stack with one entry per line prefixed with its position in the stack Arguments: +N Displays the Nth entry counting from the left of the list shown by dirs when invoked without options, starting with zero. -N Displays the Nth entry counting from the right of the list shown by dirs when invoked without options, starting with zero. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Remove directories from stack. Removes entries from the directory stack. With no arguments, removes the top directory from the stack, and changes to the new top directory. Options: -n Suppresses the normal change of directory when removing directories from the stack, so only the stack is manipulated. Arguments: +N Removes the Nth entry counting from the left of the list shown by `dirs', starting with zero. For example: `popd +0' removes the first directory, `popd +1' the second. -N Removes the Nth entry counting from the right of the list shown by `dirs', starting with zero. For example: `popd -0' removes the last directory, `popd -1' the next to last. The `dirs' builtin displays the directory stack. Exit Status: Returns success unless an invalid argument is supplied or the directory change fails.Add directories to stack. Adds a directory to the top of the directory stack, or rotates the stack, making the new top of the stack the current working directory. With no arguments, exchanges the top two directories. Options: -n Suppresses the normal change of directory when adding directories to the stack, so only the stack is manipulated. Arguments: +N Rotates the stack so that the Nth directory (counting from the left of the list shown by `dirs', starting with zero) is at the top. -N Rotates the stack so that the Nth directory (counting from the right of the list shown by `dirs', starting with zero) is at the top. dir Adds DIR to the directory stack at the top, making it the new current working directory. The `dirs' builtin displays the directory stack. Exit Status: Returns success unless an invalid argument is supplied or the directory change fails.Common shell variable names and usage. BASH_VERSION Version information for this Bash. CDPATH A colon-separated list of directories to search for directories given as arguments to `cd'. GLOBIGNORE A colon-separated list of patterns describing filenames to be ignored by pathname expansion. HISTFILE The name of the file where your command history is stored. HISTFILESIZE The maximum number of lines this file can contain. HISTSIZE The maximum number of history lines that a running shell can access. HOME The complete pathname to your login directory. HOSTNAME The name of the current host. HOSTTYPE The type of CPU this version of Bash is running under. IGNOREEOF Controls the action of the shell on receipt of an EOF character as the sole input. If set, then the value of it is the number of EOF characters that can be seen in a row on an empty line before the shell will exit (default 10). When unset, EOF signifies the end of input. MACHTYPE A string describing the current system Bash is running on. MAILCHECK How often, in seconds, Bash checks for new mail. MAILPATH A colon-separated list of filenames which Bash checks for new mail. OSTYPE The version of Unix this version of Bash is running on. PATH A colon-separated list of directories to search when looking for commands. PROMPT_COMMAND A command to be executed before the printing of each primary prompt. PS1 The primary prompt string. PS2 The secondary prompt string. PWD The full pathname of the current directory. SHELLOPTS A colon-separated list of enabled shell options. TERM The name of the current terminal type. TIMEFORMAT The output format for timing statistics displayed by the `time' reserved word. auto_resume Non-null means a command word appearing on a line by itself is first looked for in the list of currently stopped jobs. If found there, that job is foregrounded. A value of `exact' means that the command word must exactly match a command in the list of stopped jobs. A value of `substring' means that the command word must match a substring of the job. Any other value means that the command must be a prefix of a stopped job. histchars Characters controlling history expansion and quick substitution. The first character is the history substitution character, usually `!'. The second is the `quick substitution' character, usually `^'. The third is the `history comment' character, usually `#'. HISTIGNORE A colon-separated list of patterns used to decide which commands should be saved on the history list. Execute conditional command. Returns a status of 0 or 1 depending on the evaluation of the conditional expression EXPRESSION. Expressions are composed of the same primaries used by the `test' builtin, and may be combined using the following operators: ( EXPRESSION ) Returns the value of EXPRESSION ! EXPRESSION True if EXPRESSION is false; else false EXPR1 && EXPR2 True if both EXPR1 and EXPR2 are true; else false EXPR1 || EXPR2 True if either EXPR1 or EXPR2 is true; else false When the `==' and `!=' operators are used, the string to the right of the operator is used as a pattern and pattern matching is performed. When the `=~' operator is used, the string to the right of the operator is matched as a regular expression. The && and || operators do not evaluate EXPR2 if EXPR1 is sufficient to determine the expression's value. Exit Status: 0 or 1 depending on value of EXPRESSION.Evaluate arithmetic expression. The EXPRESSION is evaluated according to the rules for arithmetic evaluation. Equivalent to "let EXPRESSION". Exit Status: Returns 1 if EXPRESSION evaluates to 0; returns 0 otherwise.Resume job in foreground. Equivalent to the JOB_SPEC argument to the `fg' command. Resume a stopped or background job. JOB_SPEC can specify either a job name or a job number. Following JOB_SPEC with a `&' places the job in the background, as if the job specification had been supplied as an argument to `bg'. Exit Status: Returns the status of the resumed job.Group commands as a unit. Run a set of commands in a group. This is one way to redirect an entire set of commands. Exit Status: Returns the status of the last command executed.Define shell function. Create a shell function named NAME. When invoked as a simple command, NAME runs COMMANDs in the calling shell's context. When NAME is invoked, the arguments are passed to the function as $1...$n, and the function's name is in $FUNCNAME. Exit Status: Returns success unless NAME is readonly.Create a coprocess named NAME. Execute COMMAND asynchronously, with the standard output and standard input of the command connected via a pipe to file descriptors assigned to indices 0 and 1 of an array variable NAME in the executing shell. The default NAME is "COPROC". Exit Status: The coproc command returns an exit status of 0.Execute commands as long as a test does not succeed. Expand and execute COMMANDS as long as the final command in the `until' COMMANDS has an exit status which is not zero. Exit Status: Returns the status of the last command executed.Execute commands as long as a test succeeds. Expand and execute COMMANDS as long as the final command in the `while' COMMANDS has an exit status of zero. Exit Status: Returns the status of the last command executed.Execute commands based on conditional. The `if COMMANDS' list is executed. If its exit status is zero, then the `then COMMANDS' list is executed. Otherwise, each `elif COMMANDS' list is executed in turn, and if its exit status is zero, the corresponding `then COMMANDS' list is executed and the if command completes. Otherwise, the `else COMMANDS' list is executed, if present. The exit status of the entire construct is the exit status of the last command executed, or zero if no condition tested true. Exit Status: Returns the status of the last command executed.Execute commands based on pattern matching. Selectively execute COMMANDS based upon WORD matching PATTERN. The `|' is used to separate multiple patterns. Exit Status: Returns the status of the last command executed.Report time consumed by pipeline's execution. Execute PIPELINE and print a summary of the real time, user CPU time, and system CPU time spent executing PIPELINE when it terminates. Options: -p print the timing summary in the portable Posix format The value of the TIMEFORMAT variable is used as the output format. Exit Status: The return status is the return status of PIPELINE.Select words from a list and execute commands. The WORDS are expanded, generating a list of words. The set of expanded words is printed on the standard error, each preceded by a number. If `in WORDS' is not present, `in "$@"' is assumed. The PS3 prompt is then displayed and a line read from the standard input. If the line consists of the number corresponding to one of the displayed words, then NAME is set to that word. If the line is empty, WORDS and the prompt are redisplayed. If EOF is read, the command completes. Any other value read causes NAME to be set to null. The line read is saved in the variable REPLY. COMMANDS are executed after each selection until a break command is executed. Exit Status: Returns the status of the last command executed.Arithmetic for loop. Equivalent to (( EXP1 )) while (( EXP2 )); do COMMANDS (( EXP3 )) done EXP1, EXP2, and EXP3 are arithmetic expressions. If any expression is omitted, it behaves as if it evaluates to 1. Exit Status: Returns the status of the last command executed.Execute commands for each member in a list. The `for' loop executes a sequence of commands for each member in a list of items. If `in WORDS ...;' is not present, then `in "$@"' is assumed. For each element in WORDS, NAME is set to that element, and the COMMANDS are executed. Exit Status: Returns the status of the last command executed.Wait for job completion and return exit status. Waits for each process identified by an ID, which may be a process ID or a job specification, and reports its termination status. If ID is not given, waits for all currently active child processes, and the return status is zero. If ID is a a job specification, waits for all processes in that job's pipeline. If the -n option is supplied, waits for the next job to terminate and returns its exit status. Exit Status: Returns the status of the last ID; fails if ID is invalid or an invalid option is given.Display or set file mode mask. Sets the user file-creation mask to MODE. If MODE is omitted, prints the current value of the mask. If MODE begins with a digit, it is interpreted as an octal number; otherwise it is a symbolic mode string like that accepted by chmod(1). Options: -p if MODE is omitted, output in a form that may be reused as input -S makes the output symbolic; otherwise an octal number is output Exit Status: Returns success unless MODE is invalid or an invalid option is given.Modify shell resource limits. Provides control over the resources available to the shell and processes it creates, on systems that allow such control. Options: -S use the `soft' resource limit -H use the `hard' resource limit -a all current limits are reported -b the socket buffer size -c the maximum size of core files created -d the maximum size of a process's data segment -e the maximum scheduling priority (`nice') -f the maximum size of files written by the shell and its children -i the maximum number of pending signals -k the maximum number of kqueues allocated for this process -l the maximum size a process may lock into memory -m the maximum resident set size -n the maximum number of open file descriptors -p the pipe buffer size -q the maximum number of bytes in POSIX message queues -r the maximum real-time scheduling priority -s the maximum stack size -t the maximum amount of cpu time in seconds -u the maximum number of user processes -v the size of virtual memory -x the maximum number of file locks -P the maximum number of pseudoterminals -T the maximum number of threads Not all options are available on all platforms. If LIMIT is given, it is the new value of the specified resource; the special LIMIT values `soft', `hard', and `unlimited' stand for the current soft limit, the current hard limit, and no limit, respectively. Otherwise, the current value of the specified resource is printed. If no option is given, then -f is assumed. Values are in 1024-byte increments, except for -t, which is in seconds, -p, which is in increments of 512 bytes, and -u, which is an unscaled number of processes. Exit Status: Returns success unless an invalid option is supplied or an error occurs.Display information about command type. For each NAME, indicate how it would be interpreted if used as a command name. Options: -a display all locations containing an executable named NAME; includes aliases, builtins, and functions, if and only if the `-p' option is not also used -f suppress shell function lookup -P force a PATH search for each NAME, even if it is an alias, builtin, or function, and returns the name of the disk file that would be executed -p returns either the name of the disk file that would be executed, or nothing if `type -t NAME' would not return `file' -t output a single word which is one of `alias', `keyword', `function', `builtin', `file' or `', if NAME is an alias, shell reserved word, shell function, shell builtin, disk file, or not found, respectively Arguments: NAME Command name to be interpreted. Exit Status: Returns success if all of the NAMEs are found; fails if any are not found.Trap signals and other events. Defines and activates handlers to be run when the shell receives signals or other conditions. ARG is a command to be read and executed when the shell receives the signal(s) SIGNAL_SPEC. If ARG is absent (and a single SIGNAL_SPEC is supplied) or `-', each specified signal is reset to its original value. If ARG is the null string each SIGNAL_SPEC is ignored by the shell and by the commands it invokes. If a SIGNAL_SPEC is EXIT (0) ARG is executed on exit from the shell. If a SIGNAL_SPEC is DEBUG, ARG is executed before every simple command. If a SIGNAL_SPEC is RETURN, ARG is executed each time a shell function or a script run by the . or source builtins finishes executing. A SIGNAL_SPEC of ERR means to execute ARG each time a command's failure would cause the shell to exit when the -e option is enabled. If no arguments are supplied, trap prints the list of commands associated with each signal. Options: -l print a list of signal names and their corresponding numbers -p display the trap commands associated with each SIGNAL_SPEC Each SIGNAL_SPEC is either a signal name in or a signal number. Signal names are case insensitive and the SIG prefix is optional. A signal may be sent to the shell with "kill -signal $$". Exit Status: Returns success unless a SIGSPEC is invalid or an invalid option is given.Display process times. Prints the accumulated user and system times for the shell and all of its child processes. Exit Status: Always succeeds.Evaluate conditional expression. This is a synonym for the "test" builtin, but the last argument must be a literal `]', to match the opening `['.Evaluate conditional expression. Exits with a status of 0 (true) or 1 (false) depending on the evaluation of EXPR. Expressions may be unary or binary. Unary expressions are often used to examine the status of a file. There are string operators and numeric comparison operators as well. The behavior of test depends on the number of arguments. Read the bash manual page for the complete specification. File operators: -a FILE True if file exists. -b FILE True if file is block special. -c FILE True if file is character special. -d FILE True if file is a directory. -e FILE True if file exists. -f FILE True if file exists and is a regular file. -g FILE True if file is set-group-id. -h FILE True if file is a symbolic link. -L FILE True if file is a symbolic link. -k FILE True if file has its `sticky' bit set. -p FILE True if file is a named pipe. -r FILE True if file is readable by you. -s FILE True if file exists and is not empty. -S FILE True if file is a socket. -t FD True if FD is opened on a terminal. -u FILE True if the file is set-user-id. -w FILE True if the file is writable by you. -x FILE True if the file is executable by you. -O FILE True if the file is effectively owned by you. -G FILE True if the file is effectively owned by your group. -N FILE True if the file has been modified since it was last read. FILE1 -nt FILE2 True if file1 is newer than file2 (according to modification date). FILE1 -ot FILE2 True if file1 is older than file2. FILE1 -ef FILE2 True if file1 is a hard link to file2. String operators: -z STRING True if string is empty. -n STRING STRING True if string is not empty. STRING1 = STRING2 True if the strings are equal. STRING1 != STRING2 True if the strings are not equal. STRING1 < STRING2 True if STRING1 sorts before STRING2 lexicographically. STRING1 > STRING2 True if STRING1 sorts after STRING2 lexicographically. Other operators: -o OPTION True if the shell option OPTION is enabled. -v VAR True if the shell variable VAR is set. -R VAR True if the shell variable VAR is set and is a name reference. ! EXPR True if expr is false. EXPR1 -a EXPR2 True if both expr1 AND expr2 are true. EXPR1 -o EXPR2 True if either expr1 OR expr2 is true. arg1 OP arg2 Arithmetic tests. OP is one of -eq, -ne, -lt, -le, -gt, or -ge. Arithmetic binary operators return true if ARG1 is equal, not-equal, less-than, less-than-or-equal, greater-than, or greater-than-or-equal than ARG2. Exit Status: Returns success if EXPR evaluates to true; fails if EXPR evaluates to false or an invalid argument is given.Suspend shell execution. Suspend the execution of this shell until it receives a SIGCONT signal. Unless forced, login shells cannot be suspended. Options: -f force the suspend, even if the shell is a login shell Exit Status: Returns success unless job control is not enabled or an error occurs.Execute commands from a file in the current shell. Read and execute commands from FILENAME in the current shell. The entries in $PATH are used to find the directory containing FILENAME. If any ARGUMENTS are supplied, they become the positional parameters when FILENAME is executed. Exit Status: Returns the status of the last command executed in FILENAME; fails if FILENAME cannot be read.Shift positional parameters. Rename the positional parameters $N+1,$N+2 ... to $1,$2 ... If N is not given, it is assumed to be 1. Exit Status: Returns success unless N is negative or greater than $#.Mark shell variables as unchangeable. Mark each NAME as read-only; the values of these NAMEs may not be changed by subsequent assignment. If VALUE is supplied, assign VALUE before marking as read-only. Options: -a refer to indexed array variables -A refer to associative array variables -f refer to shell functions -p display a list of all readonly variables or functions, depending on whether or not the -f option is given An argument of `--' disables further option processing. Exit Status: Returns success unless an invalid option is given or NAME is invalid.Set export attribute for shell variables. Marks each NAME for automatic export to the environment of subsequently executed commands. If VALUE is supplied, assign VALUE before exporting. Options: -f refer to shell functions -n remove the export property from each NAME -p display a list of all exported variables and functions An argument of `--' disables further option processing. Exit Status: Returns success unless an invalid option is given or NAME is invalid.Unset values and attributes of shell variables and functions. For each NAME, remove the corresponding variable or function. Options: -f treat each NAME as a shell function -v treat each NAME as a shell variable -n treat each NAME as a name reference and unset the variable itself rather than the variable it references Without options, unset first tries to unset a variable, and if that fails, tries to unset a function. Some variables cannot be unset; also see `readonly'. Exit Status: Returns success unless an invalid option is given or a NAME is read-only.Set or unset values of shell options and positional parameters. Change the value of shell attributes and positional parameters, or display the names and values of shell variables. Options: -a Mark variables which are modified or created for export. -b Notify of job termination immediately. -e Exit immediately if a command exits with a non-zero status. -f Disable file name generation (globbing). -h Remember the location of commands as they are looked up. -k All assignment arguments are placed in the environment for a command, not just those that precede the command name. -m Job control is enabled. -n Read commands but do not execute them. -o option-name Set the variable corresponding to option-name: allexport same as -a braceexpand same as -B emacs use an emacs-style line editing interface errexit same as -e errtrace same as -E functrace same as -T hashall same as -h histexpand same as -H history enable command history ignoreeof the shell will not exit upon reading EOF interactive-comments allow comments to appear in interactive commands keyword same as -k monitor same as -m noclobber same as -C noexec same as -n noglob same as -f nolog currently accepted but ignored notify same as -b nounset same as -u onecmd same as -t physical same as -P pipefail the return value of a pipeline is the status of the last command to exit with a non-zero status, or zero if no command exited with a non-zero status posix change the behavior of bash where the default operation differs from the Posix standard to match the standard privileged same as -p verbose same as -v vi use a vi-style line editing interface xtrace same as -x -p Turned on whenever the real and effective user ids do not match. Disables processing of the $ENV file and importing of shell functions. Turning this option off causes the effective uid and gid to be set to the real uid and gid. -t Exit after reading and executing one command. -u Treat unset variables as an error when substituting. -v Print shell input lines as they are read. -x Print commands and their arguments as they are executed. -B the shell will perform brace expansion -C If set, disallow existing regular files to be overwritten by redirection of output. -E If set, the ERR trap is inherited by shell functions. -H Enable ! style history substitution. This flag is on by default when the shell is interactive. -P If set, do not resolve symbolic links when executing commands such as cd which change the current directory. -T If set, the DEBUG and RETURN traps are inherited by shell functions. -- Assign any remaining arguments to the positional parameters. If there are no remaining arguments, the positional parameters are unset. - Assign any remaining arguments to the positional parameters. The -x and -v options are turned off. Using + rather than - causes these flags to be turned off. The flags can also be used upon invocation of the shell. The current set of flags may be found in $-. The remaining n ARGs are positional parameters and are assigned, in order, to $1, $2, .. $n. If no ARGs are given, all shell variables are printed. Exit Status: Returns success unless an invalid option is given.Return from a shell function. Causes a function or sourced script to exit with the return value specified by N. If N is omitted, the return status is that of the last command executed within the function or script. Exit Status: Returns N, or failure if the shell is not executing a function or script.Read a line from the standard input and split it into fields. Reads a single line from the standard input, or from file descriptor FD if the -u option is supplied. The line is split into fields as with word splitting, and the first word is assigned to the first NAME, the second word to the second NAME, and so on, with any leftover words assigned to the last NAME. Only the characters found in $IFS are recognized as word delimiters. If no NAMEs are supplied, the line read is stored in the REPLY variable. Options: -a array assign the words read to sequential indices of the array variable ARRAY, starting at zero -d delim continue until the first character of DELIM is read, rather than newline -e use Readline to obtain the line in an interactive shell -i text use TEXT as the initial text for Readline -n nchars return after reading NCHARS characters rather than waiting for a newline, but honor a delimiter if fewer than NCHARS characters are read before the delimiter -N nchars return only after reading exactly NCHARS characters, unless EOF is encountered or read times out, ignoring any delimiter -p prompt output the string PROMPT without a trailing newline before attempting to read -r do not allow backslashes to escape any characters -s do not echo input coming from a terminal -t timeout time out and return failure if a complete line of input is not read within TIMEOUT seconds. The value of the TMOUT variable is the default timeout. TIMEOUT may be a fractional number. If TIMEOUT is 0, read returns immediately, without trying to read any data, returning success only if input is available on the specified file descriptor. The exit status is greater than 128 if the timeout is exceeded -u fd read from file descriptor FD instead of the standard input Exit Status: The return code is zero, unless end-of-file is encountered, read times out (in which case it's greater than 128), a variable assignment error occurs, or an invalid file descriptor is supplied as the argument to -u.Evaluate arithmetic expressions. Evaluate each ARG as an arithmetic expression. Evaluation is done in fixed-width integers with no check for overflow, though division by 0 is trapped and flagged as an error. The following list of operators is grouped into levels of equal-precedence operators. The levels are listed in order of decreasing precedence. id++, id-- variable post-increment, post-decrement ++id, --id variable pre-increment, pre-decrement -, + unary minus, plus !, ~ logical and bitwise negation ** exponentiation *, /, % multiplication, division, remainder +, - addition, subtraction <<, >> left and right bitwise shifts <=, >=, <, > comparison ==, != equality, inequality & bitwise AND ^ bitwise XOR | bitwise OR && logical AND || logical OR expr ? expr : expr conditional operator =, *=, /=, %=, +=, -=, <<=, >>=, &=, ^=, |= assignment Shell variables are allowed as operands. The name of the variable is replaced by its value (coerced to a fixed-width integer) within an expression. The variable need not have its integer attribute turned on to be used in an expression. Operators are evaluated in order of precedence. Sub-expressions in parentheses are evaluated first and may override the precedence rules above. Exit Status: If the last ARG evaluates to 0, let returns 1; let returns 0 otherwise.Send a signal to a job. Send the processes identified by PID or JOBSPEC the signal named by SIGSPEC or SIGNUM. If neither SIGSPEC nor SIGNUM is present, then SIGTERM is assumed. Options: -s sig SIG is a signal name -n sig SIG is a signal number -l list the signal names; if arguments follow `-l' they are assumed to be signal numbers for which names should be listed -L synonym for -l Kill is a shell builtin for two reasons: it allows job IDs to be used instead of process IDs, and allows processes to be killed if the limit on processes that you can create is reached. Exit Status: Returns success unless an invalid option is given or an error occurs.Remove jobs from current shell. Removes each JOBSPEC argument from the table of active jobs. Without any JOBSPECs, the shell uses its notion of the current job. Options: -a remove all jobs if JOBSPEC is not supplied -h mark each JOBSPEC so that SIGHUP is not sent to the job if the shell receives a SIGHUP -r remove only running jobs Exit Status: Returns success unless an invalid option or JOBSPEC is given.Display status of jobs. Lists the active jobs. JOBSPEC restricts output to that job. Without options, the status of all active jobs is displayed. Options: -l lists process IDs in addition to the normal information -n lists only processes that have changed status since the last notification -p lists process IDs only -r restrict output to running jobs -s restrict output to stopped jobs If -x is supplied, COMMAND is run after all job specifications that appear in ARGS have been replaced with the process ID of that job's process group leader. Exit Status: Returns success unless an invalid option is given or an error occurs. If -x is used, returns the exit status of COMMAND.Display or manipulate the history list. Display the history list with line numbers, prefixing each modified entry with a `*'. An argument of N lists only the last N entries. Options: -c clear the history list by deleting all of the entries -d offset delete the history entry at position OFFSET. -a append history lines from this session to the history file -n read all history lines not already read from the history file and append them to the history list -r read the history file and append the contents to the history list -w write the current history to the history file -p perform history expansion on each ARG and display the result without storing it in the history list -s append the ARGs to the history list as a single entry If FILENAME is given, it is used as the history file. Otherwise, if HISTFILE has a value, that is used, else ~/.bash_history. If the HISTTIMEFORMAT variable is set and not null, its value is used as a format string for strftime(3) to print the time stamp associated with each displayed history entry. No time stamps are printed otherwise. Exit Status: Returns success unless an invalid option is given or an error occurs.Display information about builtin commands. Displays brief summaries of builtin commands. If PATTERN is specified, gives detailed help on all commands matching PATTERN, otherwise the list of help topics is printed. Options: -d output short description for each topic -m display usage in pseudo-manpage format -s output only a short usage synopsis for each topic matching PATTERN Arguments: PATTERN Pattern specifiying a help topic Exit Status: Returns success unless PATTERN is not found or an invalid option is given.Remember or display program locations. Determine and remember the full pathname of each command NAME. If no arguments are given, information about remembered commands is displayed. Options: -d forget the remembered location of each NAME -l display in a format that may be reused as input -p pathname use PATHNAME as the full pathname of NAME -r forget all remembered locations -t print the remembered location of each NAME, preceding each location with the corresponding NAME if multiple NAMEs are given Arguments: NAME Each NAME is searched for in $PATH and added to the list of remembered commands. Exit Status: Returns success unless NAME is not found or an invalid option is given.Move jobs to the background. Place the jobs identified by each JOB_SPEC in the background, as if they had been started with `&'. If JOB_SPEC is not present, the shell's notion of the current job is used. Exit Status: Returns success unless job control is not enabled or an error occurs.Move job to the foreground. Place the job identified by JOB_SPEC in the foreground, making it the current job. If JOB_SPEC is not present, the shell's notion of the current job is used. Exit Status: Status of command placed in foreground, or failure if an error occurs.Display or execute commands from the history list. fc is used to list or edit and re-execute commands from the history list. FIRST and LAST can be numbers specifying the range, or FIRST can be a string, which means the most recent command beginning with that string. Options: -e ENAME select which editor to use. Default is FCEDIT, then EDITOR, then vi -l list lines instead of editing -n omit line numbers when listing -r reverse the order of the lines (newest listed first) With the `fc -s [pat=rep ...] [command]' format, COMMAND is re-executed after the substitution OLD=NEW is performed. A useful alias to use with this is r='fc -s', so that typing `r cc' runs the last command beginning with `cc' and typing `r' re-executes the last command. Exit Status: Returns success or status of executed command; non-zero if an error occurs.Exit a login shell. Exits a login shell with exit status N. Returns an error if not executed in a login shell.Exit the shell. Exits the shell with a status of N. If N is omitted, the exit status is that of the last command executed.Replace the shell with the given command. Execute COMMAND, replacing this shell with the specified program. ARGUMENTS become the arguments to COMMAND. If COMMAND is not specified, any redirections take effect in the current shell. Options: -a name pass NAME as the zeroth argument to COMMAND -c execute COMMAND with an empty environment -l place a dash in the zeroth argument to COMMAND If the command cannot be executed, a non-interactive shell exits, unless the shell option `execfail' is set. Exit Status: Returns success unless COMMAND is not found or a redirection error occurs.Parse option arguments. Getopts is used by shell procedures to parse positional parameters as options. OPTSTRING contains the option letters to be recognized; if a letter is followed by a colon, the option is expected to have an argument, which should be separated from it by white space. Each time it is invoked, getopts will place the next option in the shell variable $name, initializing name if it does not exist, and the index of the next argument to be processed into the shell variable OPTIND. OPTIND is initialized to 1 each time the shell or a shell script is invoked. When an option requires an argument, getopts places that argument into the shell variable OPTARG. getopts reports errors in one of two ways. If the first character of OPTSTRING is a colon, getopts uses silent error reporting. In this mode, no error messages are printed. If an invalid option is seen, getopts places the option character found into OPTARG. If a required argument is not found, getopts places a ':' into NAME and sets OPTARG to the option character found. If getopts is not in silent mode, and an invalid option is seen, getopts places '?' into NAME and unsets OPTARG. If a required argument is not found, a '?' is placed in NAME, OPTARG is unset, and a diagnostic message is printed. If the shell variable OPTERR has the value 0, getopts disables the printing of error messages, even if the first character of OPTSTRING is not a colon. OPTERR has the value 1 by default. Getopts normally parses the positional parameters ($0 - $9), but if more arguments are given, they are parsed instead. Exit Status: Returns success if an option is found; fails if the end of options is encountered or an error occurs.Execute arguments as a shell command. Combine ARGs into a single string, use the result as input to the shell, and execute the resulting commands. Exit Status: Returns exit status of command or success if command is null.Enable and disable shell builtins. Enables and disables builtin shell commands. Disabling allows you to execute a disk command which has the same name as a shell builtin without using a full pathname. Options: -a print a list of builtins showing whether or not each is enabled -n disable each NAME or display a list of disabled builtins -p print the list of builtins in a reusable format -s print only the names of Posix `special' builtins Options controlling dynamic loading: -f Load builtin NAME from shared object FILENAME -d Remove a builtin loaded with -f Without options, each NAME is enabled. To use the `test' found in $PATH instead of the shell builtin version, type `enable -n test'. Exit Status: Returns success unless NAME is not a shell builtin or an error occurs.Write arguments to the standard output. Display the ARGs, separated by a single space character and followed by a newline, on the standard output. Options: -n do not append a newline -e enable interpretation of the following backslash escapes -E explicitly suppress interpretation of backslash escapes `echo' interprets the following backslash-escaped characters: \a alert (bell) \b backspace \c suppress further output \e escape character \E escape character \f form feed \n new line \r carriage return \t horizontal tab \v vertical tab \\ backslash \0nnn the character whose ASCII code is NNN (octal). NNN can be 0 to 3 octal digits \xHH the eight-bit character whose value is HH (hexadecimal). HH can be one or two hex digits Exit Status: Returns success unless a write error occurs.Define local variables. Create a local variable called NAME, and give it VALUE. OPTION can be any option accepted by `declare'. Local variables can only be used within a function; they are visible only to the function where they are defined and its children. Exit Status: Returns success unless an invalid option is supplied, a variable assignment error occurs, or the shell is not executing a function.Set variable values and attributes. A synonym for `declare'. See `help declare'.Set variable values and attributes. Declare variables and give them attributes. If no NAMEs are given, display the attributes and values of all variables. Options: -f restrict action or display to function names and definitions -F restrict display to function names only (plus line number and source file when debugging) -g create global variables when used in a shell function; otherwise ignored -p display the attributes and value of each NAME Options which set attributes: -a to make NAMEs indexed arrays (if supported) -A to make NAMEs associative arrays (if supported) -i to make NAMEs have the `integer' attribute -l to convert NAMEs to lower case on assignment -n make NAME a reference to the variable named by its value -r to make NAMEs readonly -t to make NAMEs have the `trace' attribute -u to convert NAMEs to upper case on assignment -x to make NAMEs export Using `+' instead of `-' turns off the given attribute. Variables with the integer attribute have arithmetic evaluation (see the `let' command) performed when the variable is assigned a value. When used in a function, `declare' makes NAMEs local, as with the `local' command. The `-g' option suppresses this behavior. Exit Status: Returns success unless an invalid option is supplied or a variable assignment error occurs.Execute a simple command or display information about commands. Runs COMMAND with ARGS suppressing shell function lookup, or display information about the specified COMMANDs. Can be used to invoke commands on disk when a function with the same name exists. Options: -p use a default value for PATH that is guaranteed to find all of the standard utilities -v print a description of COMMAND similar to the `type' builtin -V print a more verbose description of each COMMAND Exit Status: Returns exit status of COMMAND, or failure if COMMAND is not found.Return an unsuccessful result. Exit Status: Always fails.Return a successful result. Exit Status: Always succeeds.Null command. No effect; the command does nothing. Exit Status: Always succeeds.Print the name of the current working directory. Options: -L print the value of $PWD if it names the current working directory -P print the physical directory, without any symbolic links By default, `pwd' behaves as if `-L' were specified. Exit Status: Returns 0 unless an invalid option is given or the current directory cannot be read.Change the shell working directory. Change the current directory to DIR. The default DIR is the value of the HOME shell variable. The variable CDPATH defines the search path for the directory containing DIR. Alternative directory names in CDPATH are separated by a colon (:). A null directory name is the same as the current directory. If DIR begins with a slash (/), then CDPATH is not used. If the directory is not found, and the shell option `cdable_vars' is set, the word is assumed to be a variable name. If that variable has a value, its value is used for DIR. Options: -L force symbolic links to be followed: resolve symbolic links in DIR after processing instances of `..' -P use the physical directory structure without following symbolic links: resolve symbolic links in DIR before processing instances of `..' -e if the -P option is supplied, and the current working directory cannot be determined successfully, exit with a non-zero status -@ on systems that support it, present a file with extended attributes as a directory containing the file attributes The default is to follow symbolic links, as if `-L' were specified. `..' is processed by removing the immediately previous pathname component back to a slash or the beginning of DIR. Exit Status: Returns 0 if the directory is changed, and if $PWD is set successfully when -P is used; non-zero otherwise.Return the context of the current subroutine call. Without EXPR, returns "$line $filename". With EXPR, returns "$line $subroutine $filename"; this extra information can be used to provide a stack trace. The value of EXPR indicates how many call frames to go back before the current one; the top frame is frame 0. Exit Status: Returns 0 unless the shell is not executing a shell function or EXPR is invalid.Execute shell builtins. Execute SHELL-BUILTIN with arguments ARGs without performing command lookup. This is useful when you wish to reimplement a shell builtin as a shell function, but need to execute the builtin within the function. Exit Status: Returns the exit status of SHELL-BUILTIN, or false if SHELL-BUILTIN is not a shell builtin..Resume for, while, or until loops. Resumes the next iteration of the enclosing FOR, WHILE or UNTIL loop. If N is specified, resumes the Nth enclosing loop. Exit Status: The exit status is 0 unless N is not greater than or equal to 1.Exit for, while, or until loops. Exit a FOR, WHILE or UNTIL loop. If N is specified, break N enclosing loops. Exit Status: The exit status is 0 unless N is not greater than or equal to 1.Set Readline key bindings and variables. Bind a key sequence to a Readline function or a macro, or set a Readline variable. The non-option argument syntax is equivalent to that found in ~/.inputrc, but must be passed as a single argument: e.g., bind '"\C-x\C-r": re-read-init-file'. Options: -m keymap Use KEYMAP as the keymap for the duration of this command. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. -l List names of functions. -P List function names and bindings. -p List functions and bindings in a form that can be reused as input. -S List key sequences that invoke macros and their values -s List key sequences that invoke macros and their values in a form that can be reused as input. -V List variable names and values -v List variable names and values in a form that can be reused as input. -q function-name Query about which keys invoke the named function. -u function-name Unbind all keys which are bound to the named function. -r keyseq Remove the binding for KEYSEQ. -f filename Read key bindings from FILENAME. -x keyseq:shell-command Cause SHELL-COMMAND to be executed when KEYSEQ is entered. -X List key sequences bound with -x and associated commands in a form that can be reused as input. Exit Status: bind returns 0 unless an unrecognized option is given or an error occurs.Remove each NAME from the list of defined aliases. Options: -a remove all alias definitions Return success unless a NAME is not an existing alias.Define or display aliases. Without arguments, `alias' prints the list of aliases in the reusable form `alias NAME=VALUE' on standard output. Otherwise, an alias is defined for each NAME whose VALUE is given. A trailing space in VALUE causes the next word to be checked for alias substitution when the alias is expanded. Options: -p print all defined aliases in a reusable format Exit Status: alias returns true unless a NAME is supplied for which no alias has been defined.alias [-p] [name[=value] ... ]bind [-lpsvPSVX] [-m keymap] [-f filename] [-q name] [-u name] [-r keyseq] [-x keyseq:shell-command] [keyseq:readline-function or readline-command]builtin [shell-builtin [arg ...]]command [-pVv] command [arg ...]declare [-aAfFgilnrtux] [-p] [name[=value] ...]typeset [-aAfFgilnrtux] [-p] name[=value] ...local [option] name[=value] ...enable [-a] [-dnps] [-f filename] [name ...]exec [-cl] [-a name] [command [arguments ...]] [redirection ...]fc [-e ename] [-lnr] [first] [last] or fc -s [pat=rep] [command]hash [-lr] [-p pathname] [-dt] [name ...]history [-c] [-d offset] [n] or history -anrw [filename] or history -ps arg [arg...]jobs [-lnprs] [jobspec ...] or jobs -x command [args]disown [-h] [-ar] [jobspec ... | pid ...]kill [-s sigspec | -n signum | -sigspec] pid | jobspec ... or kill -l [sigspec]read [-ers] [-a array] [-d delim] [-i text] [-n nchars] [-N nchars] [-p prompt] [-t timeout] [-u fd] [name ...]set [-abefhkmnptuvxBCHP] [-o option-name] [--] [arg ...]unset [-f] [-v] [-n] [name ...]export [-fn] [name[=value] ...] or export -preadonly [-aAf] [name[=value] ...] or readonly -ptrap [-lp] [[arg] signal_spec ...]ulimit [-SHabcdefiklmnpqrstuvxPT] [limit]for NAME [in WORDS ... ] ; do COMMANDS; donefor (( exp1; exp2; exp3 )); do COMMANDS; doneselect NAME [in WORDS ... ;] do COMMANDS; donecase WORD in [PATTERN [| PATTERN]...) COMMANDS ;;]... esacif COMMANDS; then COMMANDS; [ elif COMMANDS; then COMMANDS; ]... [ else COMMANDS; ] fiwhile COMMANDS; do COMMANDS; doneuntil COMMANDS; do COMMANDS; donecoproc [NAME] command [redirections]function name { COMMANDS ; } or name () { COMMANDS ; }variables - Names and meanings of some shell variablesshopt [-pqsu] [-o] [optname ...]printf [-v var] format [arguments]complete [-abcdefgjksuv] [-pr] [-DE] [-o option] [-A action] [-G globpat] [-W wordlist] [-F function] [-C command] [-X filterpat] [-P prefix] [-S suffix] [name ...]compgen [-abcdefgjksuv] [-o option] [-A action] [-G globpat] [-W wordlist] [-F function] [-C command] [-X filterpat] [-P prefix] [-S suffix] [word]compopt [-o|+o option] [-DE] [name ...]mapfile [-d delim] [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array]readarray [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array]unaliasunalias [-a] name [name ...]breakbreak [n]continuecontinue [n]callercaller [expr]cd [-L|[-P [-e]] [-@]] [dir]pwdpwd [-LP]truefalsedeclaretypesetlocalecho [-neE] [arg ...]enableeval [arg ...]getoptsgetopts optstring name [arg]exit [n]logout [n]fg [job_spec]bg [job_spec ...]help [-dms] [pattern ...]disownlet arg [arg ...]readreturn [n]readonlyshiftshift [n]sourcesource filename [arguments]. filename [arguments]suspend [-f]testtest [expr][ arg... ]timestype [-afptP] name [name ...]ulimitumaskumask [-p] [-S] [mode]waitwait [-n] [id ...]time [-p] pipeline{ ... }{ COMMANDS ; }job_spec [&](( ... ))(( expression ))[[ ... ]][[ expression ]]pushdpushd [-n] [+N | -N | dir]popdpopd [-n] [+N | -N]dirs [-clpv] [+N] [-N]shoptprintfcompgencompoptmapfilereadarray-- alias %s`%s': invalid alias name, line editing not enabledbind_builtinlvpVPsSXf:q:u:m:r:x:`%s': invalid keymap name%s: cannot read: %s`%s': unknown function name%s is not bound to any keys. %s can be invoked via "%s"%s`%s': cannot unbindonly meaningful in a `for', `while', or `until' loop--helploop countNULL%s %s %s OLDPWD=chdireLPHOME not setOLDPWD not setCDPATHpvVcommand_builtin%s: usage: %s: numeric argument required%s: not found%s: invalid option nameinvalid octal numberinvalid hex number%s: %s out of range%s: no such job%s: no job control%s: restricted%s: not a shell builtinwrite error: %s`'%s: ambiguous job specSIGJUNKUnknown%2d) %s%s: invalid signal specification`%s': not a pid or valid job specerror setting terminal attributes: %serror getting terminal attributes: %s%s: error retrieving current directory: %s: %s +acfgilnprtuxAF%s %d %s %s: reference variable cannot be an array`%s': invalid variable name for name referencecannot use `-f' to make functions%s: quoted compound array assignment deprecated%s: cannot destroy array variables in this way%s: cannot convert associative to indexed arraycan only be used in a functionneEadnpsf:enable %s enable -n %s BASH_LOADABLES_PATH%s: not dynamically loaded%s: cannot delete: %scannot open shared object %s: %scannot find %s in shared object %s: %sload function for %s returns failure (%d): not loaded_builtin_unload%s: is a directory%s: not a regular file%s: file is too large_evalfileparse_and_execute toppe_disposeparse_and_executeparse_string topparse_stringevalstring%s: ignoring function definition attemptcla:%s: cannot execute: %s~/.bash_logout/etc/bash.bash_logoutThere are stopped jobs. There are running jobs. exit logout not login shell: use `exit'${FCEDIT:-${EDITOR:-ed}}${FCEDIT:-${EDITOR:-vi}}:e:lnrsno command foundhistory specificationbash-fc%s: cannot open temp file: %s %c%s %sfc builtincurrentjob %d started without job control%4d %s builtin hash -p %s %s hashing disableddlp:rt-thits command %s: hash table empty %s %s: cannot open: %s%*s%s %s: %s dms%ls%c%s %ls %*s%s - SYNOPSIS%*s%s DESCRIPTIONSEE ALSO%*sbash(1) IMPLEMENTATIONThese shell commands are defined internally. Type `help' to see this list. Type `help name' to find out more about the function `name'. Use `info bash' to find out more about the shell in general. Use `man -k' or `info' to find out more about commands not in this list. A star (*) next to a name means that the command is disabled. Shell commands matching keywords `Shell commands matching keyword `no help topics match `%s'. Try `help help' or `man -k %s' or `info %s'.acd:npsrw%s: history expansion failedhistory position%s: invalid timestamp%5d%c %s%s cannot use more than one of -anrwno other options allowed with `-x'lpnxrsjobs_builtinahrUnknown error(%ld) - %s%s: arguments must be process or job IDsMAPFILE%s: invalid line count%s: invalid array origin%s: invalid callback quantumd:u:n:O:tC:c:s:empty array variable name%s: not an indexed array%s %d %s%s: invalid file descriptor specification%d: invalid file descriptor: %sinternal error: getting variable namedirectory stack emptydirectory stack index %2d %sno other directory%s: invalid argumentdirstackersa:d:i:n:p:t:u:N:read_builtinread error: %d: %s%s: invalid timeout specificationcan only `return' from a function or sourced scriptoff%-15s %s set %co %s allexportbraceexpandfnv%s: cannot unset%s: not an array variableerrtracefunctracehashallhistexpandinteractive-commentskeywordmonitornoclobbernoexecnoglobnolognotifynounsetonecmdphysicalpipefailprivilegedxtracecannot simultaneously unset a function and a variabledeclare -%s %s -%s aAfnp%s: not a function%s: cannot exportshift countfilename argument required%s: file not foundcannot suspendcannot suspend a login shellunknowntrap -- %s %d trap -- %s %s ))+*)))))))))))*))))***%s is aliased to `%s' alias %s=%s %s is a shell keyword %s is a function %s is a shell builtin %s is %s %s is hashed (%s) -type-path-allafptP%s is a special shell builtin (%s, -%c) (-%c) %-20s %16sunlimited%s: cannot get limit: %shardsoft%s: cannot modify limit: %s`%c': bad commandcore file sizeblocksdata seg sizekbytesscheduling prioritypending signalsmax locked memorymax memory sizeopen filespipe size512 bytesPOSIX message queuesreal-time prioritystack sizecpu timesecondsmax user processesvirtual memoryfile locksu=%s,g=%s,o=%s agourwx -SSpumask%s %04lo `%c': invalid symbolic mode operator`%c': invalid symbolic mode characterOPTARG%s: invalid shell option nameautocd-s-ushopt %s %s cdable_varsBASHOPTSpsuoqcdspellcheckhashcheckjobscheckwinsizecmdhistcompat31compat32compat40compat41compat42compat43complete_fullquotedirexpanddirspelldotglobexecfailexpand_aliasesextdebugextglobextquotefailglobforce_fignoreglobasciirangesglobstargnu_errfmthistappendhistreedithistverifyhostcompletehuponexitinherit_errexitinteractive_commentslastpipelithistmailwarnno_empty_cmd_completionnocaseglobnocasematchnullglobprogcomppromptvarsrestricted_shellshift_verbosesourcepathsyslog_historyxpg_echopLLzLzLzLzLzLzLzLLLLLcannot set and unset shell options simultaneouslymissing hex digit for \xmissing unicode digit for \%cwarning: %s: %s#'-+ 0v:hjlLtzU,W,W,W,WU,W,W,W,W,W,W,W,W,U,U,U,U,U,U,U,U,W,W,W,W,W,W,WU,W,W,W,W,WU,W,W,W,W,W,W,W,W,W,W,W,W,W,W,WU,W,W,W,W,W,WV,W,W,W,WVlV|V,WU,V,W,W,W,W,W,W,W<=;|&{(Display all %d possibilities? (y or n)bad value %d for what_to_do in rl_completereadline: $endif without matching $ifnoneaudiblevisibleterm=mode=C-\M-"%s%s": "%s" %s%s outputs %s emacs-standard(ins)(cmd)bell-stylecompletion-display-widthcompletion-query-itemshistory-sizeisearch-terminatorskeymapkeyseq-timeoutemacs-mode-stringvi-cmd-mode-stringvi-ins-mode-stringbind-tty-special-charsblink-matching-parenprefer-visible-bellshow-mode-in-prompt%s: unknown variable nameControl-Meta%s: unknown parser directive%s: unknown key modifierprefix-meta/etc/inputrcINPUTRC~/.inputrc\C-%c# %s (not bound) "%s": %s %s is not bound to any keys %s can be found on ... set %s %s %s is set to `%s' emacs-metaemacs-ctlxvi-movevi-commandvi-insertEscapeLFDNewlineRETReturnRuboutSPCSpaceTabbyte-orientedcolored-completion-prefixcolored-statscompletion-map-caseconvert-metadisable-completionecho-control-charactersenable-bracketed-pasteenable-keypadenable-meta-keyexpand-tildehistory-preserve-pointhorizontal-scroll-modemark-directoriesmark-modified-linesmark-symlinked-directoriesmatch-hidden-filesmenu-complete-display-prefixmeta-flagoutput-metapage-completionsrevert-all-at-newlineshow-all-if-ambiguousshow-all-if-unmodifiedskip-completed-textvisible-statsendifincludeotherC-CTRL-$else found without matching $ifcompletion-prefix-display-length%s: no closing `"' in key binding%s: no key sequence terminatorprint-completions-horizontally`@ 0pPabtnvfr W.\-!-a0.0\%o/-_=~.#$[201~readline_callback_read_char() called with no handler!coli@7 amxnkmDCclcrdceiimkDkHkIkdkhklkrkummmopcvbvsutf8(arg: %d) X%luevent not foundbad word specifiersubstitution failedunrecognized history modifierno previous substitution() <>;&|$!@?+*"'`^$*%-:$*%^ ;&()|<> =5<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<7<75<7<7\5<7<7<7<7<7<7<7H515554<7<7<74 ~ ~targetggggggggggggggggggggggggggggggggggggggggggggggggiiiiiiiiggggggghggggggggggggggggggggggggxhgggggghhgg8igghhgggggggXhgggHhg8hg(hgxhlcLS_COLORSLS_COLORS: syntax error: %s[01;3401;3601;3501;3301;3237;4130;4337;4434;4230;4230;41nodilnpisobdmisusgtwcamhLS_COLORS: unrecognized prefix: %sunparsable value for LS_COLORS environment variable;B^0CXCm<ȧEX'CH(pC(C+CX,C-DD.dDH.D.D/D1Dh2Ex2,E2DE2XEh3xE4E84E4F4 F4G>G?G(@HA0HB|HCH(DHGIG$IxGax>a>a>aA,bCtbDbDbHEbxEcE0cFDchF`cF|cFcHcIdI0dSddXS|dSdXTdxV eV@e(W\exWpeXeXeZ4f8[TfX[pfx[f[f[f[f[f8\ g^lg^g^g_g` h` hdlhehehfhfiHg8i(miXnininjXojo4joHjp`j8ptjpjpjqj8qjhqjxq kq kq4kshks|ktkxtktku$lu8lvLl(v`lHvtll$mmȾmH4nnn oTohoXoH pX4phHpx\ppppp(pHpXppp$qxLqtqHqqr,rHrrrr8sx0s\s8sxss(stDt`thtxttttt$uDuxuu(uXv v4vH\vXpvvv(w,w\wxwwwwxxX4H>H?(@AhB@BTCCDXDDDE$EHE\EpF8FXFFFFGG(ITJK8KxKLL$MPhNNNOhOP@Q\hQQQxRHT<xTTTp8VxVVV(W W<WPXxX(YZ,[x(\(ab$xcXclce(f8fHfghg|h(iHi8kklHnh8n|oHo8pXpq<qXrphsssvLh{ph||}~؁P8l((,X@X؆xX(4hPH( <lxH(Hxؖ D`ؗt(8țLh`H(H؞h$`x$8PHȫ@جT(|(XtسXLȺ8 xhHL8XD`x8Xh$Th(H,hlHx,@(xXX$XXP|(hx HHhtX,8x(hx 4Ht 0x( ,H Hh ` x  X 4p P|x$XPhdhXt(Hh0(l X!#$#<h$X$t8%%%x''H,L98<8B0hBDBxXCC8E,xGhGhHHH HILIpJhJJHKLXTTTTUU8VVD(Zef gLh`8h|iHjhjjj(j@xkxklln\qhqq8rr,tPHul8vvzH{ X|\|p}(<P|(hLȅ8HXH@8( h@|xH|(Xx(LX8,xT|x$(\Hxص h|88Hh4ع`8X p(H,@T8 4h`x(h 0 H H|   h XX (   4 X   ( ( x ( ( p    x(Lhx8h4Pl0LHlx8h x4H\D` 8   H x H$xX$$H(1H2h98:x:::8:L(;hX==(>>(EHhGxxHHLM(hNHOlOOQ]@_|`Xaaa4Xfhhh(iDidwH~Dh0HȖ8XhX((h|ؠ( 8 Ƚp      !@!T!(h!!"8"T"""0#Hd###x#8@$T$$$%H %8%%%%0&P&(&H&H'H'x'h' (l((8)hX)))8D**H*$+8+ +( +X +x + + , ,( ,, x,,,,8--P--- .8.x.(/H//X// 0!D0"h0"0"0h#0',1X@1B<2(CP28Cd2HCx2C2C2H2HH3HT3O3O3P3Q4HU4W4[5x_X5b5c5c5f<6(gP6gd6h6xj6hl07XmT7xw7Ȃ777h,8X889hL9(9ؘ9T:8::(\;x;;;ش;;(<طd<<=hP=d===P>(>8>>X?0?P?8h?X?x??8?X?@8H@@@(@@H@h A0ADAXAHpAAAAXAAAB$B8BLBhB|BBxBBBB@ChtCCCDDX(DHD(\DpD8DD0ExEE FhVDVDWG4WGWHHWIWLXM?(@D`EFЀ8GGH$JTKlXLLLȁMN8NLh4؆T8pXȃ؈8tȊ؎Ԅ8x0D\XtX̅8h$@X\hxx̆H8\(̇șؙ$@Xhؚ܈8(txȞh0hhxĊȢ(<`xċHXDthxȩ@xl(T8hخxЎدH$<\(H(0Hh8HhX$x8L`(tHHБȺ,@ȽT8x8Ēh,HHēؓx(dxx̔H<XP(H̕hD\tHԖX\ܗ,(lX(xĘL(hH(<Pdx8X(@(Hԛx  xp̜@8hxНhx$8LXܞx8 X4H`Xܟx X8x(̠84hLtHxġX,hĢ((@8Thh( 08 Dh X l H  ( x < 8XDXxlXԦhHDxܧ(( xx"Ĩ<<(=d(>>ԩC$GtGLتLLxOLO`OtOHQQ(RphSSĬXTxV<VPW8Y\P8]h]|]H^^Юc8d(gh(jlm(m@8nzRx 8/D$4 FJ w?:*3$"\ tZDQLBBA C(G0 (A ABBA (I DDB AF  AA DT/JEL C(F0m (A BBBA H 8A0A(B BBBJ T tJDEPl uBAA D0e  DABD l  DABE x  GABF  z8AU J S z8AU J SL z+FDB E(H0A8G 8A0A(B BBBG P 4HPdh <FBB B(A0A8F`d 8F0A(B BBBI  8D0A(B BBBA txE A  ЩN O @ LFFEB D(A0G 0A(A BBBH \ XHc E x ̬JEyL FBE E(A0A8J) 8A0A(B BBBG @E| O c M @wAAD  AAA ^ AAH LAA0LBDA G0  AABF Wа\R0 A 3#48{FAA Z ABK DAED$tYCG R AAI SDAHH DFA4lEDG i AAE h CAD 4EAD ^ CAD M CAG <EIG P CAG x DAK DEA9EW D P<v8PtFDD v ABI ~ CBA $AE^ E M E F@ HR$H@ECD oCA``H] K o0FDA JA  AABF @H<FBB D(C0D@ 0A(A BBBH FT=Ewx*EdVKE A зiKX A $/EM F N04QD^X̸ HTpԸ@O]D:JXN4FKA B ABI \HB0tFAA G0|  AABA <кbECG Q DAK P DAK DHADTNDG Y DAI | AAB TCAH$qMK AAH`2FBD D(D0 (D ABBG h(D ABB4T6EAG  DAE w DAD (H\lEDD G DAG t[u H ^J0 jDA D0f  AABC iG ^ AA 0DEGD m DAF }AA4$]BED H(D0(A ABB0\rADO N AAD oLJEH|LY|\0bEDD q DAE TDAHVFIE B(G0A8F` 8A0A(B BBBK @EL \VED F AA 0$XEDG k AAC UAAP&A`$d;EHG dAA4|^FEI D(D0{(A ABB80gFJE D(D0B(A BBB8lgFJE D(D0B(A BBBd FBE E(D0A8F` 8A0A(B BBBH 5 8A0A(B BBBA $dHEID sAA48}FEI D(D0Z(A ABB(pRFDI {AB4dFJD D(D0A(A ABB@L$XTEID AA4$NFJD D(G0h(A ABB\4EnxSEM4EAG0i DAE n DAE `FBB B(A0A8Dp{ 8A0A(B BBBI 8D0D(D BBB@0FJE D(C0D@ 0A(A BBBE <t0#FEE D(I0 (A BBBE $ NEID yAA(HmFDI VAB(,EAG  DAB 44EAD { DAF D AAJ l. $zD` D b F iLBBB B(A0A8G 8A0A(B BBBC ,@QGHD vABD$p}Na I D1X:Ab E M4xAAG { JAI Q DAJ ,FBDH  ABJ AAD a CAE T JAI Y CAK @ CAL U CAG  CAK \ JAI L AAJ @hkAHG  JAL  AAE RCA`ULD C(G0 (D ABBO [ (A ABBG HA0DG A ,,QKHD rABD@\(FAD R HBI d AEN VAEYHC E HFIB B(A0A8DpQ 8A0A(B BBBD D0\MDO D ABI m ABH } ABH HxFBE B(A0A8G@ 8A0A(B BBBF .EdeLTH.Ed \eLT4 H WLsd 4Ej $-Ec< 8MEE O(C0 (A BBBH 4 FBA A(G0(A ABB!pBEm N A04!? BAA D0  AABF h!8Ho!JH}$! AMJ }HA`! FEB B(A0C8D@ 8D0A(B BBBF  8D0A(B BBBH $"P^Eb I mD"AJq`"M<t"OIK A(G0Z(A ABBE,"`OGA lABJP"8OBA A(G0P (D ABBM H08#2E_ L AX#ELt#EU# AP G C#EQ##EL$#1AOH IHCH$$\BBB E(D0A8Gp 8A0A(B BBBF p$$$01Dl4$XBAD  ABG ZDB8$ BGF A(D0Q (C ABBC % H$%-BBB B(A0A8GPu 8C0A(B BBBF p%EV E b(%QGDF vAAG%(@%4AAF p AAF W MAK d CAH $&hAW H N J fH<&BEB E(A0A8GP$ 8D0A(B BBBH 4&"ADG o FAF N CAF &:Dq0&[EAL Z DAG ]DA '_ '41TT8'\L'hI[ad',x'~E`' 8Er'D '@$QR'T$QR'h (d $(`/08(|FAA DPS  AABE l(8I(t((pfEG Z DF P DL 0(wEAG O DAO DAA0( BAA J  AABA () <) P) d) Hx) FBE E(A0A8J 8A0A(B BBBD `)@BEB B(A0A8DNDBZ 8A0A(B BBBK \(*l*T&FBB B(A0A8G 8A0A(B BBBF _HE$zRx ,0*0PEID | CAF mCA<*PxBBB A(A0% (J BBBC H8+ RKBEE E(D0A8DpM 8C0A(B BBBE L+WsBEE B(A0D8G 8A0A(B BBBH L+@YBEB B(A0A8G 8C0A(B BBBA 0$,`9BBE E(D0D8F`(X,bkFDI TABL,bBBB E(D0D8G 8A0A(B BBBE L,hBBB B(A0A8J S 8A0A(B BBBG $- p8-pL-p`-pt- p -,p1-Xp(-tp-p-|p!-p!$.pEAID qDA$(.pgAID VAA$P.$qWEDG ADA(x.\qbFAH } ABA .qaAF0S AA H.qBBE A(A0b (D JBBA (H BBB/prEO0/trELHL/xrBBE A(A0b (D JBBA (H BBB/rEL4/s_LDD i DBM ICB/(sEW(0,s=FAA qAB(40@swEAG C DAK $`0s9EAG fDA$0s=EAG mAA$0s8EAG eDA 0sfEG B AA 0(tfEG | AG $ 1tt9EAG fDAH1t9Es$d1tMEAI {AA1t 1t%NI1t 1t1t 01tFAD D0q  AABD (2\uPEq J OLH2uBBA A(D0j (D ABBC D (H DBBD 2u=H2vpBBB B(A0A8Dp 8A0A(B BBBA 2,w! 3Hw9M\$3pw$83lwADD DA`3wHt3w7BBB B(A0A8G` 8A0A(B BBBB 3y-\P,3y]KAA KABA$4zNpR~ J ,04zPU K j F i G C`4${HJ|A|4X{4d{H i G $4|CEAG sAA,4@|QKDA zABA85p|BDF Z DBD L ABA 0@5}OAD } ABD kt5}4HY G G5},HV B G5}OHg I V5~5Ha G D,50~FDA [ ABA $6~OHg I VD6~\H} K Gd6~4En6 HP6iH H H 6p)HN J D61HX H D66Hm 7}Er Q K M 07$THp H O8P7dFBD A(D@I (A ABBH 87(FDA j AHJ n ABG 7\HC E G7, 7(',8DFAC { ABA (@8FID l ABF (l88EID f DAC 8(Eb8Ѓ(Eb8C8 \Hi O 9d'HQ G F 9t<dP(89EAG0} AAD Hd9PlFBB B(A0A8DP" 8A0A(B BBBB 9tZHw A Y9LHe C [9GEw D  :BHU K S,:H @@:DFBB A(D0G@_ 0A(A BBBC L:FBB D(C0c (A BBBE H (A BBBA 8:FBD D(D0 (D ABBE H;FBD D(D0Y (G ABBG V(A ABB \;8aJx N P;;`EJ A O;EEx A F4;JDG0R CAE DFAA <HEq J V J 0<HD<FBA A(D0b (D ABBG D(F ABB$<UEAD EDA<%EQ<0"A`<D=@!E[ =T&E`<=hP=dd=`4x=\FAA Q ABD OAB=H=xFBB B(D0D8D` 8A0A(B BBBA >4Eg D C0>4ATgxH>l FBB B(D0A8D` 8A0A(B BBBI { 8A0A(B BBBK  8A0A(B BBBG 8>FEA A(K0G (A ABBK ?t(?oFDI XAB @?ēIW H K M ,d?@_BDA I ABE H?pBBE B(D0D8DPQ 8D0A(B BBBK 8?DrFBA A(G0 (D ABBL 8@YBA A(G0(D ABBHX@FBB B(D0A8D@j 8D0A(B BBBD $@PNECD |DA@x=EZ A \@*L]HARBED C(G0N (A ABBG [(A ABBTA,L_0pAԜfEDG [ AAC oAAdAFBB B(A0A8D`  8A0A(B BBBL  8A0A(B BBBE BEM0 AF (0B4EHD  AAB \BxED0h AA (BTEIF@c AAA 4BFAD f ABD |AB BpZEW0w AA COEW D zRx  TCTH0^ J 8pCIAA  ABG  ALJ CC3EW D RCĦ)HM K DDԦ<ErD\EG NAFAC G  AABG 0p^$SFAC G  AABA (^SEAG AAK ^T^T ^TiKn G M C _T5Hh4_UalS A ZT_PU4dKl_xUULb B _U_U_U%_U_UDA\_ VKED D(G0i (A ABBB F (A ABBD `h0LT`VBBB A(D0GPc 0A(A BBBC XL`[XAPH`pX{BBB E(A0D8DPS 8D0A(B BBBD d`ZBBE B(A0D8GPw 8A0A(B BBBH  8F0A(B BBBF LXa _BBE B(A0A8D 8A0A(B BBBG 4alb[ACG R FAD _ DAD HabBBB B(A0A8Dh 8A0A(B BBBH H,beBBB B(A0A8DB 8A0A(B BBBF @xbllFBB D(A0D@N 0D(A BBBD bmPLbTmBEB E(D0C8D 8A0A(B BBBJ H csBEB I(A0A8G 8A0A(B BBBG Llchv]BIE E(G0C8J 8A0A(B BBBG HcxzBBE E(A0A8Gp 8A0A(B BBBJ Ld<|ZBHE B(A0A8D 8A0A(B BBBD HXdLBHE E(A0A8D 8A0A(B BBBE $zRx ,h dT!dp4e|EFDA S CBE YABH@epFBI E(A0C8F`@ 8A0A(B BBBA e Le FBB E(D0C8G 8A0A(B BBBG HetFBH B(D0G8F 8A0A(B BBBB L 8A0A(B BBBC (sEACD@ AAA LtXFBEE D(D0GpyxEbxApf 0A(A BBBF <ltIBBE A(D0w (D BBBA HthJBBE E(D0A8Gp 8A0A(B BBBH HtM)BEE E(A0C8G 8A0A(B BBBG 0DuRIEED d DAI DCALxuRW BBB B(A0A8GC 8A0A(B BBBB u _u_u_v_EO v_*TU8v_!(Lv8_q]CD CAAGLxv_TEE D(A0t(A BBBBH08v<`,LAA  ABJ x ABE 0w0aEAK C DAG bDA8waHLwauFBB B(A0A8D` 8D0A(B BBBG wb1wb,Hwc&FBB B(A0A8DP 8D0A(B BBBI t xcOBB B(A0A8DP 8A0A(B BBBG D8C0A(B BBBACPLxpdFED A(D@w (A ABBG Z (A ABBH LxeZBE B(D0A8D@8A0A(B BBBB$yeEO@@yeqYED D(D0k (A ABBE P yeAJq AC LyLfBBB B(A0D8G 8A0A(B BBBA ygH ~ A z0hHR,z8hW4@zhFBA A(D0s(A ABBxzhQEK0z iRFHA D0)  AABA zLjLzXjPFIB B(A0A8G7 8A0A(B BBBC ,{Xm%E_8H{lmHBE A(A0(A BBB {nOa E } E 4{oBKA G  AABJ {tr-8{r}BBH D(D@| (A ABBJ $0|r:EHI aAAX|r3Hl|stFBE B(D0A8D` 8A0A(B BBBE L|LtNFBB B(A0A8G 8A0A(B BBBH L}Lw FIA D(D0v (A ABBD W (F CBBL X} x6l}8x6}dx_Hb F Y E }xHK}x#}x}4y/D}PyFBB A(D0I 0A(A BBBB <~z-P~{d~{x~{~({~4{~@{4~L{cNOD GABEH 4{|FIH H(I0M(A ABB8{>`L{FEB A(A0Q (A BBBI R (A BBBG  (A BBBF D}/HfH\}FEA A(F0} (A ABBJ U (H ABBN ,}\ED0H AF  AH D 0X,FAA F0x  AABF )48Y^X3,ЀFHH H ABG  (܀Op A E K Lh`tt"ā؁́؁FbD]8hLAA N ABA A DBI 4X̃EAG K FAA X AAF 46`)|68̂FDI A(G (A ABBE 'HS E F((IJAG lAAHHTOFDB B(A0A8DP 8A0A(B BBBK ć#JJ؇MEq E Q܃ ^Tf F WA,P/PAD U ABC DPttO E (`IECG U LHH (؉\ADG } AAE  ̄\BLD H(D0e (A ABBG  (M ABBE D(D ABB@)H`X'Ea<t0FBB A(A0 (A BBBC 1O\EЅ"E\1O\E܍1O^C$QOoR@D$TPYEAD LAA4|vFBG F(D0V(A ABB8ЎXAF } CBG IFBG<4BBB A(D0 (D BBBG H0FIE B(A0H8G`g 8A0A(B BBBI |XJHFBB B(A0C8G` 8A0A(B BBBG H܇HFHL I(A0A8Gp 8A0A(B BBBJ 0(EHD i DAA aDA\ pH %FBB B(A0D8DP 8A0A(B BBBA ЈAEi B P0,L(KBBB B(A0A8X 8A0A(B BBBB l(04FAA G{  AABB H}̉XEAF\E| G 0}0FAA I  AABF L8A O lV D Dt%H\ H^ J U K ܊XH``BBE B(D0A8I 8A0A(B BBBJ @t(AAF\"A8tCBBD D(FPI (A ABBG #AAR̋Ȥ*lEa J L L c E c M k M e K U K ] K Y G i O L L L L L L L E i P4EG AG tAD  AI ̬xOj G n,̌O B ,:OZ O ~ J ` P L G 4A I g G b E F O o E TZAk D pıTAk D H i A @DT P(N0I܍-\P0Ly K u"EX0!D*TU\(CTT H F|X3RR D F@xmNAD j ABH  ABJ YAB cQ} J FAQTn8E8:EtLTFBB E(D0A8Dp 8A0A(B BBBG 8aRED D(D0p(A ABBG,Ծi[AD |ABA,i[AD |ABA,@Ti[AD |ABA,pi[AD |ABA(ԿaZDD iDAH(̐^FID GABLBE|4FAA k ABJ DAE8LFEA D(G0^ (A ABBE @,BDC q ABC T LBF JAB̑#+)JU4JDD D AAH ZAADHLAUdP,x\<jr D g I `Cl|hOBE D(G0Q (F BBBB ^ (A BBBK u (A BBBD k (A BBBF [<Pt4dzFAA V DDJ FAB4H[FAA z ABK DAEHԓpFBA A(D0e (F ABBJ G(D ABB( >FDA oAB<LFBB A(A0~ (D BBBD LHFBB B(A0A8D[ 8A0A(B BBBI HܔFBB B(A0A8D`+ 8D0A(B BBBF 8(<{FBA A(D@m (A ABBG HdFBB B(A0A8DP 8A0A(B BBBB HFBB B(A0A8DP 8A0A(B BBBE (FAA vAB((lFAA ABPT PBE B(D0D8LP 8D0A(B BBBE h8zBED A(G0w (D ABBE \FEE D(D0| (A BBBE I (A BBBH d(A BBBDp$X|EE[ H I G LpFBD C(D0r (D ABBB D (D ABBK a (D ABBN y (D ABBN 4rFBD C(G0R(D ABBH,XFBB E(A0D8G 8A0A(B BBBH 4xxFDD o ABH OHR4$xFDD o ABH OHR(lEID e AAG 8FED D(D@ (A ABBA HPFBE B(A0A8GpL 8A0A(B BBBB (>BDA sABșEQ(DHGF kABp$5FDA D(G0 (D ABBI _ (D ABBH z (D ABBE o (D ABBH HFBJ E(A0A8G@} 8D0A(B BBBF HКFBE E(D0A8Dp 8A0A(B BBBC 0(DEAD d DAE FDAHPDdBEE E(A0D8Dp 8A0A(B BBBD h d4ěpFAA F@  AABC HXBBB A(A0f (F BBBE C(D BBBHAN4dnBEA A(D0W(D ABB4nBEA A(D0W(D ABB(ԜHBDA }AB4@ ,((LAD DBHl>EqHdFBB B(D0A8D 8A0A(B BBBA <$NA I N J _ A GIP[ E FHFBB B(A0C8DP/ 8A0A(B BBBC H<FBB B(A0A8DPw 8D0A(B BBBJ  /H[ E F7H^ J F<7Hf B F\#|xBBB E(D0H8D 8A0A(B BBBE C 8A0A(B BBBE  8C0A(B BBBE | KdfLFBB B(A0A8G` 8A0A(B BBBI LHz FBB B(D0D8KpJ 8D0A(B BBBJ LxJHj N ILlBBE B(A0A8GO 8A0A(B BBBC $8$>EED kCA$P$?EAH lCA h$ d$CNt<$P$"E\8l$"BBG A(I0Q (A ABBD &{uQ A p 'Gbd@'VHa G aD'FBB D(D0G' 0A(A BBBH ,L-=EFGf AAF |/H@[ E $03ADD dDAL0FBB E(D0C8G@V 8C0A(B BBBA 4Zta,4SG/ A L6EW L b F p6HI G G I 7H7!BBB B(A0A8D@ 8C0A(B BBBH L9 FEE E(D0C8Ip 8A0A(B BBBI 8DDBED A(G (A ABBF ,FHp H P H q G N E @FFDA f ABD O ABF vCB`G,Hc( xGoFFA \CBH8GSFBB B(A0A8DPr 8C0A(B BBBH `KBGB F(H0D8OPR 8A0A(B BBBH D8F0A(B BBB(MRBED O ABA 0PMADL j AAC hCAHMEu F AHhLNH FBB B(A0A8J 8A0A(B BBBI LP[8FBB B(D0H8Fp 8A0A(B BBBA @@b:FBE D(C0J 0A(A BBBH HHH`t D   H`~ J (< PH` E l8 4@H`~ J Ď4>H`t D LFIH E(A0A8D 8A0A(B BBBB 0DPEAD0c FAL FA xELJ AD h{H@m A Dȓ'FBB A(A0G 0A(A BBBF HC,(FE) B LX}`ėLtpCFEB E(A0D8DP 8A0A(B BBBB puAJc AA H̚,FGB B(A0A8G` 8D0A(B BBBE T4FBB B(A0A8G L@IAt 8A0A(B BBBH \FBA A(D0 (D ABBC p (F ABBE I(D ABB D[ A O A ,t|FDI O ABK 8@ģFED I(D@W (A ABBG <|(lECD s DAD K DAH FDA(XrEHD e DAE 4JCG I DAF GDAD 1RSK<)JTX,CaTKHt`FBB A(A0 (D BBBA L(A EBBHFBB E(A0A8DP 8D0A(B BBBG ` XFBB E(D0A8DPY 8D0A(B BBBB  8D0A(B BBBF HpCFEB B(A0A8D`~ 8D0A(B BBBH 8qRIH D(D0t(A ABBK,LARDD _ABD(l!H<FBB E(A0A8DPy 8A0A(B BBBH #$Ab($ #04D@!JLd`TOBB B(A0A8D@S 8C0A(B BBBF `8F0A(B BBBA8FEA A(D0{ (D ABBK 0DDlFGB E(D0A8G@8D0A(B BBB``FBB B(A0A8DP 8F0A(B BBBI F8D0A(B BBBTFBB B(A0A8G L@IA 8A0A(B BBBC 4 8dEDD v DAH NDAT pEf E St uE^ E L$ @EFK qAA rES H H MFBE B(D0A8GpT 8A0A(B BBBG (  yEf E PH lJCG V KCH Z AAD D FAE DHA a jH `AFBB B(A0A8Dp 8D0A(B BBBH H doFBB B(A0A8D` 8A0A(B BBBE 4\ FIC g ABD ICBL FAA D0l  DABA D  GABB D FABL @FEE A(F0Z (D BBBE c (A EBBC T4 /FBB B(A0A8H Q GS 8A0A(B BBBE D EAG0 HAJ v DAE  DAD D 0EAG0 HAJ v DAE  DAD 4 FDC Gk  AABA LT 0OFBJ B(G0A8I 8A0A(B BBBH , 0EDG0s AAK  HKL FBB B(A0A8Dp, 8A0A(B BBBH <8TzH`l A pDOH0A A LxFBB B(A0A8GZ 8A0A(B BBBG DHFBB A(A0G 0A(A BBBA $8LHHd[x\dKo F c8`0qFAD Gp  AABH HFBB E(D0A8DP 8A0A(B BBBA 8@dFBD A(D@ (A ABBJ L|FEE E(A0H8F` 8A0A(B BBBB OBB E(A0A8H@Z 8F0A(B BBBE N 8A0A(B BBBH G8D0A(F BBBAC@T\FBE A(A0G@ 0G(A BBBN V 0A(A BBBA LFBE E(D0G8FPM 8D0A(B BBBC MDh D \D$0BBB B(A0A8D@8A0A(B BBBl{E{ P l2L I g I ,(LAA  DBJ Hb F l L D4p(|8Ho@ TATdl4IEE A(C0m (D BBBB T (A BBBE I (A EBBE  (I DBBF  (F BBBE ( RH  E W I  G P8bBB D(C0D (A BBBH c(M BBB 8uA] B F E @wEAG { CAD [ CAA v CAF ( EAD  CAC  Ly K @T(Tp0$l7ACD hAA(tACG r AAA ODu G N$ 0sD E N J R$,OAHF }AATbQe J [t&Da(.D` D D8:8dBBA A(G0{ (C ABBH HFBA A(D0| (C ABBF j(A ABBHlqQdrE{ ` F @IEF _ CC 4lgADD t CAG D KAH +-=01NXH<1NX8`dLAC s ALH c ABB  ;HZ F R<hEAF j CAF M CAG KCAD1HU C P$0dQE` K T D HXYEF E HxnA <eFBE H(F0 (C BBBD <FBB D(H0> (C BBBC @<HtICF j CAH I CAK ICAC@wICF q CAI I CAC ICACTNHB H(F0 (C BBBE S (A HDBF p<aEAD h CAJ I CAC IFA$\(Qd K L D ]YEI B H0 YED G Hp !E[  8lK  XLK $ HC E v J xH nHK E d 2,x< FDC T CBJ  Wdb J  5dP` EFBB B(A0A8DP 8D0A(B BBBJ Z8A0A(B BBB0@ ADD ] CAF DFAXt@AAG { DAG [ AAC  DAK P AAF [ CAI =Ew0[EDD j DAL KFA0 \FIA D0  AABJ 0T@\FIA D0  AABJ 0l\FIA D0  AABJ <MCF T CAB NCAFH @FBB A(A0D`x 0A(A BBBH @@NHC ] CBE ^FBJP 40BED A(F0|(C ABB0FDA D@r  AABK H}FBB B(A0A8DPL 8C0A(B BBBF < 8cHZT  8h FAC  JBG j ABC d FBB B(A0A8DPI 8A0A(B BBBK x 8F0A(B BBBI  !XV( !ECD@a AAA L!8 0K`h!L :MV M !l!5!!5,!!TAD Q ABC $!0"PAJK wAA "X"8 "d"FBA A(D0(D ABB\""9Hpt"#0Ej"$#qHh"#$"#VAHH BAA"#EQ8##BBA A(D0\ (C ABBB (@#4$AAF t AAJ l#$WDA K 4#$AAD  FAB ] CAG H#%zBED A(F0 (C ABBC ~(F ABB0 $&AAG r AAK bAA8@$D'IJF zIAS DEA8|$'IJF }IAX DEA8$'IJF zIAS DEA8$ (IJF }IAX DEA40%t(.AD @ AJ k AD z AE 4h%l)BIE  ABK MZE%T*.Eh%h*%t*%*?H` H N&*?H` H N4$&*oEAG W FAE |AA(\&*^AFF0s AAF 0&,+LACG l CAE DFA&H+<&+nACG i CAH I CAC YCA '$,QV Y }4',8H'\-FBA A(Dt (A ABBH '0'0'H^'1$H[(',1EDDpo AAA '1 (1((1EO D  C T G H(\2ATl(d(2RFDD @AB((2-AGG AAH (3eGX A 0(4XBDA L  AABA )H6A` G H A L0)6BBB E(A0A8G 8A0A(B BBBF H)D:BBB E(A0D8G`` 8A0A(B BBBG L)=O FBB B(A0A8D< 8A0A(B BBBH 8*GBDA l ABJ A FBA 4X*G}AKM H AAE I CAA L*DHBDB B(A0A8G 8A0A(B BBBA H*tMBBB B(A0A8D` 8A0A(B BBBE 0,+HPAAG0b FAF XDA``+PBBB B(D0H8GPR 8A0A(B BBBI  8D0A(B BBBE $+PR8ADD eDA+hR;YVH,RJBEE E(A0A8D` 8A0A(B BBBG P,S@d,SHx,SFBB B(A0A8Dp 8C0A(B BBBG d,W$FBB E(A0C8DG 8A0A(B BBBE  8A0A(B BBBC @,-X]UBJC d ABJ j ABC ALp-t^H-^rFBJ H(D0C8D@ 8D0A(B BBBE 4-_ADG0_ AAC [ AAC H.\`0FBB B(A0A8Fp 8A0A(B BBBK T.@fh.f|.f(.fEAF0  AAB 0.hjFHC D0  AABF .o 4/oFAD  ABG IABHFEB E(D0A8D 8D0A(B BBBC x8 H8FEI B(A0A8DP 8A0A(B BBBJ 8OH` H 89WHk E D$9@7FPP I(H0C8K@8A0A(B BBBl98OH` H 89hBED A(D0 (A ABBJ (9LFIC AB9;Eq4:EDD } CAB O CAE HH:Ln FBB B(A0A8Dp 8C0A(B BBBA (:pECG o AAH 8:TBKA w ABH Q CBJ : ; $;+EZ A F(D; ACD { AAK $p;Ե5ACD jAAH;`BBB B(A0A8Dpl 8A0A(B BBBD L;BBB B(A0A8D 8A0A(B BBBD 4<4H<FAA  ABJ JMB<HV< [8<XFBA A(D0 (C ABBD <H`=$vFBE B(A0C8DP{ 8A0A(B BBBD  8A0A(B BBBK @d=@`BD C(F0N (A ABBE H(=?IHF k ABK (=lJp F IGPC>4>,(>\XEAJ AAC X>Hp>duAo>9H^ J D>LHd D [8> FBD A(D0k (D ABBK 0?ECD p AAB RAA LTR>TJA H(F0Q (A ABBD D(C ABBDRP>(H_Rh>4Rt>FAJ s CBG iCBS> HW$ S>KY D ` H b F HS?A^_`ST?Ll_xS?5S?P0S?kICD 7 CAE X S,AJU F g`SXBBEE E(D0A8DP 8F0A(B BBBC d 8C0A(B BBBH 8`TCBJD A(FPP (A ABBC TC&,TD'FDA  ABC LTEBBB B(D0A8F 8A0A(B BBBH <0UTHACD | EAF D CAH tFApUH",UHFDA  ABG UpIP4UIgFDC b ABF kABLVIFED A(D0T (A ABBB R (A ABBH PVTJyH I lVJt|iV KleHVKECF \ CAB D EAF S CAI FCC@V LECF M CAA D EAF F CCL ,WhL @WdL TW`LhWlL|WxLWLLWLBBG B(A0C8DG 8A0A(B BBBJ W`O?Hv XO<Hd D K,XO-Hd\DXOFDF l ABA T ABI _ ABF b CBA H CBC XPXPHES X SXP XPHW A c E YdQL$Y`QFIB A(A0 (C BBBC F (F BBBF XtYRNBA C(F0_ (D ABBF g(D ABBHP08YRFBA A(DPA (A ABBK 4 ZSEAD0 CAE bCA@DZTNAA t ABI {CBHH Z\UOtNZU%ZUE H ZV%(ZVEAD o CAC [PW([LW<[HWHP[DWFBB B(A0A8F@H 8C0A(B BBBH @[XVAA ^ FBB CBHH [tY[YSdn \YSdn$\Z8\Z*L\8ZJ`N$d\pZ>Ep K  X \[{\[FDA$\,\fAFD XAA\t\\\'H^ ]\=Ht4$]\EF s AA u AJ  CO \]h^gDO E N|]^IHw A D]^-]_jEt G i0]T_vECD r AAH iCA^_AHx^_9Jb8^_.He$P^`dEAD UCAx^\`dHJ F K^`(\K^`3TV^`OEIH^ aDFBB B(A0A8D@ 8D0A(B BBBE 80_$bFBB H(A0T(A SLBl_xbHU@_bEAF c CAE q CAC T CAH _cEJ,_ cEK H { E C E l D `c-Hd,`cH|KD`c X`c0l`cTHK`@d:`ldH`xdyFBA A(D0M (D ABBD D(D DBB`d  ad3 ad 4ad+Had(\ae3pa4e3(a`eVFDI AB4aecJAD X CAE hAAF(aeaUAG ~AAC(bfLEAD s DAF D@b4fLFBB D(A0DU 0A(A BBBH 4bJ M@8 W 3 cA m= z+ @ + 2 5  1 ļ) ͼ( ޼J ) , , R &4 4`5 F L O6 `0 m`$ {"  0 P7 `& PQ pE 0) ˽( ۽R  Q ) G @( 0l ,@ 9< 21P21i"1t1҇ `1`1`1@00,1ď111 110&<190Q|1h1vpC1h1X1@}1. |1C1<}11B111|1;}1GB1A C1x01X}1n11U}111  : 00o0X+L 0Ы@ ooooRo 0 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`pP a 6 P7  @ `k Pq 0 P  V J 0` p; xA A A !B "B #A $A &A 'A (A )B *B % B + B , -B .@ /$g 0 B >B <A-f {M{}A ;t (^ )"s |~s &f vA {A A B lA B B "B (B  qA ؽf {M{}J.B {1B ; ; kg P]g Ph g h @wg Pg P2g Ph p>g p)h pIg 02h e 0g p;h p@h pGh pRh p[h pgh prh pzh f h e d }; { 0h 0h 0h ph p0A @h (g p+p"{ '{ .{ 5{ ={ D{ L{ T{ [{ b{ j{ r{ z{ { { { { { { { { { { { { { { { { | | | | &| 2| ;| F| Q| \| g| r| }| | | | | | | | | | | | } } "} -} 8} C} N} Y} d} o} z} } } e } g    ,>g  h  P@z{zxzw0vPvuyx B H ## L 0x5Г0@ox%0x}0`o y 0yy 0"y0o/y p06y%`0Dyay%P0ey͉P @0͉oyP%00oyty`% 0ty׍p0 pzyU0HpyU0xpyU0p@В0yy0pA ` 0yyp %0yd P 0p 0y p0y %`0@qc 0, %P0yc - %@0zŏ. 00qW}P6  0zj C 0qϏJ %0r/z N 0Hr^@Q %0xrA PU Б06zHzn %0rݡ 0Mz} 08s 0xs` 0sXzp p0saz `0gzqz P0xzk @0z 00zz  0z 0zz 0zt 0tFl ` 0zz А0(tz %0{{ %0!{B 0Xta_ 0tB 0tp04{`0tP0(u"B @0u(B 00u1B  0u0uG{0O{f 0^{k{0u{{Џ0{00v{c 0{{h 0{^ 0{{ 0hv{0 p0vZ0$ `0v{0( P0`w|, @0w|V 00 x|V  0x?- hxȝ؝p    $  0  <  HT`pО ,8HTdp X!"#$@%x&'Ч()`*+,--؟--.. //80L1\2l34567Ԡ89:;8<x=>?(@`[\ت\]p^^_`P{{Ь|}8}~0g    f   ġ ǡ ѡ ԡ  e !%X{ P )!:"I#U$a%n&x'()*+,-Ƣ-͢-Ӣ-آ.ߢ.~//0Fs 12345= 6789:;<,=8>J?X@f[z\\]^^ƣ_ѣ`ޣ{{| }}~*21i@ @ @ 5 @ @ @ 0 P @ @ P @ @ @ @ s G @ k @ 6 @ @ @ 0( @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ 5 p ` P p 0 P @ s G k 0( @ p L ) 3 J `& 0) P 7 7 7 7 7 7 7 7 7 J 3 0) 4 0 0? = 2 J ( 4 ( P7 PQ Q J | 0 pE @ 3 J @( R p4 0 0? = 2 J `5 R ( P7 `P Q J 0( 0 A @ @8 B ` 0 p| 0                            0p ` `o 0 @ @ | u 0 p @ a P n P P P P P P P P P P                           n o  _ _ | 0 `k a `o P  p ` 0 P p 0 P @ s Pq 1k "1 p| @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ b @d  dj P { 5 11 ^!ITC1C1s dv  GA$3a1 GA$3p1113`: GA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONS GA*GOW*GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA*`6 GA$3a1 : GA$3p1113@U: GA*GA$annobin gcc 8.5.0 20210514GA$plugin name: gcc-annobinGA$running gcc 8.5.0 20210514GA*GA*GA! GA*FORTIFYGA+GLIBCXX_ASSERTIONS GA*GOW*GA*cf_protectionGA+omit_frame_pointerGA+stack_clashGA!stack_realignGA*`: : GA*FORTIFY9 GA+GLIBCXX_ASSERTIONS GA*FORTIFY@: GA+GLIBCXX_ASSERTIONSbash-4.4.20-6.el8_10.x86_64.debug7zXZִF!t/J]?Eh=ڊ2N $, ¡r;L>FRCCˎ|jd, aeq]3k}FappH@,~Vk)I!e`eb+)x/@L-G*~",Zk[,ZE-d>)P;'#CʈwfN^xow < UP6"GQHҾU}XQ-~LԴov/mc,nxg~6 [qpzkm4hb䛃IUق&U6t#?Vc0"Bl} *3.Iv-' RKH#Hizzh')׍{Wuw``<9FlbP]0 S` ;hXrNV$&aA(u|rRkA]g ۬iu](.:Bv*BH((T{,>WA?cm)Rɢx&{N"]-tbSx~\o)Nxs.҅GNuZPU0$։_<ĢbbBr|U.~im0Y% !tsLN7tT[Ӏamh19m _Dsi-+(M<?))tB!kr2֡exf-Yڗ-{ OYD,/\0Rf@^ѻ7g(K0+"91_g %#)6$$w`],Mnᑉow()9R)濬%yv<5Y%T-hBjxN̡)ղuЇl]H-B~>͗?ƦxA+GY2D:yt!ڟ6ɎyJRy]Ōm^*!붉#mqNt#"Y#jwd^ӽȓַvSm𶴚R6!ԾrhWJ8gxv͌WIrƩ.Q &.э|ڟ)TqRq#MI /l$[rA"Jp3kyĖ3mTmhE o6hqX8nKϡjugv _6k#=K%1!G9a  :wNoDxRcȅj]F7_AEmڶq:(3SlE]*ysl6'2CƧS euat%[+n0 ̵!, piNoD77tGRFߚmـ_NEUIOڛk;u"}jҗM"yn+eq7ZXsm{nov֨*I5b6Jgsb߮JsIajL7kmA2`mW:<1# `\:xߡ2^9VmӦ۴;i _R=;қ@:l97ܷ5ik5]yL%!NbX>]ej9^(Uav&?A:4W49gQpNzaT#0˃/}F ,*Mc Pιa8 5LB:,Y<$ JgYqI"b-K;h] 7 =$V]7#ZKoYPsUjl КS5I@lZVGgGɅIFgN8G4tшt{h A=W kOsRHG6Ñ_:J }a?G exv<  Exf/rf`l[&C!tS,j -ztym|M.i$ ?*)fްUt- NrE`0n OZI$ JIi1\~ߊ~Jh i^DlX /I[LX?qRpBYky#jo0WFԋxU 76mQ4̀}HzحKѰ}jy+ڊ_G a:apSV!-;"qt2wx@ ̥`dE^!:نga=]{P+=ATH. (Í6n}zrG ,*m8(| ;$!HWG5lD g[rlZ^Bq#qh4),(I 0b-S7aD4wNgKnHQL~bAKFJ:V'8jW) Q,0 =e 3C}zo@+~Hl^;?woÛi)5w}wx7ĖhC&4Biy֤'OC8aSőt:8,in ݳv+=9픐.00ŝ * PÒq*@[P~󏦥Ƌ$7ZXh7geJM1n fD;>Z"d8FO3c--a@zp$DQ_<\t;mPk 18OroKؼm s >vT2hZDQcT R*6AʳqZYH XIIͲjUڋBtY˽2˝<[ϮOVe)qX)Өc^cݎ@+m&j>^.n'^-t/@ |&VoD+5p${w=;[}dضH<#]&ڊH H2"#!U*ǸWiqvPڣoGb>둫*3ŶFfZMA6ϟu Ƕ4QȶImeq/AWhyDHj|vHfJܾgv&% ߂?I TƤu IrT= XL(!W ]Jl6ge2WR)p&SnbX"9w41 m:  q'W%5M@deȧY H+58}yb((ljߑˮQwPs/a Lw`.mj-U!ԎRnbК3]@=1Waa SL[[ m ﳝckbo.W>IMX{O1zZOMi1+҂qNZ7r n }ٽh|q9Ό5Bdb,d+%(x8n/. 6Cwf zV+o杈qJj8 rw79L@:t&V2iŏ\fnK$#.JEQH6{ö%ހe^>tSZj~.; Zn$R8T4 $rk11?C_%7` ^kE2>ީV"F7VCk=HzԐ$[}/l0gⷥjY2! B6 Oup:C'-DH:Dk@ Us.m9:EMxQ\q]`|$d7QGx0|ZdÕPzDP9:V&m6'{,W"x ѳ+eԲaޫ)d{5_}^B\<FmC3S|vZ dP`dQ< 5!%2Ȯhy;RW̴ {L/@`r?ww**X#dk«IH4Յh^Izd]>wѓ]O w,4BY욪1pBF\xضn_t =?!);Ԁ`ٹHM"fs 9s~L\;7!̿BbqO ߩ1R,|6ݏl ݨȬ$ L-Dx.ٗtdV-r{V9Z;".~81V(Ϟ ir`҃bd>1Tu%Wj r{yލQ8mU2s02$E0#h=)8ZrnEÅ_q|1?&*HɎkK gF$?be~1+7OPAD-A&3z;Bk`E 4|`8bI7Rf@G-O VVTm~NKNr:OI+EZHSfE}K`B^LN~ "ﹺ,sG yT+{KICn njIooHQdhܹ߰dyJTao.p/i=.:@LX ̔mǰ.cv-'h cpGlh[@lv91| Ke?1DʭtP (000M2{a/|4@ޔ'w/0n͔g;bJ!T bL)tӂ,‰tWMV""F)Z5Y,1 {SN =m[ٺB= S,wo3J]\0i0)J{/mTfS5$zK VQ9{Yqj@eh 5}-1v; 6VDM!_rIY]]#R`rgmh30yHaQ;yb}=ECl"RhTO- <7}u|hG>]^1Q(ʨY Z!͠ %diRk?K-& ;bx jn=QnCڀ JJx(ɺOo/ޛUw!oHſw{IұPh}$_kՈ,0YBzճNq4ڎl~W;<F5YϊnU[klL]{stjD0ia0j̬!껿`rkz Ȼ#7Q4ke($L`IX)?Q8Ѧl܂Fr&W0}>YE䎹ltXkꗴY_h,N 9$. fVeb+H>p2|@;Ǥvnn0p s}A&'hHW 5 m.!ƒ9EFHf!͛ 2 *UnkM.HyYJsT};W^[=$XNAy<&gHJ+oz/nE;}[P&͝A2E^<ٳ᢭P:?%*q|xv~bY^&}F{%gLJ) Xa5{J]YتFe{pJMn3'՟C!s|*VOS瘄!6)@ ?ËoՉz5㒯(,{6GhGU5CZ+%'Aec)Fe}qym)fZ9-[̫G%YN= DR6 Lj]i)M XaU} jkYwoH4`eb 265f굟*1e@bqrK66wI.քqhÕu;ߥu7%aT0ۙCXUӫ!KF o-2Vw+;P^QJ-NߪW[ϑ^yB#vGثZAg'{u 詵fi [ 谗9R.xnX/ &5+dZO`\wYk'aYsu|`a .vkfg*5,EOIiE{J2Xø GjN 6aJSM d6 WOk>`C|dgw:`6ɓ/RE ONCw%:jj,Ӿ2&Q!2OȂyfV VgC8+4 #7s\c0iyAVS4l[JX-{Q?qޕ(8"IȚlU'\\Y]kp{:zfEf6Ӎ 4nQؚ~n+q#1,% 1DT2#gx3`v65d6ѯ/[#m4Oh͹ѿh8Sࡄ 0oVST7tB薓/`oRME8]h˂Ɍѭ\Q&i`LH*=DTءo~uזe>2Vw FD||Lפ 1S5VF'aaWWӒ~$(UDk]%JTT~zU6Գ}x7!'uѭTAr꧲t귴HA`~DSzDȥ[^b|J:-6\iA\^JuZӏ}ەT Y|!NlWPDQ>btA8dp'Şuqq0T$50cpYj0c~yVu@''/ kP)/RN˭FOԑWy'XAq5 44 ј%)%uW/ ҠDfreƷ#_@*5{Rxe[ pيm?K'VLX?f!~^=d݊ H=\myWwFzoWt,+ltجê{z",^+otzCO4]ݓ4a~B*t㴁9u4ൕ m EK9iXmdκ)\Jy a ֘I laj5yf~;WC|G`.ڟBc7w(eZ$Gto񲀸RK%^Mr|g~` ҧs؍bn$<0ݙQMϯshWFľ,UΏ>6$rz'8D|Qtoa?pzoTuCuD$>cRpU6z4-8 pԹeO"}"g | =q$^!0'ob^\2ϙN( , +֩V D[E{a̰h{`dIY}Ek=5 C2HDL6i?svAnff)N`z@ẟXJ8 ͙hRCK[aL%VB4d1eT㾑G#)B( &ߡϸ3!)0^n;m:+lt[)~ls.Y"מ,u**-V3XTq# @ yB4m*t3r`>W_UϰɟN7k{ygI%h- g7H,LCg) #5&.\ ?\O?xvX+)N`{MS_ZT~Z~t&ͣp AJdPBJ84 }ܖMG4zMCbv뼰C*K'[q+0yB@)Jʀ̽N`:= h=Xi~3[UVtPpe+Fwg{:U{tXBivezMX"CdDl&S},샸F7PG -$Xf PYSJ/߬GoR^ҫiF ܠK5mnOdޅ1 h{PbveꇼJ(\7}",KDSe[)%>CXR@P )0mCu;-\VcU$d/Fv =-oҨ9]PwpW[oPPP*6?`sgJ"vcFVK97s_~`Ԃ Ae pqK41~2Z"M`Sb41D3\X]ÄbgF$ncC7v%x\[RP7= 4_WzH)6\PoyjĢiOg9. ~˪6hoU5-2q@ ߘ_c&v oxUWAӑ07a`W^a#D$vh&ګYvQNEyK5,HF|Mʚhep;ϣ%uπ!tьO"Tx m!Lı 3~jNM [%GsoC"RXym^*ǐHPW>X WjIMM \]F"}r!BT] \‹ʧ2Y95uyFiETb@L|׷a=X4dU5Ir3)o*-/D si{16$u)X7DF\F`$|KnWF":_`2 nD}p3,]z͔#9oRq[X fШi6.>=w@c!>}Ea~%bKL2-0Yt[bT`E wxbBnCUsT˅ͺ¦d:1(:~ ys$n0W8fps㕬ǟc-hij5OJP˱k28O:οƒ<Lfs}F2:sq+*[*DUצ{c)z- 5̅n{'NBDDl\ . wYcu@셦{+%MS Xm8=᲍ 0@X|Qhg#Fܪ 1ҡ9} %Ps;C)Кo&r2Ӧj wRVAQ8YU?&$[b$'?q *buS[ϊF4_ aY촛A%LE8,& F&:HTz??nY/, ifJFF7ڴɬ|p{ ; ;BicY N ;Ll"<8d5*)&^Tsl3|J%Xq'Y\{QDI7*Ԥ)u-PWpQ <@?~iS#ZnpM"?E٬Hhb2^KxO5^y,$' ZY RE 0#NFwU4Ү-ri4LQSMgTϢ֚RHu8C_ \*VG@7h||Da, .6xed"@5}>wNh$%eɵXE51SZ`)7s)y&=8\K{j+_IYiţ*}g-ōu*SڬI(9;`;ݵ;9kp$3J'u[O}D4`l$k#C3q[+ نŷ\d &R/UCYj14`⃾Zi3~l,w8 A{U=h޾ UDST^N3$4w6>6AW 2MgF3#n,m62&4o`ꚍn DMkSb<8c}5-OP{:aC$c=Tc #pWw.TNz#vV*g㕢*0k|FAh1}?',E'PA9a S=&EO ^`I_Ft8'QufID=n=.[KJpDF_? To'^wESҍ+_P-,m\"ҥU=_-ȞWr !PD;:W"#秖%Ud{iH~܆167Z6VFR_k2tDGwJ)Pg^H'\oIL!W@کv.SZL`J੡XVd tnL'oD&qm3x!+s֥~K+7:m <x̄YycC+/Ի5̷ȍgG=`ąD7 iR~0'(]P>eϯT[k .pa(zb1ػX^tk[ԠkxwFTMH 0 *HvlN(ζg-kY*!uƨhK؟T ~w$.!}VEbZB cfoRc>N3r*uH8}'7P>GkS^3v ϠCaqVoIVr왹\}EΟ9U;gHUn^14X`)4k<׭@1=\ϲؕvi L;p_Dw5jyqB-ZCAzx< 0Up[ c8%(\AjO2E!dXj_Ӽ!<_$GO)2 G`v8n\C8NlFmڣkJ){&씬:n4C_gU@Z꯶ }P.lvgd1;oVTuh9LAiΘ9.U$ы|SVa@ %xՔ@dA`Q_9aYwk\q2)Q3ipϟ2v?+}T2-i} {WYIgt sN0h LN/ }'5O W YXt,0,E\d ;{PLQ#z; 66bF--LPe\T`twd{j7".{N@2儤I8ʶ.?d.VS D*Da@iLY_i5bN&71*:\Bgwi'eԙOha(;`%ᬹ#ÎÇ{rO; =K=&$֡٣%u1N %NxXM4۩,HgV쁠B#%f6*XM7s0X y( ;͈?PĤw-ۻ~ %?(0Wl?}(0>5W6+5u*>-@LwѨVϾ?֓?I5mFV~R8y_AfC>D|,x2ܔN9 -v}0{x@{6Zu ]E.znOSGNj2YG Q~ϝ,RۑZ΄맔Աaf7Q7I@ 3l;xnmMTRIz Z3C>}*+@N@07/5Ұ]x1X.O-a(kPNéaU\^Do'idJXCZz,5 g;GXDeka'3>=v]L6T8pmgΕ{]׳<3rD^g@ڀl9EJ̓M}Y_m+=WCrvދyЁC4Lo@5쇮tԆ^u J41%$9٦U[*Q3L7n)py;4tz (&\4Er!guBk9bcW4uYs("}SfZjwcN·cO_h(d5ԭҊG az}? .,%Ƌ~~-}Dkq` ɚ5ʴ_=[W3 GCH!BJbwg3*N C 9Zn~ϩ 5ϫ* \&GcO :O"txc2cMvJËKOAz1> /Dm:Ɍ5|"]gl]yg m sc_xKȯdj~ݽzbeR E"r#1 hZ$Xyt`L/Ek's؝:4cL/zE-ǦA8g1׻XN}buP3RHPAݔC%,:7tx<~XonXXxU_W`~ehTsk[vo%U`6LP9Jtr %L֌Xp:|=*q?:Io dH]A^ @;U޸J7A3Iъ"l1 +w{;}8V1R*kvbB26QŁung?ǷYYBJH>K&.I9g+,*>>ґ6ʲYaBx D+Gh!!EڹH򺴨A m=3r$ %RUkthb|Aym5u}߂E܁:'2`Ҷr9P3쿥|[͡>`׈%'}wQh+nR l҈DhwdVҸߔh UD)c\ n* 1ELdSP^)9W:ح'8 +KjLֻ&hΑu"39 AtNT~m@?PDml<;Ssw#YR]1(RgXܿ`z GK&KfIiȻ]1Q :ɄTCrgܷWb / w$BӔh)1wD= ZSSn͛˲=y=S ȁ$fT59.KPK`RY ŢR[TP_xha vhM=l/RL ʇӰ)2u9'5U[Y̷ 6bm!nUsɔ堛tV|$c# @o81pg!;,sЭfMBrt jK}WK>Rt׋qǻɐg?}H"$|4z+X牫x?Qُ)Ro >ЎESRn~ʂI̠4;&yNQ '"eK!Ħud)q 󚉹=] r˝Lc7 JwNTy7KX|I@Ϻ:rsYkS/!pzQGaqyjμ"hcr=Z}uiY#~wLeMrSr :{k7yp@I%vdaH(hli.|YҦcOѵS!RԏH5mQś`^$81YQ)M#UHDms&_נ-g8-eRPť*vC6P7vuH@w te&⻕U$0j*]|m@35CG).RϿ _bqDp>nmOB@.FL~4h2dR7jz -%bo }\0*)Sv*s`q?$'etŤ`ROWN@fP 0왆?RµG&[mssOmU5PS7>r@_fQR1kA)>Rޡ\~2gK0:wVZU=ܨ6𝠈ݫh.q^͖epq,\ E{,cD| A,00c"pI̚ns"CM6$Lؽ5gYZ.shstrtab.interp.note.gnu.property.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu.build.attributes.gnu_debuglink.gnu_debugdata  & 4$Go00IQ LLxYX+X+aoRRno}@BЫЫ  ``u^ : : ; ;  Bm00 0 ( 000 E1E HqE HJ(/pJKx>bash.html000064400001234442152530212110006351 0ustar00 BASH(1) Manual Page
BASH(1)2016 August 26BASH(1)

Index
 

NAME

bash - GNU Bourne-Again SHell  

SYNOPSIS

bash [options] [command_string | file]  

COPYRIGHT

Bash is Copyright © 1989-2016 by the Free Software Foundation, Inc.  

DESCRIPTION

Bash is an sh-compatible command language interpreter that executes commands read from the standard input or from a file. Bash also incorporates useful features from the Korn and C shells (ksh and csh).

Bash is intended to be a conformant implementation of the Shell and Utilities portion of the IEEE POSIX specification (IEEE Standard 1003.1). Bash can be configured to be POSIX-conformant by default.  

OPTIONS

All of the single-character shell options documented in the description of the set builtin command can be used as options when the shell is invoked. In addition, bash interprets the following options when it is invoked:

-c
If the -c option is present, then commands are read from the first non-option argument command_string. If there are arguments after the command_string, the first argument is assigned to $0 and any remaining arguments are assigned to the positional parameters. The assignment to $0 sets the name of the shell, which is used in warning and error messages.
-i
If the -i option is present, the shell is interactive.
-l
Make bash act as if it had been invoked as a login shell (see INVOCATION below).
-r
If the -r option is present, the shell becomes restricted (see RESTRICTED SHELL below).
-s
If the -s option is present, or if no arguments remain after option processing, then commands are read from the standard input. This option allows the positional parameters to be set when invoking an interactive shell.
-D
A list of all double-quoted strings preceded by $ is printed on the standard output. These are the strings that are subject to language translation when the current locale is not C or POSIX. This implies the -n option; no commands will be executed.
[-+]O [shopt_option]
shopt_option is one of the shell options accepted by the shopt builtin (see SHELL BUILTIN COMMANDS below). If shopt_option is present, -O sets the value of that option; +O unsets it. If shopt_option is not supplied, the names and values of the shell options accepted by shopt are printed on the standard output. If the invocation option is +O, the output is displayed in a format that may be reused as input.
--
A -- signals the end of options and disables further option processing. Any arguments after the -- are treated as filenames and arguments. An argument of - is equivalent to --.

Bash also interprets a number of multi-character options. These options must appear on the command line before the single-character options to be recognized.

--debugger
Arrange for the debugger profile to be executed before the shell starts. Turns on extended debugging mode (see the description of the extdebug option to the shopt builtin below).
--dump-po-strings
Equivalent to -D, but the output is in the GNU gettext po (portable object) file format.
--dump-strings
Equivalent to -D.
--help
Display a usage message on standard output and exit successfully.
--init-file file
--rcfile file
Execute commands from file instead of the standard personal initialization file ~/.bashrc if the shell is interactive (see INVOCATION below).
--login
Equivalent to -l.
--noediting
Do not use the GNU readline library to read command lines when the shell is interactive.
--noprofile
Do not read either the system-wide startup file /etc/profile or any of the personal initialization files ~/.bash_profile, ~/.bash_login, or ~/.profile. By default, bash reads these files when it is invoked as a login shell (see INVOCATION below).
--norc
Do not read and execute the personal initialization file ~/.bashrc if the shell is interactive. This option is on by default if the shell is invoked as sh.
--posix
Change the behavior of bash where the default operation differs from the POSIX standard to match the standard (posix mode). See SEE ALSO below for a reference to a document that details how posix mode affects bash's behavior.
--restricted
The shell becomes restricted (see RESTRICTED SHELL below).
--verbose
Equivalent to -v.
--version
Show version information for this instance of bash on the standard output and exit successfully.
 

ARGUMENTS

If arguments remain after option processing, and neither the -c nor the -s option has been supplied, the first argument is assumed to be the name of a file containing shell commands. If bash is invoked in this fashion, $0 is set to the name of the file, and the positional parameters are set to the remaining arguments. Bash reads and executes commands from this file, then exits. Bash's exit status is the exit status of the last command executed in the script. If no commands are executed, the exit status is 0. An attempt is first made to open the file in the current directory, and, if no file is found, then the shell searches the directories in PATH for the script.  

INVOCATION

A login shell is one whose first character of argument zero is a -, or one started with the --login option.

An interactive shell is one started without non-option arguments (unless -s is specified) and without the -c option whose standard input and error are both connected to terminals (as determined by isatty(3)), or one started with the -i option. PS1 is set and $- includes i if bash is interactive, allowing a shell script or a startup file to test this state.

The following paragraphs describe how bash executes its startup files. If any of the files exist but cannot be read, bash reports an error. Tildes are expanded in filenames as described below under Tilde Expansion in the EXPANSION section.

When bash is invoked as an interactive login shell, or as a non-interactive shell with the --login option, it first reads and executes commands from the file /etc/profile, if that file exists. After reading that file, it looks for ~/.bash_profile, ~/.bash_login, and ~/.profile, in that order, and reads and executes commands from the first one that exists and is readable. The --noprofile option may be used when the shell is started to inhibit this behavior.

When an interactive login shell exits, or a non-interactive login shell executes the exit builtin command, bash reads and executes commands from the file ~/.bash_logout, if it exists.

When an interactive shell that is not a login shell is started, bash reads and executes commands from ~/.bashrc, if that file exists. This may be inhibited by using the --norc option. The --rcfile file option will force bash to read and execute commands from file instead of ~/.bashrc.

When bash is started non-interactively, to run a shell script, for example, it looks for the variable BASH_ENV in the environment, expands its value if it appears there, and uses the expanded value as the name of a file to read and execute. Bash behaves as if the following command were executed:

if [ -n "$BASH_ENV" ]; then . "$BASH_ENV"; fi

but the value of the PATH variable is not used to search for the filename.

If bash is invoked with the name sh, it tries to mimic the startup behavior of historical versions of sh as closely as possible, while conforming to the POSIX standard as well. When invoked as an interactive login shell, or a non-interactive shell with the --login option, it first attempts to read and execute commands from /etc/profile and ~/.profile, in that order. The --noprofile option may be used to inhibit this behavior. When invoked as an interactive shell with the name sh, bash looks for the variable ENV, expands its value if it is defined, and uses the expanded value as the name of a file to read and execute. Since a shell invoked as sh does not attempt to read and execute commands from any other startup files, the --rcfile option has no effect. A non-interactive shell invoked with the name sh does not attempt to read any other startup files. When invoked as sh, bash enters posix mode after the startup files are read.

When bash is started in posix mode, as with the --posix command line option, it follows the POSIX standard for startup files. In this mode, interactive shells expand the ENV variable and commands are read and executed from the file whose name is the expanded value. No other startup files are read.

Bash attempts to determine when it is being run with its standard input connected to a network connection, as when executed by the remote shell daemon, usually rshd, or the secure shell daemon sshd. If bash determines it is being run in this fashion, it reads and executes commands from ~/.bashrc, if that file exists and is readable. It will not do this if invoked as sh. The --norc option may be used to inhibit this behavior, and the --rcfile option may be used to force another file to be read, but neither rshd nor sshd generally invoke the shell with those options or allow them to be specified.

If the shell is started with the effective user (group) id not equal to the real user (group) id, and the -p option is not supplied, no startup files are read, shell functions are not inherited from the environment, the SHELLOPTS, BASHOPTS, CDPATH, and GLOBIGNORE variables, if they appear in the environment, are ignored, and the effective user id is set to the real user id. If the -p option is supplied at invocation, the startup behavior is the same, but the effective user id is not reset.  

DEFINITIONS

The following definitions are used throughout the rest of this document.

blank
A space or tab.
word
A sequence of characters considered as a single unit by the shell. Also known as a token.
name
A word consisting only of alphanumeric characters and underscores, and beginning with an alphabetic character or an underscore. Also referred to as an identifier.
metacharacter
A character that, when unquoted, separates words. One of the following:

| & ; ( ) < > space tab newline

control operator
A token that performs a control function. It is one of the following symbols:

|| & && ; ;; ;& ;;& ( ) | |& <newline>

 

RESERVED WORDS

Reserved words are words that have a special meaning to the shell. The following words are recognized as reserved when unquoted and either the first word of a simple command (see SHELL GRAMMAR below) or the third word of a case or for command:

! case coproc do done elif else esac fi for function if in select then until while { } time [[ ]]

 

SHELL GRAMMAR

 

Simple Commands

A simple command is a sequence of optional variable assignments followed by blank-separated words and redirections, and terminated by a control operator. The first word specifies the command to be executed, and is passed as argument zero. The remaining words are passed as arguments to the invoked command.

The return value of a simple command is its exit status, or 128+n if the command is terminated by signal n.  

Pipelines

A pipeline is a sequence of one or more commands separated by one of the control operators | or |&. The format for a pipeline is:

[time [-p]] [ ! ] command [ [|||&] command2 ... ]

The standard output of command is connected via a pipe to the standard input of command2. This connection is performed before any redirections specified by the command (see REDIRECTION below). If |& is used, command's standard error, in addition to its standard output, is connected to command2's standard input through the pipe; it is shorthand for 2>&1 |. This implicit redirection of the standard error to the standard output is performed after any redirections specified by the command.

The return status of a pipeline is the exit status of the last command, unless the pipefail option is enabled. If pipefail is enabled, the pipeline's return status is the value of the last (rightmost) command to exit with a non-zero status, or zero if all commands exit successfully. If the reserved word ! precedes a pipeline, the exit status of that pipeline is the logical negation of the exit status as described above. The shell waits for all commands in the pipeline to terminate before returning a value.

If the time reserved word precedes a pipeline, the elapsed as well as user and system time consumed by its execution are reported when the pipeline terminates. The -p option changes the output format to that specified by POSIX. When the shell is in posix mode, it does not recognize time as a reserved word if the next token begins with a `-'. The TIMEFORMAT variable may be set to a format string that specifies how the timing information should be displayed; see the description of TIMEFORMAT under Shell Variables below.

When the shell is in posix mode, time may be followed by a newline. In this case, the shell displays the total user and system time consumed by the shell and its children. The TIMEFORMAT variable may be used to specify the format of the time information.

Each command in a pipeline is executed as a separate process (i.e., in a subshell).  

Lists

A list is a sequence of one or more pipelines separated by one of the operators ;, &, &&, or ||, and optionally terminated by one of ;, &, or <newline>.

Of these list operators, && and || have equal precedence, followed by ; and &, which have equal precedence.

A sequence of one or more newlines may appear in a list instead of a semicolon to delimit commands.

If a command is terminated by the control operator &, the shell executes the command in the background in a subshell. The shell does not wait for the command to finish, and the return status is 0. Commands separated by a ; are executed sequentially; the shell waits for each command to terminate in turn. The return status is the exit status of the last command executed.

AND and OR lists are sequences of one or more pipelines separated by the && and || control operators, respectively. AND and OR lists are executed with left associativity. An AND list has the form

command1 && command2

command2 is executed if, and only if, command1 returns an exit status of zero.

An OR list has the form

command1 || command2

command2 is executed if and only if command1 returns a non-zero exit status. The return status of AND and OR lists is the exit status of the last command executed in the list.  

Compound Commands

A compound command is one of the following. In most cases a list in a command's description may be separated from the rest of the command by one or more newlines, and may be followed by a newline in place of a semicolon.

(list)
list is executed in a subshell environment (see COMMAND EXECUTION ENVIRONMENT below). Variable assignments and builtin commands that affect the shell's environment do not remain in effect after the command completes. The return status is the exit status of list.
{ list; }
list is simply executed in the current shell environment. list must be terminated with a newline or semicolon. This is known as a group command. The return status is the exit status of list. Note that unlike the metacharacters ( and ), { and } are reserved words and must occur where a reserved word is permitted to be recognized. Since they do not cause a word break, they must be separated from list by whitespace or another shell metacharacter.
((expression))
The expression is evaluated according to the rules described below under ARITHMETIC EVALUATION. If the value of the expression is non-zero, the return status is 0; otherwise the return status is 1. This is exactly equivalent to let "expression".
[[ expression ]]
Return a status of 0 or 1 depending on the evaluation of the conditional expression expression. Expressions are composed of the primaries described below under CONDITIONAL EXPRESSIONS. Word splitting and pathname expansion are not performed on the words between the [[ and ]]; tilde expansion, parameter and variable expansion, arithmetic expansion, command substitution, process substitution, and quote removal are performed. Conditional operators such as -f must be unquoted to be recognized as primaries.

When used with [[, the < and > operators sort lexicographically using the current locale.

When the == and != operators are used, the string to the right of the operator is considered a pattern and matched according to the rules described below under Pattern Matching, as if the extglob shell option were enabled. The = operator is equivalent to ==. If the nocasematch shell option is enabled, the match is performed without regard to the case of alphabetic characters. The return value is 0 if the string matches (==) or does not match (!=) the pattern, and 1 otherwise. Any part of the pattern may be quoted to force the quoted portion to be matched as a string.

An additional binary operator, =~, is available, with the same precedence as == and !=. When it is used, the string to the right of the operator is considered an extended regular expression and matched accordingly (as in regex(3)). The return value is 0 if the string matches the pattern, and 1 otherwise. If the regular expression is syntactically incorrect, the conditional expression's return value is 2. If the nocasematch shell option is enabled, the match is performed without regard to the case of alphabetic characters. Any part of the pattern may be quoted to force the quoted portion to be matched as a string. Bracket expressions in regular expressions must be treated carefully, since normal quoting characters lose their meanings between brackets. If the pattern is stored in a shell variable, quoting the variable expansion forces the entire pattern to be matched as a string. Substrings matched by parenthesized subexpressions within the regular expression are saved in the array variable BASH_REMATCH. The element of BASH_REMATCH with index 0 is the portion of the string matching the entire regular expression. The element of BASH_REMATCH with index n is the portion of the string matching the nth parenthesized subexpression.

Expressions may be combined using the following operators, listed in decreasing order of precedence:

( expression )
Returns the value of expression. This may be used to override the normal precedence of operators.
! expression
True if expression is false.
expression1 && expression2
True if both expression1 and expression2 are true.
expression1 || expression2
True if either expression1 or expression2 is true.

The && and || operators do not evaluate expression2 if the value of expression1 is sufficient to determine the return value of the entire conditional expression.

for name [ [ in [ word ... ] ] ; ] do list ; done
The list of words following in is expanded, generating a list of items. The variable name is set to each element of this list in turn, and list is executed each time. If the in word is omitted, the for command executes list once for each positional parameter that is set (see PARAMETERS below). The return status is the exit status of the last command that executes. If the expansion of the items following in results in an empty list, no commands are executed, and the return status is 0.
for (( expr1 ; expr2 ; expr3 )) ; do list ; done
First, the arithmetic expression expr1 is evaluated according to the rules described below under ARITHMETIC EVALUATION. The arithmetic expression expr2 is then evaluated repeatedly until it evaluates to zero. Each time expr2 evaluates to a non-zero value, list is executed and the arithmetic expression expr3 is evaluated. If any expression is omitted, it behaves as if it evaluates to 1. The return value is the exit status of the last command in list that is executed, or false if any of the expressions is invalid.
select name [ in word ] ; do list ; done
The list of words following in is expanded, generating a list of items. The set of expanded words is printed on the standard error, each preceded by a number. If the in word is omitted, the positional parameters are printed (see PARAMETERS below). The PS3 prompt is then displayed and a line read from the standard input. If the line consists of a number corresponding to one of the displayed words, then the value of name is set to that word. If the line is empty, the words and prompt are displayed again. If EOF is read, the command completes. Any other value read causes name to be set to null. The line read is saved in the variable REPLY. The list is executed after each selection until a break command is executed. The exit status of select is the exit status of the last command executed in list, or zero if no commands were executed.
case word in [ [(] pattern [ | pattern ]
A case command first expands word, and tries to match it against each pattern in turn, using the same matching rules as for pathname expansion (see Pathname Expansion below). The word is expanded using tilde expansion, parameter and variable expansion, arithmetic expansion, command substitution, process substitution and quote removal. Each pattern examined is expanded using tilde expansion, parameter and variable expansion, arithmetic expansion, command substitution, and process substitution. If the nocasematch shell option is enabled, the match is performed without regard to the case of alphabetic characters. When a match is found, the corresponding list is executed. If the ;; operator is used, no subsequent matches are attempted after the first pattern match. Using ;& in place of ;; causes execution to continue with the list associated with the next set of patterns. Using ;;& in place of ;; causes the shell to test the next pattern list in the statement, if any, and execute any associated list on a successful match. The exit status is zero if no pattern matches. Otherwise, it is the exit status of the last command executed in list.
if list; then list; [ elif list; then list; ] ... [ else list; ] fi
The if list is executed. If its exit status is zero, the then list is executed. Otherwise, each elif list is executed in turn, and if its exit status is zero, the corresponding then list is executed and the command completes. Otherwise, the else list is executed, if present. The exit status is the exit status of the last command executed, or zero if no condition tested true.
while list-1; do list-2; done
until list-1; do list-2; done
The while command continuously executes the list list-2 as long as the last command in the list list-1 returns an exit status of zero. The until command is identical to the while command, except that the test is negated: list-2 is executed as long as the last command in list-1 returns a non-zero exit status. The exit status of the while and until commands is the exit status of the last command executed in list-2, or zero if none was executed.
 

Coprocesses

A coprocess is a shell command preceded by the coproc reserved word. A coprocess is executed asynchronously in a subshell, as if the command had been terminated with the & control operator, with a two-way pipe established between the executing shell and the coprocess.

The format for a coprocess is:

coproc [NAME] command [redirections]

This creates a coprocess named NAME. If NAME is not supplied, the default name is COPROC. NAME must not be supplied if command is a simple command (see above); otherwise, it is interpreted as the first word of the simple command. When the coprocess is executed, the shell creates an array variable (see Arrays below) named NAME in the context of the executing shell. The standard output of command is connected via a pipe to a file descriptor in the executing shell, and that file descriptor is assigned to NAME[0]. The standard input of command is connected via a pipe to a file descriptor in the executing shell, and that file descriptor is assigned to NAME[1]. This pipe is established before any redirections specified by the command (see REDIRECTION below). The file descriptors can be utilized as arguments to shell commands and redirections using standard word expansions. The file descriptors are not available in subshells. The process ID of the shell spawned to execute the coprocess is available as the value of the variable NAME_PID. The wait builtin command may be used to wait for the coprocess to terminate.

Since the coprocess is created as an asynchronous command, the coproc command always returns success. The return status of a coprocess is the exit status of command.  

Shell Function Definitions

A shell function is an object that is called like a simple command and executes a compound command with a new set of positional parameters. Shell functions are declared as follows:

name () compound-command [redirection]
function name [()] compound-command [redirection]
This defines a function named name. The reserved word function is optional. If the function reserved word is supplied, the parentheses are optional. The body of the function is the compound command compound-command (see Compound Commands above). That command is usually a list of commands between { and }, but may be any command listed under Compound Commands above, with one exception: If the function reserved word is used, but the parentheses are not supplied, the braces are required. compound-command is executed whenever name is specified as the name of a simple command. When in posix mode, name may not be the name of one of the POSIX special builtins. Any redirections (see REDIRECTION below) specified when a function is defined are performed when the function is executed. The exit status of a function definition is zero unless a syntax error occurs or a readonly function with the same name already exists. When executed, the exit status of a function is the exit status of the last command executed in the body. (See FUNCTIONS below.)
 

COMMENTS

In a non-interactive shell, or an interactive shell in which the interactive_comments option to the shopt builtin is enabled (see SHELL BUILTIN COMMANDS below), a word beginning with # causes that word and all remaining characters on that line to be ignored. An interactive shell without the interactive_comments option enabled does not allow comments. The interactive_comments option is on by default in interactive shells.  

QUOTING

Quoting is used to remove the special meaning of certain characters or words to the shell. Quoting can be used to disable special treatment for special characters, to prevent reserved words from being recognized as such, and to prevent parameter expansion.

Each of the metacharacters listed above under DEFINITIONS has special meaning to the shell and must be quoted if it is to represent itself.

When the command history expansion facilities are being used (see HISTORY EXPANSION below), the history expansion character, usually !, must be quoted to prevent history expansion.

There are three quoting mechanisms: the escape character, single quotes, and double quotes.

A non-quoted backslash (\) is the escape character. It preserves the literal value of the next character that follows, with the exception of <newline>. If a \<newline> pair appears, and the backslash is not itself quoted, the \<newline> is treated as a line continuation (that is, it is removed from the input stream and effectively ignored).

Enclosing characters in single quotes preserves the literal value of each character within the quotes. A single quote may not occur between single quotes, even when preceded by a backslash.

Enclosing characters in double quotes preserves the literal value of all characters within the quotes, with the exception of $, `, \, and, when history expansion is enabled, !. When the shell is in posix mode, the ! has no special meaning within double quotes, even when history expansion is enabled. The characters $ and ` retain their special meaning within double quotes. The backslash retains its special meaning only when followed by one of the following characters: $, `, ", \, or <newline>. A double quote may be quoted within double quotes by preceding it with a backslash. If enabled, history expansion will be performed unless an ! appearing in double quotes is escaped using a backslash. The backslash preceding the ! is not removed.

The special parameters * and @ have special meaning when in double quotes (see PARAMETERS below).

Words of the form $aqstringaq are treated specially. The word expands to string, with backslash-escaped characters replaced as specified by the ANSI C standard. Backslash escape sequences, if present, are decoded as follows:

\a
alert (bell)
\b
backspace
\e
\E
an escape character
\f
form feed
\n
new line
\r
carriage return
\t
horizontal tab
\v
vertical tab
\\
backslash
\aq
single quote
\dq
double quote
\?
question mark
\nnn
the eight-bit character whose value is the octal value nnn (one to three digits)
\xHH
the eight-bit character whose value is the hexadecimal value HH (one or two hex digits)
\uHHHH
the Unicode (ISO/IEC 10646) character whose value is the hexadecimal value HHHH (one to four hex digits)
\UHHHHHHHH
the Unicode (ISO/IEC 10646) character whose value is the hexadecimal value HHHHHHHH (one to eight hex digits)
\cx
a control-x character

The expanded result is single-quoted, as if the dollar sign had not been present.

A double-quoted string preceded by a dollar sign ($dqstringdq) will cause the string to be translated according to the current locale. If the current locale is C or POSIX, the dollar sign is ignored. If the string is translated and replaced, the replacement is double-quoted.  

PARAMETERS

A parameter is an entity that stores values. It can be a name, a number, or one of the special characters listed below under Special Parameters. A variable is a parameter denoted by a name. A variable has a value and zero or more attributes. Attributes are assigned using the declare builtin command (see declare below in SHELL BUILTIN COMMANDS).

A parameter is set if it has been assigned a value. The null string is a valid value. Once a variable is set, it may be unset only by using the unset builtin command (see SHELL BUILTIN COMMANDS below).

A variable may be assigned to by a statement of the form

name=[value]

If value is not given, the variable is assigned the null string. All values undergo tilde expansion, parameter and variable expansion, command substitution, arithmetic expansion, and quote removal (see EXPANSION below). If the variable has its integer attribute set, then value is evaluated as an arithmetic expression even if the $((...)) expansion is not used (see Arithmetic Expansion below). Word splitting is not performed, with the exception of "$@" as explained below under Special Parameters. Pathname expansion is not performed. Assignment statements may also appear as arguments to the alias, declare, typeset, export, readonly, and local builtin commands (declaration commands). When in posix mode, these builtins may appear in a command after one or more instances of the command builtin and retain these assignment statement properties.

In the context where an assignment statement is assigning a value to a shell variable or array index, the += operator can be used to append to or add to the variable's previous value. This includes arguments to builtin commands such as declare that accept assignment statements (declaration commands). When += is applied to a variable for which the integer attribute has been set, value is evaluated as an arithmetic expression and added to the variable's current value, which is also evaluated. When += is applied to an array variable using compound assignment (see Arrays below), the variable's value is not unset (as it is when using =), and new values are appended to the array beginning at one greater than the array's maximum index (for indexed arrays) or added as additional key-value pairs in an associative array. When applied to a string-valued variable, value is expanded and appended to the variable's value.

A variable can be assigned the nameref attribute using the -n option to the declare or local builtin commands (see the descriptions of declare and local below) to create a nameref, or a reference to another variable. This allows variables to be manipulated indirectly. Whenever the nameref variable is referenced, assigned to, unset, or has its attributes modified (other than using or changing the nameref attribute itself), the operation is actually performed on the variable specified by the nameref variable's value. A nameref is commonly used within shell functions to refer to a variable whose name is passed as an argument to the function. For instance, if a variable name is passed to a shell function as its first argument, running

declare -n ref=$1

inside the function creates a nameref variable ref whose value is the variable name passed as the first argument. References and assignments to ref, and changes to its attributes, are treated as references, assignments, and attribute modifications to the variable whose name was passed as $1. If the control variable in a for loop has the nameref attribute, the list of words can be a list of shell variables, and a name reference will be established for each word in the list, in turn, when the loop is executed. Array variables cannot be given the nameref attribute. However, nameref variables can reference array variables and subscripted array variables. Namerefs can be unset using the -n option to the unset builtin. Otherwise, if unset is executed with the name of a nameref variable as an argument, the variable referenced by the nameref variable will be unset.  

Positional Parameters

A positional parameter is a parameter denoted by one or more digits, other than the single digit 0. Positional parameters are assigned from the shell's arguments when it is invoked, and may be reassigned using the set builtin command. Positional parameters may not be assigned to with assignment statements. The positional parameters are temporarily replaced when a shell function is executed (see FUNCTIONS below).

When a positional parameter consisting of more than a single digit is expanded, it must be enclosed in braces (see EXPANSION below).  

Special Parameters

The shell treats several parameters specially. These parameters may only be referenced; assignment to them is not allowed.

*
Expands to the positional parameters, starting from one. When the expansion is not within double quotes, each positional parameter expands to a separate word. In contexts where it is performed, those words are subject to further word splitting and pathname expansion. When the expansion occurs within double quotes, it expands to a single word with the value of each parameter separated by the first character of the IFS special variable. That is, "$*" is equivalent to "$1c$2c...", where c is the first character of the value of the IFS variable. If IFS is unset, the parameters are separated by spaces. If IFS is null, the parameters are joined without intervening separators.
@
Expands to the positional parameters, starting from one. When the expansion occurs within double quotes, each parameter expands to a separate word. That is, "$@" is equivalent to "$1" "$2" ... If the double-quoted expansion occurs within a word, the expansion of the first parameter is joined with the beginning part of the original word, and the expansion of the last parameter is joined with the last part of the original word. When there are no positional parameters, "$@" and $@ expand to nothing (i.e., they are removed).
#
Expands to the number of positional parameters in decimal.
?
Expands to the exit status of the most recently executed foreground pipeline.
-
Expands to the current option flags as specified upon invocation, by the set builtin command, or those set by the shell itself (such as the -i option).
$
Expands to the process ID of the shell. In a () subshell, it expands to the process ID of the current shell, not the subshell.
!
Expands to the process ID of the job most recently placed into the background, whether executed as an asynchronous command or using the bg builtin (see JOB CONTROL below).
0
Expands to the name of the shell or shell script. This is set at shell initialization. If bash is invoked with a file of commands, $0 is set to the name of that file. If bash is started with the -c option, then $0 is set to the first argument after the string to be executed, if one is present. Otherwise, it is set to the filename used to invoke bash, as given by argument zero.
_
At shell startup, set to the absolute pathname used to invoke the shell or shell script being executed as passed in the environment or argument list. Subsequently, expands to the last argument to the previous command, after expansion. Also set to the full pathname used to invoke each command executed and placed in the environment exported to that command. When checking mail, this parameter holds the name of the mail file currently being checked.
 

Shell Variables

The following variables are set by the shell:

BASH
Expands to the full filename used to invoke this instance of bash.
BASHOPTS
A colon-separated list of enabled shell options. Each word in the list is a valid argument for the -s option to the shopt builtin command (see SHELL BUILTIN COMMANDS below). The options appearing in BASHOPTS are those reported as on by shopt. If this variable is in the environment when bash starts up, each shell option in the list will be enabled before reading any startup files. This variable is read-only.
BASHPID
Expands to the process ID of the current bash process. This differs from $$ under certain circumstances, such as subshells that do not require bash to be re-initialized.
BASH_ALIASES
An associative array variable whose members correspond to the internal list of aliases as maintained by the alias builtin. Elements added to this array appear in the alias list; however, unsetting array elements currently does not cause aliases to be removed from the alias list. If BASH_ALIASES is unset, it loses its special properties, even if it is subsequently reset.
BASH_ARGC
An array variable whose values are the number of parameters in each frame of the current bash execution call stack. The number of parameters to the current subroutine (shell function or script executed with . or source) is at the top of the stack. When a subroutine is executed, the number of parameters passed is pushed onto BASH_ARGC. The shell sets BASH_ARGC only when in extended debugging mode (see the description of the extdebug option to the shopt builtin below)
BASH_ARGV
An array variable containing all of the parameters in the current bash execution call stack. The final parameter of the last subroutine call is at the top of the stack; the first parameter of the initial call is at the bottom. When a subroutine is executed, the parameters supplied are pushed onto BASH_ARGV. The shell sets BASH_ARGV only when in extended debugging mode (see the description of the extdebug option to the shopt builtin below)
BASH_CMDS
An associative array variable whose members correspond to the internal hash table of commands as maintained by the hash builtin. Elements added to this array appear in the hash table; however, unsetting array elements currently does not cause command names to be removed from the hash table. If BASH_CMDS is unset, it loses its special properties, even if it is subsequently reset.
BASH_COMMAND
The command currently being executed or about to be executed, unless the shell is executing a command as the result of a trap, in which case it is the command executing at the time of the trap.
BASH_EXECUTION_STRING
The command argument to the -c invocation option.
BASH_LINENO
An array variable whose members are the line numbers in source files where each corresponding member of FUNCNAME was invoked. ${BASH_LINENO[$i]} is the line number in the source file (${BASH_SOURCE[$i+1]}) where ${FUNCNAME[$i]} was called (or ${BASH_LINENO[$i-1]} if referenced within another shell function). Use LINENO to obtain the current line number.
BASH_LOADABLES_PATH
A colon-separated list of directories in which the shell looks for dynamically loadable builtins specified by the enable command.
BASH_REMATCH
An array variable whose members are assigned by the =~ binary operator to the [[ conditional command. The element with index 0 is the portion of the string matching the entire regular expression. The element with index n is the portion of the string matching the nth parenthesized subexpression. This variable is read-only.
BASH_SOURCE
An array variable whose members are the source filenames where the corresponding shell function names in the FUNCNAME array variable are defined. The shell function ${FUNCNAME[$i]} is defined in the file ${BASH_SOURCE[$i]} and called from ${BASH_SOURCE[$i+1]}.
BASH_SUBSHELL
Incremented by one within each subshell or subshell environment when the shell begins executing in that environment. The initial value is 0.
BASH_VERSINFO
A readonly array variable whose members hold version information for this instance of bash. The values assigned to the array members are as follows:

BASH_VERSINFO[0]
The major version number (the release).
BASH_VERSINFO[1]
The minor version number (the version).
BASH_VERSINFO[2]
The patch level.
BASH_VERSINFO[3]
The build version.
BASH_VERSINFO[4]
The release status (e.g., beta1).
BASH_VERSINFO[5]
The value of MACHTYPE.
BASH_VERSION
Expands to a string describing the version of this instance of bash.
COMP_CWORD
An index into ${COMP_WORDS} of the word containing the current cursor position. This variable is available only in shell functions invoked by the programmable completion facilities (see Programmable Completion below).
COMP_KEY
The key (or final key of a key sequence) used to invoke the current completion function.
COMP_LINE
The current command line. This variable is available only in shell functions and external commands invoked by the programmable completion facilities (see Programmable Completion below).
COMP_POINT
The index of the current cursor position relative to the beginning of the current command. If the current cursor position is at the end of the current command, the value of this variable is equal to ${#COMP_LINE}. This variable is available only in shell functions and external commands invoked by the programmable completion facilities (see Programmable Completion below).
COMP_TYPE
Set to an integer value corresponding to the type of completion attempted that caused a completion function to be called: TAB, for normal completion, ?, for listing completions after successive tabs, !, for listing alternatives on partial word completion, @, to list completions if the word is not unmodified, or %, for menu completion. This variable is available only in shell functions and external commands invoked by the programmable completion facilities (see Programmable Completion below).
COMP_WORDBREAKS
The set of characters that the readline library treats as word separators when performing word completion. If COMP_WORDBREAKS is unset, it loses its special properties, even if it is subsequently reset.
COMP_WORDS
An array variable (see Arrays below) consisting of the individual words in the current command line. The line is split into words as readline would split it, using COMP_WORDBREAKS as described above. This variable is available only in shell functions invoked by the programmable completion facilities (see Programmable Completion below).
COPROC
An array variable (see Arrays below) created to hold the file descriptors for output from and input to an unnamed coprocess (see Coprocesses above).
DIRSTACK
An array variable (see Arrays below) containing the current contents of the directory stack. Directories appear in the stack in the order they are displayed by the dirs builtin. Assigning to members of this array variable may be used to modify directories already in the stack, but the pushd and popd builtins must be used to add and remove directories. Assignment to this variable will not change the current directory. If DIRSTACK is unset, it loses its special properties, even if it is subsequently reset.
EUID
Expands to the effective user ID of the current user, initialized at shell startup. This variable is readonly.
FUNCNAME
An array variable containing the names of all shell functions currently in the execution call stack. The element with index 0 is the name of any currently-executing shell function. The bottom-most element (the one with the highest index) is "main". This variable exists only when a shell function is executing. Assignments to FUNCNAME have no effect. If FUNCNAME is unset, it loses its special properties, even if it is subsequently reset.

This variable can be used with BASH_LINENO and BASH_SOURCE. Each element of FUNCNAME has corresponding elements in BASH_LINENO and BASH_SOURCE to describe the call stack. For instance, ${FUNCNAME[$i]} was called from the file ${BASH_SOURCE[$i+1]} at line number ${BASH_LINENO[$i]}. The caller builtin displays the current call stack using this information.

GROUPS
An array variable containing the list of groups of which the current user is a member. Assignments to GROUPS have no effect. If GROUPS is unset, it loses its special properties, even if it is subsequently reset.
HISTCMD
The history number, or index in the history list, of the current command. If HISTCMD is unset, it loses its special properties, even if it is subsequently reset.
HOSTNAME
Automatically set to the name of the current host.
HOSTTYPE
Automatically set to a string that uniquely describes the type of machine on which bash is executing. The default is system-dependent.
LINENO
Each time this parameter is referenced, the shell substitutes a decimal number representing the current sequential line number (starting with 1) within a script or function. When not in a script or function, the value substituted is not guaranteed to be meaningful. If LINENO is unset, it loses its special properties, even if it is subsequently reset.
MACHTYPE
Automatically set to a string that fully describes the system type on which bash is executing, in the standard GNU cpu-company-system format. The default is system-dependent.
MAPFILE
An array variable (see Arrays below) created to hold the text read by the mapfile builtin when no variable name is supplied.
OLDPWD
The previous working directory as set by the cd command.
OPTARG
The value of the last option argument processed by the getopts builtin command (see SHELL BUILTIN COMMANDS below).
OPTIND
The index of the next argument to be processed by the getopts builtin command (see SHELL BUILTIN COMMANDS below).
OSTYPE
Automatically set to a string that describes the operating system on which bash is executing. The default is system-dependent.
PIPESTATUS
An array variable (see Arrays below) containing a list of exit status values from the processes in the most-recently-executed foreground pipeline (which may contain only a single command).
PPID
The process ID of the shell's parent. This variable is readonly.
PWD
The current working directory as set by the cd command.
RANDOM
Each time this parameter is referenced, a random integer between 0 and 32767 is generated. The sequence of random numbers may be initialized by assigning a value to RANDOM. If RANDOM is unset, it loses its special properties, even if it is subsequently reset.
READLINE_LINE
The contents of the readline line buffer, for use with bind -x (see SHELL BUILTIN COMMANDS below).
READLINE_POINT
The position of the insertion point in the readline line buffer, for use with bind -x (see SHELL BUILTIN COMMANDS below).
REPLY
Set to the line of input read by the read builtin command when no arguments are supplied.
SECONDS
Each time this parameter is referenced, the number of seconds since shell invocation is returned. If a value is assigned to SECONDS, the value returned upon subsequent references is the number of seconds since the assignment plus the value assigned. If SECONDS is unset, it loses its special properties, even if it is subsequently reset.
SHELLOPTS
A colon-separated list of enabled shell options. Each word in the list is a valid argument for the -o option to the set builtin command (see SHELL BUILTIN COMMANDS below). The options appearing in SHELLOPTS are those reported as on by set -o. If this variable is in the environment when bash starts up, each shell option in the list will be enabled before reading any startup files. This variable is read-only.
SHLVL
Incremented by one each time an instance of bash is started.
UID
Expands to the user ID of the current user, initialized at shell startup. This variable is readonly.

The following variables are used by the shell. In some cases, bash assigns a default value to a variable; these cases are noted below.

BASH_COMPAT
The value is used to set the shell's compatibility level. See the description of the shopt builtin below under SHELL BUILTIN COMMANDS for a description of the various compatibility levels and their effects. The value may be a decimal number (e.g., 4.2) or an integer (e.g., 42) corresponding to the desired compatibility level. If BASH_COMPAT is unset or set to the empty string, the compatibility level is set to the default for the current version. If BASH_COMPAT is set to a value that is not one of the valid compatibility levels, the shell prints an error message and sets the compatibility level to the default for the current version. The valid compatibility levels correspond to the compatibility options accepted by the shopt builtin described below (for example, compat42 means that 4.2 and 42 are valid values). The current version is also a valid value.
BASH_ENV
If this parameter is set when bash is executing a shell script, its value is interpreted as a filename containing commands to initialize the shell, as in ~/.bashrc. The value of BASH_ENV is subjected to parameter expansion, command substitution, and arithmetic expansion before being interpreted as a filename. PATH is not used to search for the resultant filename.
BASH_XTRACEFD
If set to an integer corresponding to a valid file descriptor, bash will write the trace output generated when set -x is enabled to that file descriptor. The file descriptor is closed when BASH_XTRACEFD is unset or assigned a new value. Unsetting BASH_XTRACEFD or assigning it the empty string causes the trace output to be sent to the standard error. Note that setting BASH_XTRACEFD to 2 (the standard error file descriptor) and then unsetting it will result in the standard error being closed.
CDPATH
The search path for the cd command. This is a colon-separated list of directories in which the shell looks for destination directories specified by the cd command. A sample value is ".:~:/usr".
CHILD_MAX
Set the number of exited child status values for the shell to remember. Bash will not allow this value to be decreased below a POSIX-mandated minimum, and there is a maximum value (currently 8192) that this may not exceed. The minimum value is system-dependent.
COLUMNS
Used by the select compound command to determine the terminal width when printing selection lists. Automatically set if the checkwinsize option is enabled or in an interactive shell upon receipt of a SIGWINCH.
COMPREPLY
An array variable from which bash reads the possible completions generated by a shell function invoked by the programmable completion facility (see Programmable Completion below). Each array element contains one possible completion.
EMACS
If bash finds this variable in the environment when the shell starts with value t, it assumes that the shell is running in an Emacs shell buffer and disables line editing.
ENV
Similar to BASH_ENV; used when the shell is invoked in POSIX mode.
EXECIGNORE
A colon-separated list of shell patterns (see Pattern Matching) defining the list of filenames to be ignored by command search using PATH. Files whose full pathnames match one of these patterns are not considered executable files for the purposes of completion and command execution via PATH lookup. This does not affect the behavior of the [, test, and [[ commands. Full pathnames in the command hash table are not subject to EXECIGNORE. Use this variable to ignore shared library files that have the executable bit set, but are not executable files. The pattern matching honors the setting of the extglob shell option.
FCEDIT
The default editor for the fc builtin command.
FIGNORE
A colon-separated list of suffixes to ignore when performing filename completion (see READLINE below). A filename whose suffix matches one of the entries in FIGNORE is excluded from the list of matched filenames. A sample value is ".o:~".
FUNCNEST
If set to a numeric value greater than 0, defines a maximum function nesting level. Function invocations that exceed this nesting level will cause the current command to abort.
GLOBIGNORE
A colon-separated list of patterns defining the set of filenames to be ignored by pathname expansion. If a filename matched by a pathname expansion pattern also matches one of the patterns in GLOBIGNORE, it is removed from the list of matches.
HISTCONTROL
A colon-separated list of values controlling how commands are saved on the history list. If the list of values includes ignorespace, lines which begin with a space character are not saved in the history list. A value of ignoredups causes lines matching the previous history entry to not be saved. A value of ignoreboth is shorthand for ignorespace and ignoredups. A value of erasedups causes all previous lines matching the current line to be removed from the history list before that line is saved. Any value not in the above list is ignored. If HISTCONTROL is unset, or does not include a valid value, all lines read by the shell parser are saved on the history list, subject to the value of HISTIGNORE. The second and subsequent lines of a multi-line compound command are not tested, and are added to the history regardless of the value of HISTCONTROL.
HISTFILE
The name of the file in which command history is saved (see HISTORY below). The default value is ~/.bash_history. If unset, the command history is not saved when a shell exits.
HISTFILESIZE
The maximum number of lines contained in the history file. When this variable is assigned a value, the history file is truncated, if necessary, to contain no more than that number of lines by removing the oldest entries. The history file is also truncated to this size after writing it when a shell exits. If the value is 0, the history file is truncated to zero size. Non-numeric values and numeric values less than zero inhibit truncation. The shell sets the default value to the value of HISTSIZE after reading any startup files.
HISTIGNORE
A colon-separated list of patterns used to decide which command lines should be saved on the history list. Each pattern is anchored at the beginning of the line and must match the complete line (no implicit `*' is appended). Each pattern is tested against the line after the checks specified by HISTCONTROL are applied. In addition to the normal shell pattern matching characters, `&' matches the previous history line. `&' may be escaped using a backslash; the backslash is removed before attempting a match. The second and subsequent lines of a multi-line compound command are not tested, and are added to the history regardless of the value of HISTIGNORE. The pattern matching honors the setting of the extglob shell option.
HISTSIZE
The number of commands to remember in the command history (see HISTORY below). If the value is 0, commands are not saved in the history list. Numeric values less than zero result in every command being saved on the history list (there is no limit). The shell sets the default value to 500 after reading any startup files.
HISTTIMEFORMAT
If this variable is set and not null, its value is used as a format string for strftime(3) to print the time stamp associated with each history entry displayed by the history builtin. If this variable is set, time stamps are written to the history file so they may be preserved across shell sessions. This uses the history comment character to distinguish timestamps from other history lines.
HOME
The home directory of the current user; the default argument for the cd builtin command. The value of this variable is also used when performing tilde expansion.
HOSTFILE
Contains the name of a file in the same format as /etc/hosts that should be read when the shell needs to complete a hostname. The list of possible hostname completions may be changed while the shell is running; the next time hostname completion is attempted after the value is changed, bash adds the contents of the new file to the existing list. If HOSTFILE is set, but has no value, or does not name a readable file, bash attempts to read /etc/hosts to obtain the list of possible hostname completions. When HOSTFILE is unset, the hostname list is cleared.
IFS
The Internal Field Separator that is used for word splitting after expansion and to split lines into words with the read builtin command. The default value is ``<space><tab><newline>''.
IGNOREEOF
Controls the action of an interactive shell on receipt of an EOF character as the sole input. If set, the value is the number of consecutive EOF characters which must be typed as the first characters on an input line before bash exits. If the variable exists but does not have a numeric value, or has no value, the default value is 10. If it does not exist, EOF signifies the end of input to the shell.
INPUTRC
The filename for the readline startup file, overriding the default of ~/.inputrc (see READLINE below).
LANG
Used to determine the locale category for any category not specifically selected with a variable starting with LC_.
LC_ALL
This variable overrides the value of LANG and any other LC_ variable specifying a locale category.
LC_COLLATE
This variable determines the collation order used when sorting the results of pathname expansion, and determines the behavior of range expressions, equivalence classes, and collating sequences within pathname expansion and pattern matching.
LC_CTYPE
This variable determines the interpretation of characters and the behavior of character classes within pathname expansion and pattern matching.
LC_MESSAGES
This variable determines the locale used to translate double-quoted strings preceded by a $.
LC_NUMERIC
This variable determines the locale category used for number formatting.
LC_TIME
This variable determines the locale category used for data and time formatting.
LINES
Used by the select compound command to determine the column length for printing selection lists. Automatically set if the checkwinsize option is enabled or in an interactive shell upon receipt of a SIGWINCH.
MAIL
If this parameter is set to a file or directory name and the MAILPATH variable is not set, bash informs the user of the arrival of mail in the specified file or Maildir-format directory.
MAILCHECK
Specifies how often (in seconds) bash checks for mail. The default is 60 seconds. When it is time to check for mail, the shell does so before displaying the primary prompt. If this variable is unset, or set to a value that is not a number greater than or equal to zero, the shell disables mail checking.
MAILPATH
A colon-separated list of filenames to be checked for mail. The message to be printed when mail arrives in a particular file may be specified by separating the filename from the message with a `?'. When used in the text of the message, $_ expands to the name of the current mailfile. Example:

MAILPATH=aq/var/mail/bfox?"You have mail":~/shell-mail?"$_ has mail!"aq

Bash can be configured to supply a default value for this variable (there is no value by default), but the location of the user mail files that it uses is system dependent (e.g., /var/mail/$USER).

OPTERR
If set to the value 1, bash displays error messages generated by the getopts builtin command (see SHELL BUILTIN COMMANDS below). OPTERR is initialized to 1 each time the shell is invoked or a shell script is executed.
PATH
The search path for commands. It is a colon-separated list of directories in which the shell looks for commands (see COMMAND EXECUTION below). A zero-length (null) directory name in the value of PATH indicates the current directory. A null directory name may appear as two adjacent colons, or as an initial or trailing colon. The default path is system-dependent, and is set by the administrator who installs bash. A common value is /usr/local/bin:/usr/local/sbin:/usr/bin:/usr/sbin:/bin:/sbin.
POSIXLY_CORRECT
If this variable is in the environment when bash starts, the shell enters posix mode before reading the startup files, as if the --posix invocation option had been supplied. If it is set while the shell is running, bash enables posix mode, as if the command set -o posix had been executed.
PROMPT_COMMAND
If set, the value is executed as a command prior to issuing each primary prompt.
PROMPT_DIRTRIM
If set to a number greater than zero, the value is used as the number of trailing directory components to retain when expanding the \w and \W prompt string escapes (see PROMPTING below). Characters removed are replaced with an ellipsis.
PS0
The value of this parameter is expanded (see PROMPTING below) and displayed by interactive shells after reading a command and before the command is executed.
PS1
The value of this parameter is expanded (see PROMPTING below) and used as the primary prompt string. The default value is ``\s-\v\$ ''.
PS2
The value of this parameter is expanded as with PS1 and used as the secondary prompt string. The default is ``> ''.
PS3
The value of this parameter is used as the prompt for the select command (see SHELL GRAMMAR above).
PS4
The value of this parameter is expanded as with PS1 and the value is printed before each command bash displays during an execution trace. The first character of PS4 is replicated multiple times, as necessary, to indicate multiple levels of indirection. The default is ``+ ''.
SHELL
The full pathname to the shell is kept in this environment variable. If it is not set when the shell starts, bash assigns to it the full pathname of the current user's login shell.
TIMEFORMAT
The value of this parameter is used as a format string specifying how the timing information for pipelines prefixed with the time reserved word should be displayed. The % character introduces an escape sequence that is expanded to a time value or other information. The escape sequences and their meanings are as follows; the braces denote optional portions.

%%
A literal %.
%[p][l]R
The elapsed time in seconds.
%[p][l]U
The number of CPU seconds spent in user mode.
%[p][l]S
The number of CPU seconds spent in system mode.
%P
The CPU percentage, computed as (%U + %S) / %R.
The optional p is a digit specifying the precision, the number of fractional digits after a decimal point. A value of 0 causes no decimal point or fraction to be output. At most three places after the decimal point may be specified; values of p greater than 3 are changed to 3. If p is not specified, the value 3 is used.
The optional l specifies a longer format, including minutes, of the form MMmSS.FFs. The value of p determines whether or not the fraction is included.
If this variable is not set, bash acts as if it had the value $aq\nreal\t%3lR\nuser\t%3lU\nsys\t%3lSaq. If the value is null, no timing information is displayed. A trailing newline is added when the format string is displayed.
TMOUT
If set to a value greater than zero, TMOUT is treated as the default timeout for the read builtin. The select command terminates if input does not arrive after TMOUT seconds when input is coming from a terminal. In an interactive shell, the value is interpreted as the number of seconds to wait for a line of input after issuing the primary prompt. Bash terminates after waiting for that number of seconds if a complete line of input does not arrive.
TMPDIR
If set, bash uses its value as the name of a directory in which bash creates temporary files for the shell's use.
auto_resume
This variable controls how the shell interacts with the user and job control. If this variable is set, single word simple commands without redirections are treated as candidates for resumption of an existing stopped job. There is no ambiguity allowed; if there is more than one job beginning with the string typed, the job most recently accessed is selected. The name of a stopped job, in this context, is the command line used to start it. If set to the value exact, the string supplied must match the name of a stopped job exactly; if set to substring, the string supplied needs to match a substring of the name of a stopped job. The substring value provides functionality analogous to the %? job identifier (see JOB CONTROL below). If set to any other value, the supplied string must be a prefix of a stopped job's name; this provides functionality analogous to the %string job identifier.
histchars
The two or three characters which control history expansion and tokenization (see HISTORY EXPANSION below). The first character is the history expansion character, the character which signals the start of a history expansion, normally `!'. The second character is the quick substitution character, which is used as shorthand for re-running the previous command entered, substituting one string for another in the command. The default is `^'. The optional third character is the character which indicates that the remainder of the line is a comment when found as the first character of a word, normally `#'. The history comment character causes history substitution to be skipped for the remaining words on the line. It does not necessarily cause the shell parser to treat the rest of the line as a comment.
 

Arrays

Bash provides one-dimensional indexed and associative array variables. Any variable may be used as an indexed array; the declare builtin will explicitly declare an array. There is no maximum limit on the size of an array, nor any requirement that members be indexed or assigned contiguously. Indexed arrays are referenced using integers (including arithmetic expressions) and are zero-based; associative arrays are referenced using arbitrary strings. Unless otherwise noted, indexed array indices must be non-negative integers.

An indexed array is created automatically if any variable is assigned to using the syntax name[subscript]=value. The subscript is treated as an arithmetic expression that must evaluate to a number. To explicitly declare an indexed array, use declare -a name (see SHELL BUILTIN COMMANDS below). declare -a name[subscript] is also accepted; the subscript is ignored.

Associative arrays are created using declare -A name.

Attributes may be specified for an array variable using the declare and readonly builtins. Each attribute applies to all members of an array.

Arrays are assigned to using compound assignments of the form name=(value1 ... valuen), where each value is of the form [subscript]=string. Indexed array assignments do not require anything but string. When assigning to indexed arrays, if the optional brackets and subscript are supplied, that index is assigned to; otherwise the index of the element assigned is the last index assigned to by the statement plus one. Indexing starts at zero.

When assigning to an associative array, the subscript is required.

This syntax is also accepted by the declare builtin. Individual array elements may be assigned to using the name[subscript]=value syntax introduced above. When assigning to an indexed array, if name is subscripted by a negative number, that number is interpreted as relative to one greater than the maximum index of name, so negative indices count back from the end of the array, and an index of -1 references the last element.

Any element of an array may be referenced using ${name[subscript]}. The braces are required to avoid conflicts with pathname expansion. If subscript is @ or *, the word expands to all members of name. These subscripts differ only when the word appears within double quotes. If the word is double-quoted, ${name[*]} expands to a single word with the value of each array member separated by the first character of the IFS special variable, and ${name[@]} expands each element of name to a separate word. When there are no array members, ${name[@]} expands to nothing. If the double-quoted expansion occurs within a word, the expansion of the first parameter is joined with the beginning part of the original word, and the expansion of the last parameter is joined with the last part of the original word. This is analogous to the expansion of the special parameters * and @ (see Special Parameters above). ${#name[subscript]} expands to the length of ${name[subscript]}. If subscript is * or @, the expansion is the number of elements in the array. If the subscript used to reference an element of an indexed array evaluates to a number less than zero, it is interpreted as relative to one greater than the maximum index of the array, so negative indices count back from the end of the array, and an index of -1 references the last element.

Referencing an array variable without a subscript is equivalent to referencing the array with a subscript of 0. Any reference to a variable using a valid subscript is legal, and bash will create an array if necessary.

An array variable is considered set if a subscript has been assigned a value. The null string is a valid value.

It is possible to obtain the keys (indices) of an array as well as the values. ${!name[@]} and ${!name[*]} expand to the indices assigned in array variable name. The treatment when in double quotes is similar to the expansion of the special parameters @ and * within double quotes.

The unset builtin is used to destroy arrays. unset name[subscript] destroys the array element at index subscript. Negative subscripts to indexed arrays are interpreted as described above. Care must be taken to avoid unwanted side effects caused by pathname expansion. unset name, where name is an array, or unset name[subscript], where subscript is * or @, removes the entire array.

The declare, local, and readonly builtins each accept a -a option to specify an indexed array and a -A option to specify an associative array. If both options are supplied, -A takes precedence. The read builtin accepts a -a option to assign a list of words read from the standard input to an array. The set and declare builtins display array values in a way that allows them to be reused as assignments.  

EXPANSION

Expansion is performed on the command line after it has been split into words. There are seven kinds of expansion performed: brace expansion, tilde expansion, parameter and variable expansion, command substitution, arithmetic expansion, word splitting, and pathname expansion.

The order of expansions is: brace expansion; tilde expansion, parameter and variable expansion, arithmetic expansion, and command substitution (done in a left-to-right fashion); word splitting; and pathname expansion.

On systems that can support it, there is an additional expansion available: process substitution. This is performed at the same time as tilde, parameter, variable, and arithmetic expansion and command substitution.

After these expansions are performed, quote characters present in the original word are removed unless they have been quoted themselves (quote removal).

Only brace expansion, word splitting, and pathname expansion can change the number of words of the expansion; other expansions expand a single word to a single word. The only exceptions to this are the expansions of "$@" and "${name[@]}" as explained above (see PARAMETERS).  

Brace Expansion

Brace expansion is a mechanism by which arbitrary strings may be generated. This mechanism is similar to pathname expansion, but the filenames generated need not exist. Patterns to be brace expanded take the form of an optional preamble, followed by either a series of comma-separated strings or a sequence expression between a pair of braces, followed by an optional postscript. The preamble is prefixed to each string contained within the braces, and the postscript is then appended to each resulting string, expanding left to right.

Brace expansions may be nested. The results of each expanded string are not sorted; left to right order is preserved. For example, a{d,c,b}e expands into `ade ace abe'.

A sequence expression takes the form {x..y[..incr]}, where x and y are either integers or single characters, and incr, an optional increment, is an integer. When integers are supplied, the expression expands to each number between x and y, inclusive. Supplied integers may be prefixed with 0 to force each term to have the same width. When either x or y begins with a zero, the shell attempts to force all generated terms to contain the same number of digits, zero-padding where necessary. When characters are supplied, the expression expands to each character lexicographically between x and y, inclusive, using the default C locale. Note that both x and y must be of the same type. When the increment is supplied, it is used as the difference between each term. The default increment is 1 or -1 as appropriate.

Brace expansion is performed before any other expansions, and any characters special to other expansions are preserved in the result. It is strictly textual. Bash does not apply any syntactic interpretation to the context of the expansion or the text between the braces.

A correctly-formed brace expansion must contain unquoted opening and closing braces, and at least one unquoted comma or a valid sequence expression. Any incorrectly formed brace expansion is left unchanged. A { or , may be quoted with a backslash to prevent its being considered part of a brace expression. To avoid conflicts with parameter expansion, the string ${ is not considered eligible for brace expansion.

This construct is typically used as shorthand when the common prefix of the strings to be generated is longer than in the above example:

mkdir /usr/local/src/bash/{old,new,dist,bugs}

or
chown root /usr/{ucb/{ex,edit},lib/{ex?.?*,how_ex}}

Brace expansion introduces a slight incompatibility with historical versions of sh. sh does not treat opening or closing braces specially when they appear as part of a word, and preserves them in the output. Bash removes braces from words as a consequence of brace expansion. For example, a word entered to sh as file{1,2} appears identically in the output. The same word is output as file1 file2 after expansion by bash. If strict compatibility with sh is desired, start bash with the +B option or disable brace expansion with the +B option to the set command (see SHELL BUILTIN COMMANDS below).  

Tilde Expansion

If a word begins with an unquoted tilde character (`~'), all of the characters preceding the first unquoted slash (or all characters, if there is no unquoted slash) are considered a tilde-prefix. If none of the characters in the tilde-prefix are quoted, the characters in the tilde-prefix following the tilde are treated as a possible login name. If this login name is the null string, the tilde is replaced with the value of the shell parameter HOME. If HOME is unset, the home directory of the user executing the shell is substituted instead. Otherwise, the tilde-prefix is replaced with the home directory associated with the specified login name.

If the tilde-prefix is a `~+', the value of the shell variable PWD replaces the tilde-prefix. If the tilde-prefix is a `~-', the value of the shell variable OLDPWD, if it is set, is substituted. If the characters following the tilde in the tilde-prefix consist of a number N, optionally prefixed by a `+' or a `-', the tilde-prefix is replaced with the corresponding element from the directory stack, as it would be displayed by the dirs builtin invoked with the tilde-prefix as an argument. If the characters following the tilde in the tilde-prefix consist of a number without a leading `+' or `-', `+' is assumed.

If the login name is invalid, or the tilde expansion fails, the word is unchanged.

Each variable assignment is checked for unquoted tilde-prefixes immediately following a : or the first =. In these cases, tilde expansion is also performed. Consequently, one may use filenames with tildes in assignments to PATH, MAILPATH, and CDPATH, and the shell assigns the expanded value.  

Parameter Expansion

The `$' character introduces parameter expansion, command substitution, or arithmetic expansion. The parameter name or symbol to be expanded may be enclosed in braces, which are optional but serve to protect the variable to be expanded from characters immediately following it which could be interpreted as part of the name.

When braces are used, the matching ending brace is the first `}' not escaped by a backslash or within a quoted string, and not within an embedded arithmetic expansion, command substitution, or parameter expansion.

${parameter}
The value of parameter is substituted. The braces are required when parameter is a positional parameter with more than one digit, or when parameter is followed by a character which is not to be interpreted as part of its name. The parameter is a shell parameter as described above PARAMETERS) or an array reference (Arrays).

If the first character of parameter is an exclamation point (!), and parameter is not a nameref, it introduces a level of variable indirection. Bash uses the value of the variable formed from the rest of parameter as the name of the variable; this variable is then expanded and that value is used in the rest of the substitution, rather than the value of parameter itself. This is known as indirect expansion. If parameter is a nameref, this expands to the name of the variable referenced by parameter instead of performing the complete indirect expansion. The exceptions to this are the expansions of ${!prefix*} and ${!name[@]} described below. The exclamation point must immediately follow the left brace in order to introduce indirection.

In each of the cases below, word is subject to tilde expansion, parameter expansion, command substitution, and arithmetic expansion.

When not performing substring expansion, using the forms documented below (e.g., :-), bash tests for a parameter that is unset or null. Omitting the colon results in a test only for a parameter that is unset.

${parameter:-word}
Use Default Values. If parameter is unset or null, the expansion of word is substituted. Otherwise, the value of parameter is substituted.
${parameter:=word}
Assign Default Values. If parameter is unset or null, the expansion of word is assigned to parameter. The value of parameter is then substituted. Positional parameters and special parameters may not be assigned to in this way.
${parameter:?word}
Display Error if Null or Unset. If parameter is null or unset, the expansion of word (or a message to that effect if word is not present) is written to the standard error and the shell, if it is not interactive, exits. Otherwise, the value of parameter is substituted.
${parameter:+word}
Use Alternate Value. If parameter is null or unset, nothing is substituted, otherwise the expansion of word is substituted.
${parameter:offset}
${parameter:offset:length}
Substring Expansion. Expands to up to length characters of the value of parameter starting at the character specified by offset. If parameter is @, an indexed array subscripted by @ or *, or an associative array name, the results differ as described below. If length is omitted, expands to the substring of the value of parameter starting at the character specified by offset and extending to the end of the value. length and offset are arithmetic expressions (see ARITHMETIC EVALUATION below).

If offset evaluates to a number less than zero, the value is used as an offset in characters from the end of the value of parameter. If length evaluates to a number less than zero, it is interpreted as an offset in characters from the end of the value of parameter rather than a number of characters, and the expansion is the characters between offset and that result. Note that a negative offset must be separated from the colon by at least one space to avoid being confused with the :- expansion.

If parameter is @, the result is length positional parameters beginning at offset. A negative offset is taken relative to one greater than the greatest positional parameter, so an offset of -1 evaluates to the last positional parameter. It is an expansion error if length evaluates to a number less than zero.

If parameter is an indexed array name subscripted by @ or *, the result is the length members of the array beginning with ${parameter[offset]}. A negative offset is taken relative to one greater than the maximum index of the specified array. It is an expansion error if length evaluates to a number less than zero.

Substring expansion applied to an associative array produces undefined results.

Substring indexing is zero-based unless the positional parameters are used, in which case the indexing starts at 1 by default. If offset is 0, and the positional parameters are used, $0 is prefixed to the list.

${!prefix*}
${!prefix@}
Names matching prefix. Expands to the names of variables whose names begin with prefix, separated by the first character of the IFS special variable. When @ is used and the expansion appears within double quotes, each variable name expands to a separate word.
${!name[@]}
${!name[*]}
List of array keys. If name is an array variable, expands to the list of array indices (keys) assigned in name. If name is not an array, expands to 0 if name is set and null otherwise. When @ is used and the expansion appears within double quotes, each key expands to a separate word.
${#parameter}
Parameter length. The length in characters of the value of parameter is substituted. If parameter is * or @, the value substituted is the number of positional parameters. If parameter is an array name subscripted by * or @, the value substituted is the number of elements in the array. If parameter is an indexed array name subscripted by a negative number, that number is interpreted as relative to one greater than the maximum index of parameter, so negative indices count back from the end of the array, and an index of -1 references the last element.
${parameter#word}
${parameter##word}
Remove matching prefix pattern. The word is expanded to produce a pattern just as in pathname expansion. If the pattern matches the beginning of the value of parameter, then the result of the expansion is the expanded value of parameter with the shortest matching pattern (the ``#'' case) or the longest matching pattern (the ``##'' case) deleted. If parameter is @ or *, the pattern removal operation is applied to each positional parameter in turn, and the expansion is the resultant list. If parameter is an array variable subscripted with @ or *, the pattern removal operation is applied to each member of the array in turn, and the expansion is the resultant list.
${parameter%word}
${parameter%%word}
Remove matching suffix pattern. The word is expanded to produce a pattern just as in pathname expansion. If the pattern matches a trailing portion of the expanded value of parameter, then the result of the expansion is the expanded value of parameter with the shortest matching pattern (the ``%'' case) or the longest matching pattern (the ``%%'' case) deleted. If parameter is @ or *, the pattern removal operation is applied to each positional parameter in turn, and the expansion is the resultant list. If parameter is an array variable subscripted with @ or *, the pattern removal operation is applied to each member of the array in turn, and the expansion is the resultant list.
${parameter/pattern/string}
Pattern substitution. The pattern is expanded to produce a pattern just as in pathname expansion. Parameter is expanded and the longest match of pattern against its value is replaced with string. If pattern begins with /, all matches of pattern are replaced with string. Normally only the first match is replaced. If pattern begins with #, it must match at the beginning of the expanded value of parameter. If pattern begins with %, it must match at the end of the expanded value of parameter. If string is null, matches of pattern are deleted and the / following pattern may be omitted. If the nocasematch shell option is enabled, the match is performed without regard to the case of alphabetic characters. If parameter is @ or *, the substitution operation is applied to each positional parameter in turn, and the expansion is the resultant list. If parameter is an array variable subscripted with @ or *, the substitution operation is applied to each member of the array in turn, and the expansion is the resultant list.
${parameter^pattern}
${parameter^^pattern}
${parameter,pattern}
${parameter,,pattern}
Case modification. This expansion modifies the case of alphabetic characters in parameter. The pattern is expanded to produce a pattern just as in pathname expansion. Each character in the expanded value of parameter is tested against pattern, and, if it matches the pattern, its case is converted. The pattern should not attempt to match more than one character. The ^ operator converts lowercase letters matching pattern to uppercase; the , operator converts matching uppercase letters to lowercase. The ^^ and ,, expansions convert each matched character in the expanded value; the ^ and , expansions match and convert only the first character in the expanded value. If pattern is omitted, it is treated like a ?, which matches every character. If parameter is @ or *, the case modification operation is applied to each positional parameter in turn, and the expansion is the resultant list. If parameter is an array variable subscripted with @ or *, the case modification operation is applied to each member of the array in turn, and the expansion is the resultant list.
${parameter@operator}
Parameter transformation. The expansion is either a transformation of the value of parameter or information about parameter itself, depending on the value of operator. Each operator is a single letter:

Q
The expansion is a string that is the value of parameter quoted in a format that can be reused as input.
E
The expansion is a string that is the value of parameter with backslash escape sequences expanded as with the $'...' quoting mechansim.
P
The expansion is a string that is the result of expanding the value of parameter as if it were a prompt string (see PROMPTING below).
A
The expansion is a string in the form of an assignment statement or declare command that, if evaluated, will recreate parameter with its attributes and value.
a
The expansion is a string consisting of flag values representing parameter's attributes.

If parameter is @ or *, the operation is applied to each positional parameter in turn, and the expansion is the resultant list. If parameter is an array variable subscripted with @ or *, the case modification operation is applied to each member of the array in turn, and the expansion is the resultant list.

The result of the expansion is subject to word splitting and pathname expansion as described below.

 

Command Substitution

Command substitution allows the output of a command to replace the command name. There are two forms:

$(command)

or
`command`

Bash performs the expansion by executing command in a subshell environment and replacing the command substitution with the standard output of the command, with any trailing newlines deleted. Embedded newlines are not deleted, but they may be removed during word splitting. The command substitution $(cat file) can be replaced by the equivalent but faster $(< file).

When the old-style backquote form of substitution is used, backslash retains its literal meaning except when followed by $, `, or \. The first backquote not preceded by a backslash terminates the command substitution. When using the $(command) form, all characters between the parentheses make up the command; none are treated specially.

Command substitutions may be nested. To nest when using the backquoted form, escape the inner backquotes with backslashes.

If the substitution appears within double quotes, word splitting and pathname expansion are not performed on the results.  

Arithmetic Expansion

Arithmetic expansion allows the evaluation of an arithmetic expression and the substitution of the result. The format for arithmetic expansion is:

$((expression))

The expression is treated as if it were within double quotes, but a double quote inside the parentheses is not treated specially. All tokens in the expression undergo parameter and variable expansion, command substitution, and quote removal. The result is treated as the arithmetic expression to be evaluated. Arithmetic expansions may be nested.

The evaluation is performed according to the rules listed below under ARITHMETIC EVALUATION. If expression is invalid, bash prints a message indicating failure and no substitution occurs.  

Process Substitution

Process substitution allows a process's input or output to be referred to using a filename. It takes the form of <(list) or >(list). The process list is run asynchronously, and its input or output appears as a filename. This filename is passed as an argument to the current command as the result of the expansion. If the >(list) form is used, writing to the file will provide input for list. If the <(list) form is used, the file passed as an argument should be read to obtain the output of list. Process substitution is supported on systems that support named pipes (FIFOs) or the /dev/fd method of naming open files.

When available, process substitution is performed simultaneously with parameter and variable expansion, command substitution, and arithmetic expansion.  

Word Splitting

The shell scans the results of parameter expansion, command substitution, and arithmetic expansion that did not occur within double quotes for word splitting.

The shell treats each character of IFS as a delimiter, and splits the results of the other expansions into words using these characters as field terminators. If IFS is unset, or its value is exactly <space><tab><newline>, the default, then sequences of <space>, <tab>, and <newline> at the beginning and end of the results of the previous expansions are ignored, and any sequence of IFS characters not at the beginning or end serves to delimit words. If IFS has a value other than the default, then sequences of the whitespace characters space, tab, and newline are ignored at the beginning and end of the word, as long as the whitespace character is in the value of IFS (an IFS whitespace character). Any character in IFS that is not IFS whitespace, along with any adjacent IFS whitespace characters, delimits a field. A sequence of IFS whitespace characters is also treated as a delimiter. If the value of IFS is null, no word splitting occurs.

Explicit null arguments ("" or aqaq) are retained and passed to commands as empty strings. Unquoted implicit null arguments, resulting from the expansion of parameters that have no values, are removed. If a parameter with no value is expanded within double quotes, a null argument results and is retained and passed to a command as an empty string. When a quoted null argument appears as part of a word whose expansion is non-null, the null argument is removed. That is, the word -daqaq becomes -d after word splitting and null argument removal.

Note that if no expansion occurs, no splitting is performed.  

Pathname Expansion

After word splitting, unless the -f option has been set, bash scans each word for the characters *, ?, and [. If one of these characters appears, then the word is regarded as a pattern, and replaced with an alphabetically sorted list of filenames matching the pattern (see Pattern Matching below). If no matching filenames are found, and the shell option nullglob is not enabled, the word is left unchanged. If the nullglob option is set, and no matches are found, the word is removed. If the failglob shell option is set, and no matches are found, an error message is printed and the command is not executed. If the shell option nocaseglob is enabled, the match is performed without regard to the case of alphabetic characters. When a pattern is used for pathname expansion, the character ``.'' at the start of a name or immediately following a slash must be matched explicitly, unless the shell option dotglob is set. When matching a pathname, the slash character must always be matched explicitly. In other cases, the ``.'' character is not treated specially. See the description of shopt below under SHELL BUILTIN COMMANDS for a description of the nocaseglob, nullglob, failglob, and dotglob shell options.

The GLOBIGNORE shell variable may be used to restrict the set of filenames matching a pattern. If GLOBIGNORE is set, each matching filename that also matches one of the patterns in GLOBIGNORE is removed from the list of matches. If the nocaseglob option is set, the matching against the patterns in GLOBIGNORE is performed without regard to case. The filenames ``.'' and ``..'' are always ignored when GLOBIGNORE is set and not null. However, setting GLOBIGNORE to a non-null value has the effect of enabling the dotglob shell option, so all other filenames beginning with a ``.'' will match. To get the old behavior of ignoring filenames beginning with a ``.'', make ``.*'' one of the patterns in GLOBIGNORE. The dotglob option is disabled when GLOBIGNORE is unset. The pattern matching honors the setting of the extglob shell option.

Pattern Matching

Any character that appears in a pattern, other than the special pattern characters described below, matches itself. The NUL character may not occur in a pattern. A backslash escapes the following character; the escaping backslash is discarded when matching. The special pattern characters must be quoted if they are to be matched literally.

The special pattern characters have the following meanings:

*
Matches any string, including the null string. When the globstar shell option is enabled, and * is used in a pathname expansion context, two adjacent *s used as a single pattern will match all files and zero or more directories and subdirectories. If followed by a /, two adjacent *s will match only directories and subdirectories.
?
Matches any single character.
[...]
Matches any one of the enclosed characters. A pair of characters separated by a hyphen denotes a range expression; any character that falls between those two characters, inclusive, using the current locale's collating sequence and character set, is matched. If the first character following the [ is a ! or a ^ then any character not enclosed is matched. The sorting order of characters in range expressions is determined by the current locale and the values of the LC_COLLATE or LC_ALL shell variables, if set. To obtain the traditional interpretation of range expressions, where [a-d] is equivalent to [abcd], set value of the LC_ALL shell variable to C, or enable the globasciiranges shell option. A - may be matched by including it as the first or last character in the set. A ] may be matched by including it as the first character in the set.

Within [ and ], character classes can be specified using the syntax [:class:], where class is one of the following classes defined in the POSIX standard:

alnum alpha ascii blank cntrl digit graph lower print punct space upper word xdigit
A character class matches any character belonging to that class. The word character class matches letters, digits, and the character _.

Within [ and ], an equivalence class can be specified using the syntax [=c=], which matches all characters with the same collation weight (as defined by the current locale) as the character c.

Within [ and ], the syntax [.symbol.] matches the collating symbol symbol.

If the extglob shell option is enabled using the shopt builtin, several extended pattern matching operators are recognized. In the following description, a pattern-list is a list of one or more patterns separated by a |. Composite patterns may be formed using one or more of the following sub-patterns:

?(pattern-list)
Matches zero or one occurrence of the given patterns
*(pattern-list)
Matches zero or more occurrences of the given patterns
+(pattern-list)
Matches one or more occurrences of the given patterns
@(pattern-list)
Matches one of the given patterns
!(pattern-list)
Matches anything except one of the given patterns
 

Quote Removal

After the preceding expansions, all unquoted occurrences of the characters \, aq, and " that did not result from one of the above expansions are removed.  

REDIRECTION

Before a command is executed, its input and output may be redirected using a special notation interpreted by the shell. Redirection allows commands' file handles to be duplicated, opened, closed, made to refer to different files, and can change the files the command reads from and writes to. Redirection may also be used to modify file handles in the current shell execution environment. The following redirection operators may precede or appear anywhere within a simple command or may follow a command. Redirections are processed in the order they appear, from left to right.

Each redirection that may be preceded by a file descriptor number may instead be preceded by a word of the form {varname}. In this case, for each redirection operator except >&- and <&-, the shell will allocate a file descriptor greater than or equal to 10 and assign it to varname. If >&- or <&- is preceded by {varname}, the value of varname defines the file descriptor to close.

In the following descriptions, if the file descriptor number is omitted, and the first character of the redirection operator is <, the redirection refers to the standard input (file descriptor 0). If the first character of the redirection operator is >, the redirection refers to the standard output (file descriptor 1).

The word following the redirection operator in the following descriptions, unless otherwise noted, is subjected to brace expansion, tilde expansion, parameter and variable expansion, command substitution, arithmetic expansion, quote removal, pathname expansion, and word splitting. If it expands to more than one word, bash reports an error.

Note that the order of redirections is significant. For example, the command

ls > dirlist 2>&1

directs both standard output and standard error to the file dirlist, while the command

ls 2>&1 > dirlist

directs only the standard output to file dirlist, because the standard error was duplicated from the standard output before the standard output was redirected to dirlist.

Bash handles several filenames specially when they are used in redirections, as described in the following table. If the operating system on which bash is running provides these special files, bash will use them; otherwise it will emulate them internally with the behavior described below.

/dev/fd/fd
If fd is a valid integer, file descriptor fd is duplicated.
/dev/stdin
File descriptor 0 is duplicated.
/dev/stdout
File descriptor 1 is duplicated.
/dev/stderr
File descriptor 2 is duplicated.
/dev/tcp/host/port
If host is a valid hostname or Internet address, and port is an integer port number or service name, bash attempts to open the corresponding TCP socket.
/dev/udp/host/port
If host is a valid hostname or Internet address, and port is an integer port number or service name, bash attempts to open the corresponding UDP socket.

A failure to open or create a file causes the redirection to fail.

Redirections using file descriptors greater than 9 should be used with care, as they may conflict with file descriptors the shell uses internally.  

Redirecting Input

Redirection of input causes the file whose name results from the expansion of word to be opened for reading on file descriptor n, or the standard input (file descriptor 0) if n is not specified.

The general format for redirecting input is:

[n]<word

 

Redirecting Output

Redirection of output causes the file whose name results from the expansion of word to be opened for writing on file descriptor n, or the standard output (file descriptor 1) if n is not specified. If the file does not exist it is created; if it does exist it is truncated to zero size.

The general format for redirecting output is:

[n]>word

If the redirection operator is >, and the noclobber option to the set builtin has been enabled, the redirection will fail if the file whose name results from the expansion of word exists and is a regular file. If the redirection operator is >|, or the redirection operator is > and the noclobber option to the set builtin command is not enabled, the redirection is attempted even if the file named by word exists.  

Appending Redirected Output

Redirection of output in this fashion causes the file whose name results from the expansion of word to be opened for appending on file descriptor n, or the standard output (file descriptor 1) if n is not specified. If the file does not exist it is created.

The general format for appending output is:

[n]>>word

 

Redirecting Standard Output and Standard Error

This construct allows both the standard output (file descriptor 1) and the standard error output (file descriptor 2) to be redirected to the file whose name is the expansion of word.

There are two formats for redirecting standard output and standard error:

&>word

and
>&word

Of the two forms, the first is preferred. This is semantically equivalent to

>word 2>&1

When using the second form, word may not expand to a number or -. If it does, other redirection operators apply (see Duplicating File Descriptors below) for compatibility reasons.  

Appending Standard Output and Standard Error

This construct allows both the standard output (file descriptor 1) and the standard error output (file descriptor 2) to be appended to the file whose name is the expansion of word.

The format for appending standard output and standard error is:

&>>word

This is semantically equivalent to

>>word 2>&1

(see Duplicating File Descriptors below).  

Here Documents

This type of redirection instructs the shell to read input from the current source until a line containing only delimiter (with no trailing blanks) is seen. All of the lines read up to that point are then used as the standard input (or file descriptor n if n is specified) for a command.

The format of here-documents is:

[n]<<[-]word
        here-document
delimiter

No parameter and variable expansion, command substitution, arithmetic expansion, or pathname expansion is performed on word. If any part of word is quoted, the delimiter is the result of quote removal on word, and the lines in the here-document are not expanded. If word is unquoted, all lines of the here-document are subjected to parameter expansion, command substitution, and arithmetic expansion, the character sequence \<newline> is ignored, and \ must be used to quote the characters \, $, and `.

If the redirection operator is <<-, then all leading tab characters are stripped from input lines and the line containing delimiter. This allows here-documents within shell scripts to be indented in a natural fashion.  

Here Strings

A variant of here documents, the format is:

[n]<<<word

The word undergoes brace expansion, tilde expansion, parameter and variable expansion, command substitution, arithmetic expansion, and quote removal. Pathname expansion and word splitting are not performed. The result is supplied as a single string, with a newline appended, to the command on its standard input (or file descriptor n if n is specified).  

Duplicating File Descriptors

The redirection operator

[n]<&word

is used to duplicate input file descriptors. If word expands to one or more digits, the file descriptor denoted by n is made to be a copy of that file descriptor. If the digits in word do not specify a file descriptor open for input, a redirection error occurs. If word evaluates to -, file descriptor n is closed. If n is not specified, the standard input (file descriptor 0) is used.

The operator

[n]>&word

is used similarly to duplicate output file descriptors. If n is not specified, the standard output (file descriptor 1) is used. If the digits in word do not specify a file descriptor open for output, a redirection error occurs. If word evaluates to -, file descriptor n is closed. As a special case, if n is omitted, and word does not expand to one or more digits or -, the standard output and standard error are redirected as described previously.  

Moving File Descriptors

The redirection operator

[n]<&digit-

moves the file descriptor digit to file descriptor n, or the standard input (file descriptor 0) if n is not specified. digit is closed after being duplicated to n.

Similarly, the redirection operator

[n]>&digit-

moves the file descriptor digit to file descriptor n, or the standard output (file descriptor 1) if n is not specified.  

Opening File Descriptors for Reading and Writing

The redirection operator

[n]<>word

causes the file whose name is the expansion of word to be opened for both reading and writing on file descriptor n, or on file descriptor 0 if n is not specified. If the file does not exist, it is created.  

ALIASES

Aliases allow a string to be substituted for a word when it is used as the first word of a simple command. The shell maintains a list of aliases that may be set and unset with the alias and unalias builtin commands (see SHELL BUILTIN COMMANDS below). The first word of each simple command, if unquoted, is checked to see if it has an alias. If so, that word is replaced by the text of the alias. The characters /, $, `, and = and any of the shell metacharacters or quoting characters listed above may not appear in an alias name. The replacement text may contain any valid shell input, including shell metacharacters. The first word of the replacement text is tested for aliases, but a word that is identical to an alias being expanded is not expanded a second time. This means that one may alias ls to ls -F, for instance, and bash does not try to recursively expand the replacement text. If the last character of the alias value is a blank, then the next command word following the alias is also checked for alias expansion.

Aliases are created and listed with the alias command, and removed with the unalias command.

There is no mechanism for using arguments in the replacement text. If arguments are needed, a shell function should be used (see FUNCTIONS below).

Aliases are not expanded when the shell is not interactive, unless the expand_aliases shell option is set using shopt (see the description of shopt under SHELL BUILTIN COMMANDS below).

The rules concerning the definition and use of aliases are somewhat confusing. Bash always reads at least one complete line of input before executing any of the commands on that line. Aliases are expanded when a command is read, not when it is executed. Therefore, an alias definition appearing on the same line as another command does not take effect until the next line of input is read. The commands following the alias definition on that line are not affected by the new alias. This behavior is also an issue when functions are executed. Aliases are expanded when a function definition is read, not when the function is executed, because a function definition is itself a command. As a consequence, aliases defined in a function are not available until after that function is executed. To be safe, always put alias definitions on a separate line, and do not use alias in compound commands.

For almost every purpose, aliases are superseded by shell functions.  

FUNCTIONS

A shell function, defined as described above under SHELL GRAMMAR, stores a series of commands for later execution. When the name of a shell function is used as a simple command name, the list of commands associated with that function name is executed. Functions are executed in the context of the current shell; no new process is created to interpret them (contrast this with the execution of a shell script). When a function is executed, the arguments to the function become the positional parameters during its execution. The special parameter # is updated to reflect the change. Special parameter 0 is unchanged. The first element of the FUNCNAME variable is set to the name of the function while the function is executing.

All other aspects of the shell execution environment are identical between a function and its caller with these exceptions: the DEBUG and RETURN traps (see the description of the trap builtin under SHELL BUILTIN COMMANDS below) are not inherited unless the function has been given the trace attribute (see the description of the declare builtin below) or the -o functrace shell option has been enabled with the set builtin (in which case all functions inherit the DEBUG and RETURN traps), and the ERR trap is not inherited unless the -o errtrace shell option has been enabled.

Variables local to the function may be declared with the local builtin command. Ordinarily, variables and their values are shared between the function and its caller.

The FUNCNEST variable, if set to a numeric value greater than 0, defines a maximum function nesting level. Function invocations that exceed the limit cause the entire command to abort.

If the builtin command return is executed in a function, the function completes and execution resumes with the next command after the function call. Any command associated with the RETURN trap is executed before execution resumes. When a function completes, the values of the positional parameters and the special parameter # are restored to the values they had prior to the function's execution.

Function names and definitions may be listed with the -f option to the declare or typeset builtin commands. The -F option to declare or typeset will list the function names only (and optionally the source file and line number, if the extdebug shell option is enabled). Functions may be exported so that subshells automatically have them defined with the -f option to the export builtin. A function definition may be deleted using the -f option to the unset builtin. Note that shell functions and variables with the same name may result in multiple identically-named entries in the environment passed to the shell's children. Care should be taken in cases where this may cause a problem.

Functions may be recursive. The FUNCNEST variable may be used to limit the depth of the function call stack and restrict the number of function invocations. By default, no limit is imposed on the number of recursive calls.  

ARITHMETIC EVALUATION

The shell allows arithmetic expressions to be evaluated, under certain circumstances (see the let and declare builtin commands, the (( compound command, and Arithmetic Expansion). Evaluation is done in fixed-width integers with no check for overflow, though division by 0 is trapped and flagged as an error. The operators and their precedence, associativity, and values are the same as in the C language. The following list of operators is grouped into levels of equal-precedence operators. The levels are listed in order of decreasing precedence.

id++ id--
variable post-increment and post-decrement
++id --id
variable pre-increment and pre-decrement
- +
unary minus and plus
! ~
logical and bitwise negation
**
exponentiation
* / %
multiplication, division, remainder
+ -
addition, subtraction
<< >>
left and right bitwise shifts
<= >= < >
comparison
== !=
equality and inequality
&
bitwise AND
^
bitwise exclusive OR
|
bitwise OR
&&
logical AND
||
logical OR
expr?expr:expr
conditional operator
= *= /= %= += -= <<= >>= &= ^= |=
assignment
expr1 , expr2
comma

Shell variables are allowed as operands; parameter expansion is performed before the expression is evaluated. Within an expression, shell variables may also be referenced by name without using the parameter expansion syntax. A shell variable that is null or unset evaluates to 0 when referenced by name without using the parameter expansion syntax. The value of a variable is evaluated as an arithmetic expression when it is referenced, or when a variable which has been given the integer attribute using declare -i is assigned a value. A null value evaluates to 0. A shell variable need not have its integer attribute turned on to be used in an expression.

Constants with a leading 0 are interpreted as octal numbers. A leading 0x or 0X denotes hexadecimal. Otherwise, numbers take the form [base#]n, where the optional base is a decimal number between 2 and 64 representing the arithmetic base, and n is a number in that base. If base# is omitted, then base 10 is used. When specifying n, the digits greater than 9 are represented by the lowercase letters, the uppercase letters, @, and _, in that order. If base is less than or equal to 36, lowercase and uppercase letters may be used interchangeably to represent numbers between 10 and 35.

Operators are evaluated in order of precedence. Sub-expressions in parentheses are evaluated first and may override the precedence rules above.  

CONDITIONAL EXPRESSIONS

Conditional expressions are used by the [[ compound command and the test and [ builtin commands to test file attributes and perform string and arithmetic comparisons. Expressions are formed from the following unary or binary primaries. Bash handles several filenames specially when they are used in expressions. If the operating system on which bash is running provides these special files, bash will use them; otherwise it will emulate them internally with this behavior: If any file argument to one of the primaries is of the form /dev/fd/n, then file descriptor n is checked. If the file argument to one of the primaries is one of /dev/stdin, /dev/stdout, or /dev/stderr, file descriptor 0, 1, or 2, respectively, is checked.

Unless otherwise specified, primaries that operate on files follow symbolic links and operate on the target of the link, rather than the link itself.

When used with [[, the < and > operators sort lexicographically using the current locale. The test command sorts using ASCII ordering.

-a file
True if file exists.
-b file
True if file exists and is a block special file.
-c file
True if file exists and is a character special file.
-d file
True if file exists and is a directory.
-e file
True if file exists.
-f file
True if file exists and is a regular file.
-g file
True if file exists and is set-group-id.
-h file
True if file exists and is a symbolic link.
-k file
True if file exists and its ``sticky'' bit is set.
-p file
True if file exists and is a named pipe (FIFO).
-r file
True if file exists and is readable.
-s file
True if file exists and has a size greater than zero.
-t fd
True if file descriptor fd is open and refers to a terminal.
-u file
True if file exists and its set-user-id bit is set.
-w file
True if file exists and is writable.
-x file
True if file exists and is executable.
-G file
True if file exists and is owned by the effective group id.
-L file
True if file exists and is a symbolic link.
-N file
True if file exists and has been modified since it was last read.
-O file
True if file exists and is owned by the effective user id.
-S file
True if file exists and is a socket.
file1 -ef file2
True if file1 and file2 refer to the same device and inode numbers.
file1 -nt file2
True if file1 is newer (according to modification date) than file2, or if file1 exists and file2 does not.
file1 -ot file2
True if file1 is older than file2, or if file2 exists and file1 does not.
-o optname
True if the shell option optname is enabled. See the list of options under the description of the -o option to the set builtin below.
-v varname
True if the shell variable varname is set (has been assigned a value).
-R varname
True if the shell variable varname is set and is a name reference.
-z string
True if the length of string is zero.
string
-n string
True if the length of string is non-zero.
string1 == string2
string1 = string2
True if the strings are equal. = should be used with the test command for POSIX conformance. When used with the [[ command, this performs pattern matching as described above (Compound Commands).
string1 != string2
True if the strings are not equal.
string1 < string2
True if string1 sorts before string2 lexicographically.
string1 > string2
True if string1 sorts after string2 lexicographically.
arg1 OP arg2
OP is one of -eq, -ne, -lt, -le, -gt, or -ge. These arithmetic binary operators return true if arg1 is equal to, not equal to, less than, less than or equal to, greater than, or greater than or equal to arg2, respectively. Arg1 and arg2 may be positive or negative integers.
 

SIMPLE COMMAND EXPANSION

When a simple command is executed, the shell performs the following expansions, assignments, and redirections, from left to right.
1.
The words that the parser has marked as variable assignments (those preceding the command name) and redirections are saved for later processing.
2.
The words that are not variable assignments or redirections are expanded. If any words remain after expansion, the first word is taken to be the name of the command and the remaining words are the arguments.
3.
Redirections are performed as described above under REDIRECTION.
4.
The text after the = in each variable assignment undergoes tilde expansion, parameter expansion, command substitution, arithmetic expansion, and quote removal before being assigned to the variable.

If no command name results, the variable assignments affect the current shell environment. Otherwise, the variables are added to the environment of the executed command and do not affect the current shell environment. If any of the assignments attempts to assign a value to a readonly variable, an error occurs, and the command exits with a non-zero status.

If no command name results, redirections are performed, but do not affect the current shell environment. A redirection error causes the command to exit with a non-zero status.

If there is a command name left after expansion, execution proceeds as described below. Otherwise, the command exits. If one of the expansions contained a command substitution, the exit status of the command is the exit status of the last command substitution performed. If there were no command substitutions, the command exits with a status of zero.  

COMMAND EXECUTION

After a command has been split into words, if it results in a simple command and an optional list of arguments, the following actions are taken.

If the command name contains no slashes, the shell attempts to locate it. If there exists a shell function by that name, that function is invoked as described above in FUNCTIONS. If the name does not match a function, the shell searches for it in the list of shell builtins. If a match is found, that builtin is invoked.

If the name is neither a shell function nor a builtin, and contains no slashes, bash searches each element of the PATH for a directory containing an executable file by that name. Bash uses a hash table to remember the full pathnames of executable files (see hash under SHELL BUILTIN COMMANDS below). A full search of the directories in PATH is performed only if the command is not found in the hash table. If the search is unsuccessful, the shell searches for a defined shell function named command_not_found_handle. If that function exists, it is invoked with the original command and the original command's arguments as its arguments, and the function's exit status becomes the exit status of the shell. If that function is not defined, the shell prints an error message and returns an exit status of 127.

If the search is successful, or if the command name contains one or more slashes, the shell executes the named program in a separate execution environment. Argument 0 is set to the name given, and the remaining arguments to the command are set to the arguments given, if any.

If this execution fails because the file is not in executable format, and the file is not a directory, it is assumed to be a shell script, a file containing shell commands. A subshell is spawned to execute it. This subshell reinitializes itself, so that the effect is as if a new shell had been invoked to handle the script, with the exception that the locations of commands remembered by the parent (see hash below under SHELL BUILTIN COMMANDS) are retained by the child.

If the program is a file beginning with #!, the remainder of the first line specifies an interpreter for the program. The shell executes the specified interpreter on operating systems that do not handle this executable format themselves. The arguments to the interpreter consist of a single optional argument following the interpreter name on the first line of the program, followed by the name of the program, followed by the command arguments, if any.  

COMMAND EXECUTION ENVIRONMENT

The shell has an execution environment, which consists of the following:
*
open files inherited by the shell at invocation, as modified by redirections supplied to the exec builtin
*
the current working directory as set by cd, pushd, or popd, or inherited by the shell at invocation
*
the file creation mode mask as set by umask or inherited from the shell's parent
*
current traps set by trap
*
shell parameters that are set by variable assignment or with set or inherited from the shell's parent in the environment
*
shell functions defined during execution or inherited from the shell's parent in the environment
*
options enabled at invocation (either by default or with command-line arguments) or by set
*
options enabled by shopt
*
shell aliases defined with alias
*
various process IDs, including those of background jobs, the value of $$, and the value of PPID

When a simple command other than a builtin or shell function is to be executed, it is invoked in a separate execution environment that consists of the following. Unless otherwise noted, the values are inherited from the shell.

*
the shell's open files, plus any modifications and additions specified by redirections to the command
*
the current working directory
*
the file creation mode mask
*
shell variables and functions marked for export, along with variables exported for the command, passed in the environment
*
traps caught by the shell are reset to the values inherited from the shell's parent, and traps ignored by the shell are ignored

A command invoked in this separate environment cannot affect the shell's execution environment.

Command substitution, commands grouped with parentheses, and asynchronous commands are invoked in a subshell environment that is a duplicate of the shell environment, except that traps caught by the shell are reset to the values that the shell inherited from its parent at invocation. Builtin commands that are invoked as part of a pipeline are also executed in a subshell environment. Changes made to the subshell environment cannot affect the shell's execution environment.

Subshells spawned to execute command substitutions inherit the value of the -e option from the parent shell. When not in posix mode, bash clears the -e option in such subshells.

If a command is followed by a & and job control is not active, the default standard input for the command is the empty file /dev/null. Otherwise, the invoked command inherits the file descriptors of the calling shell as modified by redirections.  

ENVIRONMENT

When a program is invoked it is given an array of strings called the environment. This is a list of name-value pairs, of the form name=value.

The shell provides several ways to manipulate the environment. On invocation, the shell scans its own environment and creates a parameter for each name found, automatically marking it for export to child processes. Executed commands inherit the environment. The export and declare -x commands allow parameters and functions to be added to and deleted from the environment. If the value of a parameter in the environment is modified, the new value becomes part of the environment, replacing the old. The environment inherited by any executed command consists of the shell's initial environment, whose values may be modified in the shell, less any pairs removed by the unset command, plus any additions via the export and declare -x commands.

The environment for any simple command or function may be augmented temporarily by prefixing it with parameter assignments, as described above in PARAMETERS. These assignment statements affect only the environment seen by that command.

If the -k option is set (see the set builtin command below), then all parameter assignments are placed in the environment for a command, not just those that precede the command name.

When bash invokes an external command, the variable _ is set to the full filename of the command and passed to that command in its environment.  

EXIT STATUS

The exit status of an executed command is the value returned by the waitpid system call or equivalent function. Exit statuses fall between 0 and 255, though, as explained below, the shell may use values above 125 specially. Exit statuses from shell builtins and compound commands are also limited to this range. Under certain circumstances, the shell will use special values to indicate specific failure modes.

For the shell's purposes, a command which exits with a zero exit status has succeeded. An exit status of zero indicates success. A non-zero exit status indicates failure. When a command terminates on a fatal signal N, bash uses the value of 128+N as the exit status.

If a command is not found, the child process created to execute it returns a status of 127. If a command is found but is not executable, the return status is 126.

If a command fails because of an error during expansion or redirection, the exit status is greater than zero.

Shell builtin commands return a status of 0 (true) if successful, and non-zero (false) if an error occurs while they execute. All builtins return an exit status of 2 to indicate incorrect usage, generally invalid options or missing arguments.

Bash itself returns the exit status of the last command executed, unless a syntax error occurs, in which case it exits with a non-zero value. See also the exit builtin command below.  

SIGNALS

When bash is interactive, in the absence of any traps, it ignores SIGTERM (so that kill 0 does not kill an interactive shell), and SIGINT is caught and handled (so that the wait builtin is interruptible). In all cases, bash ignores SIGQUIT. If job control is in effect, bash ignores SIGTTIN, SIGTTOU, and SIGTSTP.

Non-builtin commands run by bash have signal handlers set to the values inherited by the shell from its parent. When job control is not in effect, asynchronous commands ignore SIGINT and SIGQUIT in addition to these inherited handlers. Commands run as a result of command substitution ignore the keyboard-generated job control signals SIGTTIN, SIGTTOU, and SIGTSTP.

The shell exits by default upon receipt of a SIGHUP. Before exiting, an interactive shell resends the SIGHUP to all jobs, running or stopped. Stopped jobs are sent SIGCONT to ensure that they receive the SIGHUP. To prevent the shell from sending the signal to a particular job, it should be removed from the jobs table with the disown builtin (see SHELL BUILTIN COMMANDS below) or marked to not receive SIGHUP using disown -h.

If the huponexit shell option has been set with shopt, bash sends a SIGHUP to all jobs when an interactive login shell exits.

If bash is waiting for a command to complete and receives a signal for which a trap has been set, the trap will not be executed until the command completes. When bash is waiting for an asynchronous command via the wait builtin, the reception of a signal for which a trap has been set will cause the wait builtin to return immediately with an exit status greater than 128, immediately after which the trap is executed.  

JOB CONTROL

Job control refers to the ability to selectively stop (suspend) the execution of processes and continue (resume) their execution at a later point. A user typically employs this facility via an interactive interface supplied jointly by the operating system kernel's terminal driver and bash.

The shell associates a job with each pipeline. It keeps a table of currently executing jobs, which may be listed with the jobs command. When bash starts a job asynchronously (in the background), it prints a line that looks like:

[1] 25647

indicating that this job is job number 1 and that the process ID of the last process in the pipeline associated with this job is 25647. All of the processes in a single pipeline are members of the same job. Bash uses the job abstraction as the basis for job control.

To facilitate the implementation of the user interface to job control, the operating system maintains the notion of a current terminal process group ID. Members of this process group (processes whose process group ID is equal to the current terminal process group ID) receive keyboard-generated signals such as SIGINT. These processes are said to be in the foreground. Background processes are those whose process group ID differs from the terminal's; such processes are immune to keyboard-generated signals. Only foreground processes are allowed to read from or, if the user so specifies with stty tostop, write to the terminal. Background processes which attempt to read from (write to when stty tostop is in effect) the terminal are sent a SIGTTIN (SIGTTOU) signal by the kernel's terminal driver, which, unless caught, suspends the process.

If the operating system on which bash is running supports job control, bash contains facilities to use it. Typing the suspend character (typically ^Z, Control-Z) while a process is running causes that process to be stopped and returns control to bash. Typing the delayed suspend character (typically ^Y, Control-Y) causes the process to be stopped when it attempts to read input from the terminal, and control to be returned to bash. The user may then manipulate the state of this job, using the bg command to continue it in the background, the fg command to continue it in the foreground, or the kill command to kill it. A ^Z takes effect immediately, and has the additional side effect of causing pending output and typeahead to be discarded.

There are a number of ways to refer to a job in the shell. The character % introduces a job specification (jobspec). Job number n may be referred to as %n. A job may also be referred to using a prefix of the name used to start it, or using a substring that appears in its command line. For example, %ce refers to a stopped ce job. If a prefix matches more than one job, bash reports an error. Using %?ce, on the other hand, refers to any job containing the string ce in its command line. If the substring matches more than one job, bash reports an error. The symbols %% and %+ refer to the shell's notion of the current job, which is the last job stopped while it was in the foreground or started in the background. The previous job may be referenced using %-. If there is only a single job, %+ and %- can both be used to refer to that job. In output pertaining to jobs (e.g., the output of the jobs command), the current job is always flagged with a +, and the previous job with a -. A single % (with no accompanying job specification) also refers to the current job.

Simply naming a job can be used to bring it into the foreground: %1 is a synonym for ``fg %1'', bringing job 1 from the background into the foreground. Similarly, ``%1 &'' resumes job 1 in the background, equivalent to ``bg %1''.

The shell learns immediately whenever a job changes state. Normally, bash waits until it is about to print a prompt before reporting changes in a job's status so as to not interrupt any other output. If the -b option to the set builtin command is enabled, bash reports such changes immediately. Any trap on SIGCHLD is executed for each child that exits.

If an attempt to exit bash is made while jobs are stopped (or, if the checkjobs shell option has been enabled using the shopt builtin, running), the shell prints a warning message, and, if the checkjobs option is enabled, lists the jobs and their statuses. The jobs command may then be used to inspect their status. If a second attempt to exit is made without an intervening command, the shell does not print another warning, and any stopped jobs are terminated.  

PROMPTING

When executing interactively, bash displays the primary prompt PS1 when it is ready to read a command, and the secondary prompt PS2 when it needs more input to complete a command. Bash displays PS0 after it reads a command but before executing it. Bash allows these prompt strings to be customized by inserting a number of backslash-escaped special characters that are decoded as follows:
\a
an ASCII bell character (07)
\d
the date in "Weekday Month Date" format (e.g., "Tue May 26")
\D{format}
the format is passed to strftime(3) and the result is inserted into the prompt string; an empty format results in a locale-specific time representation. The braces are required
\e
an ASCII escape character (033)
\h
the hostname up to the first `.'
\H
the hostname
\j
the number of jobs currently managed by the shell
\l
the basename of the shell's terminal device name
\n
newline
\r
carriage return
\s
the name of the shell, the basename of $0 (the portion following the final slash)
\t
the current time in 24-hour HH:MM:SS format
\T
the current time in 12-hour HH:MM:SS format
\@
the current time in 12-hour am/pm format
\A
the current time in 24-hour HH:MM format
\u
the username of the current user
\v
the version of bash (e.g., 2.00)
\V
the release of bash, version + patch level (e.g., 2.00.0)
\w
the current working directory, with $HOME abbreviated with a tilde (uses the value of the PROMPT_DIRTRIM variable)
\W
the basename of the current working directory, with $HOME abbreviated with a tilde
\!
the history number of this command
\#
the command number of this command
\$
if the effective UID is 0, a #, otherwise a $
\nnn
the character corresponding to the octal number nnn
\\
a backslash
\[
begin a sequence of non-printing characters, which could be used to embed a terminal control sequence into the prompt
\]
end a sequence of non-printing characters

The command number and the history number are usually different: the history number of a command is its position in the history list, which may include commands restored from the history file (see HISTORY below), while the command number is the position in the sequence of commands executed during the current shell session. After the string is decoded, it is expanded via parameter expansion, command substitution, arithmetic expansion, and quote removal, subject to the value of the promptvars shell option (see the description of the shopt command under SHELL BUILTIN COMMANDS below).  

READLINE

This is the library that handles reading input when using an interactive shell, unless the --noediting option is given at shell invocation. Line editing is also used when using the -e option to the read builtin. By default, the line editing commands are similar to those of Emacs. A vi-style line editing interface is also available. Line editing can be enabled at any time using the -o emacs or -o vi options to the set builtin (see SHELL BUILTIN COMMANDS below). To turn off line editing after the shell is running, use the +o emacs or +o vi options to the set builtin.  

Readline Notation

In this section, the Emacs-style notation is used to denote keystrokes. Control keys are denoted by C-key, e.g., C-n means Control-N. Similarly, meta keys are denoted by M-key, so M-x means Meta-X. (On keyboards without a meta key, M-x means ESC x, i.e., press the Escape key then the x key. This makes ESC the meta prefix. The combination M-C-x means ESC-Control-x, or press the Escape key then hold the Control key while pressing the x key.)

Readline commands may be given numeric arguments, which normally act as a repeat count. Sometimes, however, it is the sign of the argument that is significant. Passing a negative argument to a command that acts in the forward direction (e.g., kill-line) causes that command to act in a backward direction. Commands whose behavior with arguments deviates from this are noted below.

When a command is described as killing text, the text deleted is saved for possible future retrieval (yanking). The killed text is saved in a kill ring. Consecutive kills cause the text to be accumulated into one unit, which can be yanked all at once. Commands which do not kill text separate the chunks of text on the kill ring.  

Readline Initialization

Readline is customized by putting commands in an initialization file (the inputrc file). The name of this file is taken from the value of the INPUTRC variable. If that variable is unset, the default is ~/.inputrc. When a program which uses the readline library starts up, the initialization file is read, and the key bindings and variables are set. There are only a few basic constructs allowed in the readline initialization file. Blank lines are ignored. Lines beginning with a # are comments. Lines beginning with a $ indicate conditional constructs. Other lines denote key bindings and variable settings.

The default key-bindings may be changed with an inputrc file. Other programs that use this library may add their own commands and bindings.

For example, placing

M-Control-u: universal-argument

or
C-Meta-u: universal-argument
into the inputrc would make M-C-u execute the readline command universal-argument.

The following symbolic character names are recognized: RUBOUT, DEL, ESC, LFD, NEWLINE, RET, RETURN, SPC, SPACE, and TAB.

In addition to command names, readline allows keys to be bound to a string that is inserted when the key is pressed (a macro).  

Readline Key Bindings

The syntax for controlling key bindings in the inputrc file is simple. All that is required is the name of the command or the text of a macro and a key sequence to which it should be bound. The name may be specified in one of two ways: as a symbolic key name, possibly with Meta- or Control- prefixes, or as a key sequence.

When using the form keyname:function-name or macro, keyname is the name of a key spelled out in English. For example:

Control-u: universal-argument
Meta-Rubout: backward-kill-word
Control-o: "> output"

In the above example, C-u is bound to the function universal-argument, M-DEL is bound to the function backward-kill-word, and C-o is bound to run the macro expressed on the right hand side (that is, to insert the text > output into the line).

In the second form, "keyseq":function-name or macro, keyseq differs from keyname above in that strings denoting an entire key sequence may be specified by placing the sequence within double quotes. Some GNU Emacs style key escapes can be used, as in the following example, but the symbolic character names are not recognized.

"\C-u": universal-argument
"\C-x\C-r": re-read-init-file
"\e[11~": "Function Key 1"

In this example, C-u is again bound to the function universal-argument. C-x C-r is bound to the function re-read-init-file, and ESC [ 1 1 ~ is bound to insert the text Function Key 1.

The full set of GNU Emacs style escape sequences is

\C-
control prefix
\M-
meta prefix
\e
an escape character
\\
backslash
\
literal "
\aq
literal aq

In addition to the GNU Emacs style escape sequences, a second set of backslash escapes is available:

\a
alert (bell)
\b
backspace
\d
delete
\f
form feed
\n
newline
\r
carriage return
\t
horizontal tab
\v
vertical tab
\nnn
the eight-bit character whose value is the octal value nnn (one to three digits)
\xHH
the eight-bit character whose value is the hexadecimal value HH (one or two hex digits)

When entering the text of a macro, single or double quotes must be used to indicate a macro definition. Unquoted text is assumed to be a function name. In the macro body, the backslash escapes described above are expanded. Backslash will quote any other character in the macro text, including " and aq.

Bash allows the current readline key bindings to be displayed or modified with the bind builtin command. The editing mode may be switched during interactive use by using the -o option to the set builtin command (see SHELL BUILTIN COMMANDS below).  

Readline Variables

Readline has variables that can be used to further customize its behavior. A variable may be set in the inputrc file with a statement of the form

set variable-name value

Except where noted, readline variables can take the values On or Off (without regard to case). Unrecognized variable names are ignored. When a variable value is read, empty or null values, "on" (case-insensitive), and "1" are equivalent to On. All other values are equivalent to Off. The variables and their default values are:

bell-style (audible)
Controls what happens when readline wants to ring the terminal bell. If set to none, readline never rings the bell. If set to visible, readline uses a visible bell if one is available. If set to audible, readline attempts to ring the terminal's bell.
bind-tty-special-chars (On)
If set to On, readline attempts to bind the control characters treated specially by the kernel's terminal driver to their readline equivalents.
blink-matching-paren (Off)
If set to On, readline attempts to briefly move the cursor to an opening parenthesis when a closing parenthesis is inserted.
colored-completion-prefix (Off)
If set to On, when listing completions, readline displays the common prefix of the set of possible completions using a different color. The color definitions are taken from the value of the LS_COLORS environment variable.
colored-stats (Off)
If set to On, readline displays possible completions using different colors to indicate their file type. The color definitions are taken from the value of the LS_COLORS environment variable.
comment-begin (``#'')
The string that is inserted when the readline insert-comment command is executed. This command is bound to M-# in emacs mode and to # in vi command mode.
completion-display-width (-1)
The number of screen columns used to display possible matches when performing completion. The value is ignored if it is less than 0 or greater than the terminal screen width. A value of 0 will cause matches to be displayed one per line. The default value is -1.
completion-ignore-case (Off)
If set to On, readline performs filename matching and completion in a case-insensitive fashion.
completion-map-case (Off)
If set to On, and completion-ignore-case is enabled, readline treats hyphens (-) and underscores (_) as equivalent when performing case-insensitive filename matching and completion.
completion-prefix-display-length (0)
The length in characters of the common prefix of a list of possible completions that is displayed without modification. When set to a value greater than zero, common prefixes longer than this value are replaced with an ellipsis when displaying possible completions.
completion-query-items (100)
This determines when the user is queried about viewing the number of possible completions generated by the possible-completions command. It may be set to any integer value greater than or equal to zero. If the number of possible completions is greater than or equal to the value of this variable, the user is asked whether or not he wishes to view them; otherwise they are simply listed on the terminal.
convert-meta (On)
If set to On, readline will convert characters with the eighth bit set to an ASCII key sequence by stripping the eighth bit and prefixing an escape character (in effect, using escape as the meta prefix). The default is On, but readline will set it to Off if the locale contains eight-bit characters.
disable-completion (Off)
If set to On, readline will inhibit word completion. Completion characters will be inserted into the line as if they had been mapped to self-insert.
echo-control-characters (On)
When set to On, on operating systems that indicate they support it, readline echoes a character corresponding to a signal generated from the keyboard.
editing-mode (emacs)
Controls whether readline begins with a set of key bindings similar to Emacs or vi. editing-mode can be set to either emacs or vi.
enable-bracketed-paste (Off)
When set to On, readline will configure the terminal in a way that will enable it to insert each paste into the editing buffer as a single string of characters, instead of treating each character as if it had been read from the keyboard. This can prevent pasted characters from being interpreted as editing commands.
enable-keypad (Off)
When set to On, readline will try to enable the application keypad when it is called. Some systems need this to enable the arrow keys.
enable-meta-key (On)
When set to On, readline will try to enable any meta modifier key the terminal claims to support when it is called. On many terminals, the meta key is used to send eight-bit characters.
expand-tilde (Off)
If set to On, tilde expansion is performed when readline attempts word completion.
history-preserve-point (Off)
If set to On, the history code attempts to place point at the same location on each history line retrieved with previous-history or next-history.
history-size (unset)
Set the maximum number of history entries saved in the history list. If set to zero, any existing history entries are deleted and no new entries are saved. If set to a value less than zero, the number of history entries is not limited. By default, the number of history entries is set to the value of the HISTSIZE shell variable. If an attempt is made to set history-size to a non-numeric value, the maximum number of history entries will be set to 500.
horizontal-scroll-mode (Off)
When set to On, makes readline use a single line for display, scrolling the input horizontally on a single screen line when it becomes longer than the screen width rather than wrapping to a new line.
input-meta (Off)
If set to On, readline will enable eight-bit input (that is, it will not strip the eighth bit from the characters it reads), regardless of what the terminal claims it can support. The name meta-flag is a synonym for this variable. The default is Off, but readline will set it to On if the locale contains eight-bit characters.
isearch-terminators (``C-[C-J'')
The string of characters that should terminate an incremental search without subsequently executing the character as a command. If this variable has not been given a value, the characters ESC and C-J will terminate an incremental search.
keymap (emacs)
Set the current readline keymap. The set of valid keymap names is emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-command, and vi-insert. vi is equivalent to vi-command; emacs is equivalent to emacs-standard. The default value is emacs; the value of editing-mode also affects the default keymap.
emacs-mode-string (@)
This string is displayed immediately before the last line of the primary prompt when emacs editing mode is active. The value is expanded like a key binding, so the standard set of meta- and control prefixes and backslash escape sequences is available. Use the \1 and \2 escapes to begin and end sequences of non-printing characters, which can be used to embed a terminal control sequence into the mode string.
keyseq-timeout (500)
Specifies the duration readline will wait for a character when reading an ambiguous key sequence (one that can form a complete key sequence using the input read so far, or can take additional input to complete a longer key sequence). If no input is received within the timeout, readline will use the shorter but complete key sequence. The value is specified in milliseconds, so a value of 1000 means that readline will wait one second for additional input. If this variable is set to a value less than or equal to zero, or to a non-numeric value, readline will wait until another key is pressed to decide which key sequence to complete.
mark-directories (On)
If set to On, completed directory names have a slash appended.
mark-modified-lines (Off)
If set to On, history lines that have been modified are displayed with a preceding asterisk (*).
mark-symlinked-directories (Off)
If set to On, completed names which are symbolic links to directories have a slash appended (subject to the value of mark-directories).
match-hidden-files (On)
This variable, when set to On, causes readline to match files whose names begin with a `.' (hidden files) when performing filename completion. If set to Off, the leading `.' must be supplied by the user in the filename to be completed.
menu-complete-display-prefix (Off)
If set to On, menu completion displays the common prefix of the list of possible completions (which may be empty) before cycling through the list.
output-meta (Off)
If set to On, readline will display characters with the eighth bit set directly rather than as a meta-prefixed escape sequence. The default is Off, but readline will set it to On if the locale contains eight-bit characters.
page-completions (On)
If set to On, readline uses an internal more-like pager to display a screenful of possible completions at a time.
print-completions-horizontally (Off)
If set to On, readline will display completions with matches sorted horizontally in alphabetical order, rather than down the screen.
revert-all-at-newline (Off)
If set to On, readline will undo all changes to history lines before returning when accept-line is executed. By default, history lines may be modified and retain individual undo lists across calls to readline.
show-all-if-ambiguous (Off)
This alters the default behavior of the completion functions. If set to On, words which have more than one possible completion cause the matches to be listed immediately instead of ringing the bell.
show-all-if-unmodified (Off)
This alters the default behavior of the completion functions in a fashion similar to show-all-if-ambiguous. If set to On, words which have more than one possible completion without any possible partial completion (the possible completions don't share a common prefix) cause the matches to be listed immediately instead of ringing the bell.
show-mode-in-prompt (Off)
If set to On, add a character to the beginning of the prompt indicating the editing mode: emacs (@), vi command (:) or vi insertion (+).
skip-completed-text (Off)
If set to On, this alters the default completion behavior when inserting a single match into the line. It's only active when performing completion in the middle of a word. If enabled, readline does not insert characters from the completion that match characters after point in the word being completed, so portions of the word following the cursor are not duplicated.
vi-cmd-mode-string ((cmd))
This string is displayed immediately before the last line of the primary prompt when vi editing mode is active and in command mode. The value is expanded like a key binding, so the standard set of meta- and control prefixes and backslash escape sequences is available. Use the \1 and \2 escapes to begin and end sequences of non-printing characters, which can be used to embed a terminal control sequence into the mode string.
vi-ins-mode-string ((ins))
This string is displayed immediately before the last line of the primary prompt when vi editing mode is active and in insertion mode. The value is expanded like a key binding, so the standard set of meta- and control prefixes and backslash escape sequences is available. Use the \1 and \2 escapes to begin and end sequences of non-printing characters, which can be used to embed a terminal control sequence into the mode string.
visible-stats (Off)
If set to On, a character denoting a file's type as reported by stat(2) is appended to the filename when listing possible completions.
 

Readline Conditional Constructs

Readline implements a facility similar in spirit to the conditional compilation features of the C preprocessor which allows key bindings and variable settings to be performed as the result of tests. There are four parser directives used.

$if
The $if construct allows bindings to be made based on the editing mode, the terminal being used, or the application using readline. The text of the test extends to the end of the line; no characters are required to isolate it.
mode
The mode= form of the $if directive is used to test whether readline is in emacs or vi mode. This may be used in conjunction with the set keymap command, for instance, to set bindings in the emacs-standard and emacs-ctlx keymaps only if readline is starting out in emacs mode.
term
The term= form may be used to include terminal-specific key bindings, perhaps to bind the key sequences output by the terminal's function keys. The word on the right side of the = is tested against both the full name of the terminal and the portion of the terminal name before the first -. This allows sun to match both sun and sun-cmd, for instance.
application
The application construct is used to include application-specific settings. Each program using the readline library sets the application name, and an initialization file can test for a particular value. This could be used to bind key sequences to functions useful for a specific program. For instance, the following command adds a key sequence that quotes the current or previous word in bash:

$if Bash
# Quote the current or previous word
"\C-xq": "\eb\"\ef\""
$endif
$endif
This command, as seen in the previous example, terminates an $if command.
$else
Commands in this branch of the $if directive are executed if the test fails.
$include
This directive takes a single filename as an argument and reads commands and bindings from that file. For example, the following directive would read /etc/inputrc:

$include  /etc/inputrc
 

Searching

Readline provides commands for searching through the command history (see HISTORY below) for lines containing a specified string. There are two search modes: incremental and non-incremental.

Incremental searches begin before the user has finished typing the search string. As each character of the search string is typed, readline displays the next entry from the history matching the string typed so far. An incremental search requires only as many characters as needed to find the desired history entry. The characters present in the value of the isearch-terminators variable are used to terminate an incremental search. If that variable has not been assigned a value the Escape and Control-J characters will terminate an incremental search. Control-G will abort an incremental search and restore the original line. When the search is terminated, the history entry containing the search string becomes the current line.

To find other matching entries in the history list, type Control-S or Control-R as appropriate. This will search backward or forward in the history for the next entry matching the search string typed so far. Any other key sequence bound to a readline command will terminate the search and execute that command. For instance, a newline will terminate the search and accept the line, thereby executing the command from the history list.

Readline remembers the last incremental search string. If two Control-Rs are typed without any intervening characters defining a new search string, any remembered search string is used.

Non-incremental searches read the entire search string before starting to search for matching history lines. The search string may be typed by the user or be part of the contents of the current line.  

Readline Command Names

The following is a list of the names of the commands and the default key sequences to which they are bound. Command names without an accompanying key sequence are unbound by default. In the following descriptions, point refers to the current cursor position, and mark refers to a cursor position saved by the set-mark command. The text between the point and mark is referred to as the region.  

Commands for Moving

beginning-of-line (C-a)
Move to the start of the current line.
end-of-line (C-e)
Move to the end of the line.
forward-char (C-f)
Move forward a character.
backward-char (C-b)
Move back a character.
forward-word (M-f)
Move forward to the end of the next word. Words are composed of alphanumeric characters (letters and digits).
backward-word (M-b)
Move back to the start of the current or previous word. Words are composed of alphanumeric characters (letters and digits).
shell-forward-word
Move forward to the end of the next word. Words are delimited by non-quoted shell metacharacters.
shell-backward-word
Move back to the start of the current or previous word. Words are delimited by non-quoted shell metacharacters.
clear-screen (C-l)
Clear the screen leaving the current line at the top of the screen. With an argument, refresh the current line without clearing the screen.
redraw-current-line
Refresh the current line.
 

Commands for Manipulating the History

accept-line (Newline, Return)
Accept the line regardless of where the cursor is. If this line is non-empty, add it to the history list according to the state of the HISTCONTROL variable. If the line is a modified history line, then restore the history line to its original state.
previous-history (C-p)
Fetch the previous command from the history list, moving back in the list.
next-history (C-n)
Fetch the next command from the history list, moving forward in the list.
beginning-of-history (M-<)
Move to the first line in the history.
end-of-history (M->)
Move to the end of the input history, i.e., the line currently being entered.
reverse-search-history (C-r)
Search backward starting at the current line and moving `up' through the history as necessary. This is an incremental search.
forward-search-history (C-s)
Search forward starting at the current line and moving `down' through the history as necessary. This is an incremental search.
non-incremental-reverse-search-history (M-p)
Search backward through the history starting at the current line using a non-incremental search for a string supplied by the user.
non-incremental-forward-search-history (M-n)
Search forward through the history using a non-incremental search for a string supplied by the user.
history-search-forward
Search forward through the history for the string of characters between the start of the current line and the point. This is a non-incremental search.
history-search-backward
Search backward through the history for the string of characters between the start of the current line and the point. This is a non-incremental search.
yank-nth-arg (M-C-y)
Insert the first argument to the previous command (usually the second word on the previous line) at point. With an argument n, insert the nth word from the previous command (the words in the previous command begin with word 0). A negative argument inserts the nth word from the end of the previous command. Once the argument n is computed, the argument is extracted as if the "!n" history expansion had been specified.
yank-last-arg (M-., M-_)
Insert the last argument to the previous command (the last word of the previous history entry). With a numeric argument, behave exactly like yank-nth-arg. Successive calls to yank-last-arg move back through the history list, inserting the last word (or the word specified by the argument to the first call) of each line in turn. Any numeric argument supplied to these successive calls determines the direction to move through the history. A negative argument switches the direction through the history (back or forward). The history expansion facilities are used to extract the last word, as if the "!$" history expansion had been specified.
shell-expand-line (M-C-e)
Expand the line as the shell does. This performs alias and history expansion as well as all of the shell word expansions. See HISTORY EXPANSION below for a description of history expansion.
history-expand-line (M-^)
Perform history expansion on the current line. See HISTORY EXPANSION below for a description of history expansion.
magic-space
Perform history expansion on the current line and insert a space. See HISTORY EXPANSION below for a description of history expansion.
alias-expand-line
Perform alias expansion on the current line. See ALIASES above for a description of alias expansion.
history-and-alias-expand-line
Perform history and alias expansion on the current line.
insert-last-argument (M-., M-_)
A synonym for yank-last-arg.
operate-and-get-next (C-o)
Accept the current line for execution and fetch the next line relative to the current line from the history for editing. Any argument is ignored.
edit-and-execute-command (C-xC-e)
Invoke an editor on the current command line, and execute the result as shell commands. Bash attempts to invoke $VISUAL, $EDITOR, and emacs as the editor, in that order.
 

Commands for Changing Text

end-of-file (usually C-d)
The character indicating end-of-file as set, for example, by stty. If this character is read when there are no characters on the line, and point is at the beginning of the line, Readline interprets it as the end of input and returns EOF.
delete-char (C-d)
Delete the character at point. If this function is bound to the same character as the tty EOF character, as C-d commonly is, see above for the effects.
backward-delete-char (Rubout)
Delete the character behind the cursor. When given a numeric argument, save the deleted text on the kill ring.
forward-backward-delete-char
Delete the character under the cursor, unless the cursor is at the end of the line, in which case the character behind the cursor is deleted.
quoted-insert (C-q, C-v)
Add the next character typed to the line verbatim. This is how to insert characters like C-q, for example.
tab-insert (C-v TAB)
Insert a tab character.
self-insert (a, b, A, 1, !, ...)
Insert the character typed.
transpose-chars (C-t)
Drag the character before point forward over the character at point, moving point forward as well. If point is at the end of the line, then this transposes the two characters before point. Negative arguments have no effect.
transpose-words (M-t)
Drag the word before point past the word after point, moving point over that word as well. If point is at the end of the line, this transposes the last two words on the line.
upcase-word (M-u)
Uppercase the current (or following) word. With a negative argument, uppercase the previous word, but do not move point.
downcase-word (M-l)
Lowercase the current (or following) word. With a negative argument, lowercase the previous word, but do not move point.
capitalize-word (M-c)
Capitalize the current (or following) word. With a negative argument, capitalize the previous word, but do not move point.
overwrite-mode
Toggle overwrite mode. With an explicit positive numeric argument, switches to overwrite mode. With an explicit non-positive numeric argument, switches to insert mode. This command affects only emacs mode; vi mode does overwrite differently. Each call to readline() starts in insert mode. In overwrite mode, characters bound to self-insert replace the text at point rather than pushing the text to the right. Characters bound to backward-delete-char replace the character before point with a space. By default, this command is unbound.
 

Killing and Yanking

kill-line (C-k)
Kill the text from point to the end of the line.
backward-kill-line (C-x Rubout)
Kill backward to the beginning of the line.
unix-line-discard (C-u)
Kill backward from point to the beginning of the line. The killed text is saved on the kill-ring.
kill-whole-line
Kill all characters on the current line, no matter where point is.
kill-word (M-d)
Kill from point to the end of the current word, or if between words, to the end of the next word. Word boundaries are the same as those used by forward-word.
backward-kill-word (M-Rubout)
Kill the word behind point. Word boundaries are the same as those used by backward-word.
shell-kill-word
Kill from point to the end of the current word, or if between words, to the end of the next word. Word boundaries are the same as those used by shell-forward-word.
shell-backward-kill-word
Kill the word behind point. Word boundaries are the same as those used by shell-backward-word.
unix-word-rubout (C-w)
Kill the word behind point, using white space as a word boundary. The killed text is saved on the kill-ring.
unix-filename-rubout
Kill the word behind point, using white space and the slash character as the word boundaries. The killed text is saved on the kill-ring.
delete-horizontal-space (M-\)
Delete all spaces and tabs around point.
kill-region
Kill the text in the current region.
copy-region-as-kill
Copy the text in the region to the kill buffer.
copy-backward-word
Copy the word before point to the kill buffer. The word boundaries are the same as backward-word.
copy-forward-word
Copy the word following point to the kill buffer. The word boundaries are the same as forward-word.
yank (C-y)
Yank the top of the kill ring into the buffer at point.
yank-pop (M-y)
Rotate the kill ring, and yank the new top. Only works following yank or yank-pop.
 

Numeric Arguments

digit-argument (M-0, M-1, ..., M--)
Add this digit to the argument already accumulating, or start a new argument. M-- starts a negative argument.
universal-argument
This is another way to specify an argument. If this command is followed by one or more digits, optionally with a leading minus sign, those digits define the argument. If the command is followed by digits, executing universal-argument again ends the numeric argument, but is otherwise ignored. As a special case, if this command is immediately followed by a character that is neither a digit nor minus sign, the argument count for the next command is multiplied by four. The argument count is initially one, so executing this function the first time makes the argument count four, a second time makes the argument count sixteen, and so on.
 

Completing

complete (TAB)
Attempt to perform completion on the text before point. Bash attempts completion treating the text as a variable (if the text begins with $), username (if the text begins with ~), hostname (if the text begins with @), or command (including aliases and functions) in turn. If none of these produces a match, filename completion is attempted.
possible-completions (M-?)
List the possible completions of the text before point.
insert-completions (M-*)
Insert all completions of the text before point that would have been generated by possible-completions.
menu-complete
Similar to complete, but replaces the word to be completed with a single match from the list of possible completions. Repeated execution of menu-complete steps through the list of possible completions, inserting each match in turn. At the end of the list of completions, the bell is rung (subject to the setting of bell-style) and the original text is restored. An argument of n moves n positions forward in the list of matches; a negative argument may be used to move backward through the list. This command is intended to be bound to TAB, but is unbound by default.
menu-complete-backward
Identical to menu-complete, but moves backward through the list of possible completions, as if menu-complete had been given a negative argument. This command is unbound by default.
delete-char-or-list
Deletes the character under the cursor if not at the beginning or end of the line (like delete-char). If at the end of the line, behaves identically to possible-completions. This command is unbound by default.
complete-filename (M-/)
Attempt filename completion on the text before point.
possible-filename-completions (C-x /)
List the possible completions of the text before point, treating it as a filename.
complete-username (M-~)
Attempt completion on the text before point, treating it as a username.
possible-username-completions (C-x ~)
List the possible completions of the text before point, treating it as a username.
complete-variable (M-$)
Attempt completion on the text before point, treating it as a shell variable.
possible-variable-completions (C-x $)
List the possible completions of the text before point, treating it as a shell variable.
complete-hostname (M-@)
Attempt completion on the text before point, treating it as a hostname.
possible-hostname-completions (C-x @)
List the possible completions of the text before point, treating it as a hostname.
complete-command (M-!)
Attempt completion on the text before point, treating it as a command name. Command completion attempts to match the text against aliases, reserved words, shell functions, shell builtins, and finally executable filenames, in that order.
possible-command-completions (C-x !)
List the possible completions of the text before point, treating it as a command name.
dynamic-complete-history (M-TAB)
Attempt completion on the text before point, comparing the text against lines from the history list for possible completion matches.
dabbrev-expand
Attempt menu completion on the text before point, comparing the text against lines from the history list for possible completion matches.
complete-into-braces (M-{)
Perform filename completion and insert the list of possible completions enclosed within braces so the list is available to the shell (see Brace Expansion above).
 

Keyboard Macros

start-kbd-macro (C-x ()
Begin saving the characters typed into the current keyboard macro.
end-kbd-macro (C-x ))
Stop saving the characters typed into the current keyboard macro and store the definition.
call-last-kbd-macro (C-x e)
Re-execute the last keyboard macro defined, by making the characters in the macro appear as if typed at the keyboard.
print-last-kbd-macro ()
Print the last keyboard macro defined in a format suitable for the inputrc file.
 

Miscellaneous

re-read-init-file (C-x C-r)
Read in the contents of the inputrc file, and incorporate any bindings or variable assignments found there.
abort (C-g)
Abort the current editing command and ring the terminal's bell (subject to the setting of bell-style).
do-uppercase-version (M-a, M-b, M-x, ...)
If the metafied character x is lowercase, run the command that is bound to the corresponding uppercase character.
prefix-meta (ESC)
Metafy the next character typed. ESC f is equivalent to Meta-f.
undo (C-_, C-x C-u)
Incremental undo, separately remembered for each line.
revert-line (M-r)
Undo all changes made to this line. This is like executing the undo command enough times to return the line to its initial state.
tilde-expand (M-&)
Perform tilde expansion on the current word.
set-mark (C-@, M-<space>)
Set the mark to the point. If a numeric argument is supplied, the mark is set to that position.
exchange-point-and-mark (C-x C-x)
Swap the point with the mark. The current cursor position is set to the saved position, and the old cursor position is saved as the mark.
character-search (C-])
A character is read and point is moved to the next occurrence of that character. A negative count searches for previous occurrences.
character-search-backward (M-C-])
A character is read and point is moved to the previous occurrence of that character. A negative count searches for subsequent occurrences.
skip-csi-sequence
Read enough characters to consume a multi-key sequence such as those defined for keys like Home and End. Such sequences begin with a Control Sequence Indicator (CSI), usually ESC-[. If this sequence is bound to "\[", keys producing such sequences will have no effect unless explicitly bound to a readline command, instead of inserting stray characters into the editing buffer. This is unbound by default, but usually bound to ESC-[.
insert-comment (M-#)
Without a numeric argument, the value of the readline comment-begin variable is inserted at the beginning of the current line. If a numeric argument is supplied, this command acts as a toggle: if the characters at the beginning of the line do not match the value of comment-begin, the value is inserted, otherwise the characters in comment-begin are deleted from the beginning of the line. In either case, the line is accepted as if a newline had been typed. The default value of comment-begin causes this command to make the current line a shell comment. If a numeric argument causes the comment character to be removed, the line will be executed by the shell.
glob-complete-word (M-g)
The word before point is treated as a pattern for pathname expansion, with an asterisk implicitly appended. This pattern is used to generate a list of matching filenames for possible completions.
glob-expand-word (C-x *)
The word before point is treated as a pattern for pathname expansion, and the list of matching filenames is inserted, replacing the word. If a numeric argument is supplied, an asterisk is appended before pathname expansion.
glob-list-expansions (C-x g)
The list of expansions that would have been generated by glob-expand-word is displayed, and the line is redrawn. If a numeric argument is supplied, an asterisk is appended before pathname expansion.
dump-functions
Print all of the functions and their key bindings to the readline output stream. If a numeric argument is supplied, the output is formatted in such a way that it can be made part of an inputrc file.
dump-variables
Print all of the settable readline variables and their values to the readline output stream. If a numeric argument is supplied, the output is formatted in such a way that it can be made part of an inputrc file.
dump-macros
Print all of the readline key sequences bound to macros and the strings they output. If a numeric argument is supplied, the output is formatted in such a way that it can be made part of an inputrc file.
display-shell-version (C-x C-v)
Display version information about the current instance of bash.
 

Programmable Completion

When word completion is attempted for an argument to a command for which a completion specification (a compspec) has been defined using the complete builtin (see SHELL BUILTIN COMMANDS below), the programmable completion facilities are invoked.

First, the command name is identified. If the command word is the empty string (completion attempted at the beginning of an empty line), any compspec defined with the -E option to complete is used. If a compspec has been defined for that command, the compspec is used to generate the list of possible completions for the word. If the command word is a full pathname, a compspec for the full pathname is searched for first. If no compspec is found for the full pathname, an attempt is made to find a compspec for the portion following the final slash. If those searches do not result in a compspec, any compspec defined with the -D option to complete is used as the default.

Once a compspec has been found, it is used to generate the list of matching words. If a compspec is not found, the default bash completion as described above under Completing is performed.

First, the actions specified by the compspec are used. Only matches which are prefixed by the word being completed are returned. When the -f or -d option is used for filename or directory name completion, the shell variable FIGNORE is used to filter the matches.

Any completions specified by a pathname expansion pattern to the -G option are generated next. The words generated by the pattern need not match the word being completed. The GLOBIGNORE shell variable is not used to filter the matches, but the FIGNORE variable is used.

Next, the string specified as the argument to the -W option is considered. The string is first split using the characters in the IFS special variable as delimiters. Shell quoting is honored. Each word is then expanded using brace expansion, tilde expansion, parameter and variable expansion, command substitution, and arithmetic expansion, as described above under EXPANSION. The results are split using the rules described above under Word Splitting. The results of the expansion are prefix-matched against the word being completed, and the matching words become the possible completions.

After these matches have been generated, any shell function or command specified with the -F and -C options is invoked. When the command or function is invoked, the COMP_LINE, COMP_POINT, COMP_KEY, and COMP_TYPE variables are assigned values as described above under Shell Variables. If a shell function is being invoked, the COMP_WORDS and COMP_CWORD variables are also set. When the function or command is invoked, the first argument ($1) is the name of the command whose arguments are being completed, the second argument ($2) is the word being completed, and the third argument ($3) is the word preceding the word being completed on the current command line. No filtering of the generated completions against the word being completed is performed; the function or command has complete freedom in generating the matches.

Any function specified with -F is invoked first. The function may use any of the shell facilities, including the compgen builtin described below, to generate the matches. It must put the possible completions in the COMPREPLY array variable, one per array element.

Next, any command specified with the -C option is invoked in an environment equivalent to command substitution. It should print a list of completions, one per line, to the standard output. Backslash may be used to escape a newline, if necessary.

After all of the possible completions are generated, any filter specified with the -X option is applied to the list. The filter is a pattern as used for pathname expansion; a & in the pattern is replaced with the text of the word being completed. A literal & may be escaped with a backslash; the backslash is removed before attempting a match. Any completion that matches the pattern will be removed from the list. A leading ! negates the pattern; in this case any completion not matching the pattern will be removed. If the nocasematch shell option is enabled, the match is performed without regard to the case of alphabetic characters.

Finally, any prefix and suffix specified with the -P and -S options are added to each member of the completion list, and the result is returned to the readline completion code as the list of possible completions.

If the previously-applied actions do not generate any matches, and the -o dirnames option was supplied to complete when the compspec was defined, directory name completion is attempted.

If the -o plusdirs option was supplied to complete when the compspec was defined, directory name completion is attempted and any matches are added to the results of the other actions.

By default, if a compspec is found, whatever it generates is returned to the completion code as the full set of possible completions. The default bash completions are not attempted, and the readline default of filename completion is disabled. If the -o bashdefault option was supplied to complete when the compspec was defined, the bash default completions are attempted if the compspec generates no matches. If the -o default option was supplied to complete when the compspec was defined, readline's default completion will be performed if the compspec (and, if attempted, the default bash completions) generate no matches.

When a compspec indicates that directory name completion is desired, the programmable completion functions force readline to append a slash to completed names which are symbolic links to directories, subject to the value of the mark-directories readline variable, regardless of the setting of the mark-symlinked-directories readline variable.

There is some support for dynamically modifying completions. This is most useful when used in combination with a default completion specified with complete -D. It's possible for shell functions executed as completion handlers to indicate that completion should be retried by returning an exit status of 124. If a shell function returns 124, and changes the compspec associated with the command on which completion is being attempted (supplied as the first argument when the function is executed), programmable completion restarts from the beginning, with an attempt to find a new compspec for that command. This allows a set of completions to be built dynamically as completion is attempted, rather than being loaded all at once.

For instance, assuming that there is a library of compspecs, each kept in a file corresponding to the name of the command, the following default completion function would load completions dynamically:

_completion_loader()
{
       . "/etc/bash_completion.d/$1.sh" >/dev/null 2>&1 && return 124

}
complete -D -F _completion_loader -o bashdefault -o default
 

HISTORY

When the -o history option to the set builtin is enabled, the shell provides access to the command history, the list of commands previously typed. The value of the HISTSIZE variable is used as the number of commands to save in a history list. The text of the last HISTSIZE commands (default 500) is saved. The shell stores each command in the history list prior to parameter and variable expansion (see EXPANSION above) but after history expansion is performed, subject to the values of the shell variables HISTIGNORE and HISTCONTROL.

On startup, the history is initialized from the file named by the variable HISTFILE (default ~/.bash_history). The file named by the value of HISTFILE is truncated, if necessary, to contain no more than the number of lines specified by the value of HISTFILESIZE. If HISTFILESIZE is unset, or set to null, a non-numeric value, or a numeric value less than zero, the history file is not truncated. When the history file is read, lines beginning with the history comment character followed immediately by a digit are interpreted as timestamps for the preceding history line. These timestamps are optionally displayed depending on the value of the HISTTIMEFORMAT variable. When a shell with history enabled exits, the last $HISTSIZE lines are copied from the history list to $HISTFILE. If the histappend shell option is enabled (see the description of shopt under SHELL BUILTIN COMMANDS below), the lines are appended to the history file, otherwise the history file is overwritten. If HISTFILE is unset, or if the history file is unwritable, the history is not saved. If the HISTTIMEFORMAT variable is set, time stamps are written to the history file, marked with the history comment character, so they may be preserved across shell sessions. This uses the history comment character to distinguish timestamps from other history lines. After saving the history, the history file is truncated to contain no more than HISTFILESIZE lines. If HISTFILESIZE is unset, or set to null, a non-numeric value, or a numeric value less than zero, the history file is not truncated.

The builtin command fc (see SHELL BUILTIN COMMANDS below) may be used to list or edit and re-execute a portion of the history list. The history builtin may be used to display or modify the history list and manipulate the history file. When using command-line editing, search commands are available in each editing mode that provide access to the history list.

The shell allows control over which commands are saved on the history list. The HISTCONTROL and HISTIGNORE variables may be set to cause the shell to save only a subset of the commands entered. The cmdhist shell option, if enabled, causes the shell to attempt to save each line of a multi-line command in the same history entry, adding semicolons where necessary to preserve syntactic correctness. The lithist shell option causes the shell to save the command with embedded newlines instead of semicolons. See the description of the shopt builtin below under SHELL BUILTIN COMMANDS for information on setting and unsetting shell options.  

HISTORY EXPANSION

The shell supports a history expansion feature that is similar to the history expansion in csh. This section describes what syntax features are available. This feature is enabled by default for interactive shells, and can be disabled using the +H option to the set builtin command (see SHELL BUILTIN COMMANDS below). Non-interactive shells do not perform history expansion by default.

History expansions introduce words from the history list into the input stream, making it easy to repeat commands, insert the arguments to a previous command into the current input line, or fix errors in previous commands quickly.

History expansion is performed immediately after a complete line is read, before the shell breaks it into words. It takes place in two parts. The first is to determine which line from the history list to use during substitution. The second is to select portions of that line for inclusion into the current one. The line selected from the history is the event, and the portions of that line that are acted upon are words. Various modifiers are available to manipulate the selected words. The line is broken into words in the same fashion as when reading input, so that several metacharacter-separated words surrounded by quotes are considered one word. History expansions are introduced by the appearance of the history expansion character, which is ! by default. Only backslash (\) and single quotes can quote the history expansion character, but the history expansion character is also treated as quoted if it immediately precedes the closing double quote in a double-quoted string.

Several characters inhibit history expansion if found immediately following the history expansion character, even if it is unquoted: space, tab, newline, carriage return, and =. If the extglob shell option is enabled, ( will also inhibit expansion.

Several shell options settable with the shopt builtin may be used to tailor the behavior of history expansion. If the histverify shell option is enabled (see the description of the shopt builtin below), and readline is being used, history substitutions are not immediately passed to the shell parser. Instead, the expanded line is reloaded into the readline editing buffer for further modification. If readline is being used, and the histreedit shell option is enabled, a failed history substitution will be reloaded into the readline editing buffer for correction. The -p option to the history builtin command may be used to see what a history expansion will do before using it. The -s option to the history builtin may be used to add commands to the end of the history list without actually executing them, so that they are available for subsequent recall.

The shell allows control of the various characters used by the history expansion mechanism (see the description of histchars above under Shell Variables). The shell uses the history comment character to mark history timestamps when writing the history file.  

Event Designators

An event designator is a reference to a command line entry in the history list. Unless the reference is absolute, events are relative to the current position in the history list.

!
Start a history substitution, except when followed by a blank, newline, carriage return, = or ( (when the extglob shell option is enabled using the shopt builtin).
!n
Refer to command line n.
!-n
Refer to the current command minus n.
!!
Refer to the previous command. This is a synonym for `!-1'.
!string
Refer to the most recent command preceding the current position in the history list starting with string.
!?string[?]
Refer to the most recent command preceding the current position in the history list containing string. The trailing ? may be omitted if string is followed immediately by a newline.
^string1^string2^
Quick substitution. Repeat the previous command, replacing string1 with string2. Equivalent to ``!!:s/string1/string2/'' (see Modifiers below).
!#
The entire command line typed so far.
 

Word Designators

Word designators are used to select desired words from the event. A : separates the event specification from the word designator. It may be omitted if the word designator begins with a ^, $, *, -, or %. Words are numbered from the beginning of the line, with the first word being denoted by 0 (zero). Words are inserted into the current line separated by single spaces.

0 (zero)
The zeroth word. For the shell, this is the command word.
n
The nth word.
^
The first argument. That is, word 1.
$
The last word. This is usually the last argument, but will expand to the zeroth word if there is only one word in the line.
%
The word matched by the most recent `?string?' search.
x-y
A range of words; `-y' abbreviates `0-y'.
*
All of the words but the zeroth. This is a synonym for `1-$'. It is not an error to use * if there is just one word in the event; the empty string is returned in that case.
x*
Abbreviates x-$.
x-
Abbreviates x-$ like x*, but omits the last word.

If a word designator is supplied without an event specification, the previous command is used as the event.  

Modifiers

After the optional word designator, there may appear a sequence of one or more of the following modifiers, each preceded by a `:'.

h
Remove a trailing filename component, leaving only the head.
t
Remove all leading filename components, leaving the tail.
r
Remove a trailing suffix of the form .xxx, leaving the basename.
e
Remove all but the trailing suffix.
p
Print the new command but do not execute it.
q
Quote the substituted words, escaping further substitutions.
x
Quote the substituted words as with q, but break into words at blanks and newlines.
s/old/new/
Substitute new for the first occurrence of old in the event line. Any delimiter can be used in place of /. The final delimiter is optional if it is the last character of the event line. The delimiter may be quoted in old and new with a single backslash. If & appears in new, it is replaced by old. A single backslash will quote the &. If old is null, it is set to the last old substituted, or, if no previous history substitutions took place, the last string in a !?string[?] search.
&
Repeat the previous substitution.
g
Cause changes to be applied over the entire event line. This is used in conjunction with `:s' (e.g., `:gs/old/new/') or `:&'. If used with `:s', any delimiter can be used in place of /, and the final delimiter is optional if it is the last character of the event line. An a may be used as a synonym for g.
G
Apply the following `s' modifier once to each word in the event line.
 

SHELL BUILTIN COMMANDS

Unless otherwise noted, each builtin command documented in this section as accepting options preceded by - accepts -- to signify the end of the options. The :, true, false, and test builtins do not accept options and do not treat -- specially. The exit, logout, return, break, continue, let, and shift builtins accept and process arguments beginning with - without requiring --. Other builtins that accept arguments but are not specified as accepting options interpret arguments beginning with - as invalid options and require -- to prevent this interpretation.

: [arguments]
No effect; the command does nothing beyond expanding arguments and performing any specified redirections. The return status is zero.
. filename [arguments]
source filename [arguments]
Read and execute commands from filename in the current shell environment and return the exit status of the last command executed from filename. If filename does not contain a slash, filenames in PATH are used to find the directory containing filename. The file searched for in PATH need not be executable. When bash is not in posix mode, the current directory is searched if no file is found in PATH. If the sourcepath option to the shopt builtin command is turned off, the PATH is not searched. If any arguments are supplied, they become the positional parameters when filename is executed. Otherwise the positional parameters are unchanged. If the -T option is enabled, source inherits any trap on DEBUG; if it is not, any DEBUG trap string is saved and restored around the call to source, and source unsets the DEBUG trap while it executes. If -T is not set, and the sourced file changes the DEBUG trap, the new value is retained when source completes. The return status is the status of the last command exited within the script (0 if no commands are executed), and false if filename is not found or cannot be read.
alias [-p] [name[=value] ...]
Alias with no arguments or with the -p option prints the list of aliases in the form alias name=value on standard output. When arguments are supplied, an alias is defined for each name whose value is given. A trailing space in value causes the next word to be checked for alias substitution when the alias is expanded. For each name in the argument list for which no value is supplied, the name and value of the alias is printed. Alias returns true unless a name is given for which no alias has been defined.
bg [jobspec ...]
Resume each suspended job jobspec in the background, as if it had been started with &. If jobspec is not present, the shell's notion of the current job is used. bg jobspec returns 0 unless run when job control is disabled or, when run with job control enabled, any specified jobspec was not found or was started without job control.
bind [-m keymap] [-lpsvPSVX]
bind [-m keymap] [-q function] [-u function] [-r keyseq]
bind [-m keymap] -f filename
bind [-m keymap] -x keyseq:shell-command
bind [-m keymap] keyseq:function-name
bind [-m keymap] keyseq:readline-command
Display current readline key and function bindings, bind a key sequence to a readline function or macro, or set a readline variable. Each non-option argument is a command as it would appear in .inputrc, but each binding or command must be passed as a separate argument; e.g., '"\C-x\C-r": re-read-init-file'. Options, if supplied, have the following meanings:
-m keymap
Use keymap as the keymap to be affected by the subsequent bindings. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. vi is equivalent to vi-command (vi-move is also a synonym); emacs is equivalent to emacs-standard.
-l
List the names of all readline functions.
-p
Display readline function names and bindings in such a way that they can be re-read.
-P
List current readline function names and bindings.
-s
Display readline key sequences bound to macros and the strings they output in such a way that they can be re-read.
-S
Display readline key sequences bound to macros and the strings they output.
-v
Display readline variable names and values in such a way that they can be re-read.
-V
List current readline variable names and values.
-f filename
Read key bindings from filename.
-q function
Query about which keys invoke the named function.
-u function
Unbind all keys bound to the named function.
-r keyseq
Remove any current binding for keyseq.
-x keyseq:shell-command
Cause shell-command to be executed whenever keyseq is entered. When shell-command is executed, the shell sets the READLINE_LINE variable to the contents of the readline line buffer and the READLINE_POINT variable to the current location of the insertion point. If the executed command changes the value of READLINE_LINE or READLINE_POINT, those new values will be reflected in the editing state.
-X
List all key sequences bound to shell commands and the associated commands in a format that can be reused as input.

The return value is 0 unless an unrecognized option is given or an error occurred.

break [n]
Exit from within a for, while, until, or select loop. If n is specified, break n levels. n must be >= 1. If n is greater than the number of enclosing loops, all enclosing loops are exited. The return value is 0 unless n is not greater than or equal to 1.
builtin shell-builtin [arguments]
Execute the specified shell builtin, passing it arguments, and return its exit status. This is useful when defining a function whose name is the same as a shell builtin, retaining the functionality of the builtin within the function. The cd builtin is commonly redefined this way. The return status is false if shell-builtin is not a shell builtin command.
caller [expr]
Returns the context of any active subroutine call (a shell function or a script executed with the . or source builtins). Without expr, caller displays the line number and source filename of the current subroutine call. If a non-negative integer is supplied as expr, caller displays the line number, subroutine name, and source file corresponding to that position in the current execution call stack. This extra information may be used, for example, to print a stack trace. The current frame is frame 0. The return value is 0 unless the shell is not executing a subroutine call or expr does not correspond to a valid position in the call stack.
cd [-L|[-P [-e]] [-@]] [dir]
Change the current directory to dir. if dir is not supplied, the value of the HOME shell variable is the default. Any additional arguments following dir are ignored. The variable CDPATH defines the search path for the directory containing dir: each directory name in CDPATH is searched for dir. Alternative directory names in CDPATH are separated by a colon (:). A null directory name in CDPATH is the same as the current directory, i.e., ``.''. If dir begins with a slash (/), then CDPATH is not used. The -P option causes cd to use the physical directory structure by resolving symbolic links while traversing dir and before processing instances of .. in dir (see also the -P option to the set builtin command); the -L option forces symbolic links to be followed by resolving the link after processing instances of .. in dir. If .. appears in dir, it is processed by removing the immediately previous pathname component from dir, back to a slash or the beginning of dir. If the -e option is supplied with -P, and the current working directory cannot be successfully determined after a successful directory change, cd will return an unsuccessful status. On systems that support it, the -@ option presents the extended attributes associated with a file as a directory. An argument of - is converted to $OLDPWD before the directory change is attempted. If a non-empty directory name from CDPATH is used, or if - is the first argument, and the directory change is successful, the absolute pathname of the new working directory is written to the standard output. The return value is true if the directory was successfully changed; false otherwise.
command [-pVv] command [arg ...]
Run command with args suppressing the normal shell function lookup. Only builtin commands or commands found in the PATH are executed. If the -p option is given, the search for command is performed using a default value for PATH that is guaranteed to find all of the standard utilities. If either the -V or -v option is supplied, a description of command is printed. The -v option causes a single word indicating the command or filename used to invoke command to be displayed; the -V option produces a more verbose description. If the -V or -v option is supplied, the exit status is 0 if command was found, and 1 if not. If neither option is supplied and an error occurred or command cannot be found, the exit status is 127. Otherwise, the exit status of the command builtin is the exit status of command.
compgen [option] [word]
Generate possible completion matches for word according to the options, which may be any option accepted by the complete builtin with the exception of -p and -r, and write the matches to the standard output. When using the -F or -C options, the various shell variables set by the programmable completion facilities, while available, will not have useful values.

The matches will be generated in the same way as if the programmable completion code had generated them directly from a completion specification with the same flags. If word is specified, only those completions matching word will be displayed.

The return value is true unless an invalid option is supplied, or no matches were generated.

complete [-abcdefgjksuv] [-o comp-option] [-DE] [-A action] [-G globpat] [-W wordlist] [-F function] [-C command]

[-X filterpat] [-P prefix] [-S suffix] name [name ...]
complete -pr [-DE] [name ...]
Specify how arguments to each name should be completed. If the -p option is supplied, or if no options are supplied, existing completion specifications are printed in a way that allows them to be reused as input. The -r option removes a completion specification for each name, or, if no names are supplied, all completion specifications. The -D option indicates that the remaining options and actions should apply to the ``default'' command completion; that is, completion attempted on a command for which no completion has previously been defined. The -E option indicates that the remaining options and actions should apply to ``empty'' command completion; that is, completion attempted on a blank line.

The process of applying these completion specifications when word completion is attempted is described above under Programmable Completion.

Other options, if specified, have the following meanings. The arguments to the -G, -W, and -X options (and, if necessary, the -P and -S options) should be quoted to protect them from expansion before the complete builtin is invoked.

-o comp-option
The comp-option controls several aspects of the compspec's behavior beyond the simple generation of completions. comp-option may be one of:
bashdefault
Perform the rest of the default bash completions if the compspec generates no matches.
default
Use readline's default filename completion if the compspec generates no matches.
dirnames
Perform directory name completion if the compspec generates no matches.
filenames
Tell readline that the compspec generates filenames, so it can perform any filename-specific processing (like adding a slash to directory names, quoting special characters, or suppressing trailing spaces). Intended to be used with shell functions.
noquote
Tell readline not to quote the completed words if they are filenames (quoting filenames is the default).
nosort
Tell readline not to sort the list of possible completions alphabetically.
nospace
Tell readline not to append a space (the default) to words completed at the end of the line.
plusdirs
After any matches defined by the compspec are generated, directory name completion is attempted and any matches are added to the results of the other actions.
-A action
The action may be one of the following to generate a list of possible completions:
alias
Alias names. May also be specified as -a.
arrayvar
Array variable names.
binding
Readline key binding names.
builtin
Names of shell builtin commands. May also be specified as -b.
command
Command names. May also be specified as -c.
directory
Directory names. May also be specified as -d.
disabled
Names of disabled shell builtins.
enabled
Names of enabled shell builtins.
export
Names of exported shell variables. May also be specified as -e.
file
File names. May also be specified as -f.
function
Names of shell functions.
group
Group names. May also be specified as -g.
helptopic
Help topics as accepted by the help builtin.
hostname
Hostnames, as taken from the file specified by the HOSTFILE shell variable.
job
Job names, if job control is active. May also be specified as -j.
keyword
Shell reserved words. May also be specified as -k.
running
Names of running jobs, if job control is active.
service
Service names. May also be specified as -s.
setopt
Valid arguments for the -o option to the set builtin.
shopt
Shell option names as accepted by the shopt builtin.
signal
Signal names.
stopped
Names of stopped jobs, if job control is active.
user
User names. May also be specified as -u.
variable
Names of all shell variables. May also be specified as -v.
-C command
command is executed in a subshell environment, and its output is used as the possible completions.
-F function
The shell function function is executed in the current shell environment. When the function is executed, the first argument ($1) is the name of the command whose arguments are being completed, the second argument ($2) is the word being completed, and the third argument ($3) is the word preceding the word being completed on the current command line. When it finishes, the possible completions are retrieved from the value of the COMPREPLY array variable.
-G globpat
The pathname expansion pattern globpat is expanded to generate the possible completions.
-P prefix
prefix is added at the beginning of each possible completion after all other options have been applied.
-S suffix
suffix is appended to each possible completion after all other options have been applied.
-W wordlist
The wordlist is split using the characters in the IFS special variable as delimiters, and each resultant word is expanded. The possible completions are the members of the resultant list which match the word being completed.
-X filterpat
filterpat is a pattern as used for pathname expansion. It is applied to the list of possible completions generated by the preceding options and arguments, and each completion matching filterpat is removed from the list. A leading ! in filterpat negates the pattern; in this case, any completion not matching filterpat is removed.

The return value is true unless an invalid option is supplied, an option other than -p or -r is supplied without a name argument, an attempt is made to remove a completion specification for a name for which no specification exists, or an error occurs adding a completion specification.

compopt [-o option] [-DE] [+o option] [name]
Modify completion options for each name according to the options, or for the currently-executing completion if no names are supplied. If no options are given, display the completion options for each name or the current completion. The possible values of option are those valid for the complete builtin described above. The -D option indicates that the remaining options should apply to the ``default'' command completion; that is, completion attempted on a command for which no completion has previously been defined. The -E option indicates that the remaining options should apply to ``empty'' command completion; that is, completion attempted on a blank line.

The return value is true unless an invalid option is supplied, an attempt is made to modify the options for a name for which no completion specification exists, or an output error occurs.

continue [n]
Resume the next iteration of the enclosing for, while, until, or select loop. If n is specified, resume at the nth enclosing loop. n must be >= 1. If n is greater than the number of enclosing loops, the last enclosing loop (the ``top-level'' loop) is resumed. The return value is 0 unless n is not greater than or equal to 1.
declare [-aAfFgilnrtux] [-p] [name[=value] ...]
typeset [-aAfFgilnrtux] [-p] [name[=value] ...]
Declare variables and/or give them attributes. If no names are given then display the values of variables. The -p option will display the attributes and values of each name. When -p is used with name arguments, additional options, other than -f and -F, are ignored. When -p is supplied without name arguments, it will display the attributes and values of all variables having the attributes specified by the additional options. If no other options are supplied with -p, declare will display the attributes and values of all shell variables. The -f option will restrict the display to shell functions. The -F option inhibits the display of function definitions; only the function name and attributes are printed. If the extdebug shell option is enabled using shopt, the source file name and line number where each name is defined are displayed as well. The -F option implies -f. The -g option forces variables to be created or modified at the global scope, even when declare is executed in a shell function. It is ignored in all other cases. The following options can be used to restrict output to variables with the specified attribute or to give variables attributes:
-a
Each name is an indexed array variable (see Arrays above).
-A
Each name is an associative array variable (see Arrays above).
-f
Use function names only.
-i
The variable is treated as an integer; arithmetic evaluation (see ARITHMETIC EVALUATION above) is performed when the variable is assigned a value.
-l
When the variable is assigned a value, all upper-case characters are converted to lower-case. The upper-case attribute is disabled.
-n
Give each name the nameref attribute, making it a name reference to another variable. That other variable is defined by the value of name. All references, assignments, and attribute modifications to name, except those using or changing the -n attribute itself, are performed on the variable referenced by name's value. The nameref attribute cannot be applied to array variables.
-r
Make names readonly. These names cannot then be assigned values by subsequent assignment statements or unset.
-t
Give each name the trace attribute. Traced functions inherit the DEBUG and RETURN traps from the calling shell. The trace attribute has no special meaning for variables.
-u
When the variable is assigned a value, all lower-case characters are converted to upper-case. The lower-case attribute is disabled.
-x
Mark names for export to subsequent commands via the environment.

Using `+' instead of `-' turns off the attribute instead, with the exceptions that +a may not be used to destroy an array variable and +r will not remove the readonly attribute. When used in a function, declare and typeset make each name local, as with the local command, unless the -g option is supplied. If a variable name is followed by =value, the value of the variable is set to value. When using -a or -A and the compound assignment syntax to create array variables, additional attributes do not take effect until subsequent assignments. The return value is 0 unless an invalid option is encountered, an attempt is made to define a function using -f foo=bar, an attempt is made to assign a value to a readonly variable, an attempt is made to assign a value to an array variable without using the compound assignment syntax (see Arrays above), one of the names is not a valid shell variable name, an attempt is made to turn off readonly status for a readonly variable, an attempt is made to turn off array status for an array variable, or an attempt is made to display a non-existent function with -f.

dirs [-clpv] [+n] [-n]
Without options, displays the list of currently remembered directories. The default display is on a single line with directory names separated by spaces. Directories are added to the list with the pushd command; the popd command removes entries from the list. The current directory is always the first directory in the stack.
-c
Clears the directory stack by deleting all of the entries.
-l
Produces a listing using full pathnames; the default listing format uses a tilde to denote the home directory.
-p
Print the directory stack with one entry per line.
-v
Print the directory stack with one entry per line, prefixing each entry with its index in the stack.
+n
Displays the nth entry counting from the left of the list shown by dirs when invoked without options, starting with zero.
-n
Displays the nth entry counting from the right of the list shown by dirs when invoked without options, starting with zero.

The return value is 0 unless an invalid option is supplied or n indexes beyond the end of the directory stack.

disown [-ar] [-h] [jobspec ... | pid ... ]
Without options, remove each jobspec from the table of active jobs. If jobspec is not present, and neither the -a nor the -r option is supplied, the current job is used. If the -h option is given, each jobspec is not removed from the table, but is marked so that SIGHUP is not sent to the job if the shell receives a SIGHUP. If no jobspec is supplied, the -a option means to remove or mark all jobs; the -r option without a jobspec argument restricts operation to running jobs. The return value is 0 unless a jobspec does not specify a valid job.
echo [-neE] [arg ...]
Output the args, separated by spaces, followed by a newline. The return status is 0 unless a write error occurs. If -n is specified, the trailing newline is suppressed. If the -e option is given, interpretation of the following backslash-escaped characters is enabled. The -E option disables the interpretation of these escape characters, even on systems where they are interpreted by default. The xpg_echo shell option may be used to dynamically determine whether or not echo expands these escape characters by default. echo does not interpret -- to mean the end of options. echo interprets the following escape sequences:
\a
alert (bell)
\b
backspace
\c
suppress further output
\e
\E
an escape character
\f
form feed
\n
new line
\r
carriage return
\t
horizontal tab
\v
vertical tab
\\
backslash
\0nnn
the eight-bit character whose value is the octal value nnn (zero to three octal digits)
\xHH
the eight-bit character whose value is the hexadecimal value HH (one or two hex digits)
\uHHHH
the Unicode (ISO/IEC 10646) character whose value is the hexadecimal value HHHH (one to four hex digits)
\UHHHHHHHH
the Unicode (ISO/IEC 10646) character whose value is the hexadecimal value HHHHHHHH (one to eight hex digits)
enable [-a] [-dnps] [-f filename] [name ...]
Enable and disable builtin shell commands. Disabling a builtin allows a disk command which has the same name as a shell builtin to be executed without specifying a full pathname, even though the shell normally searches for builtins before disk commands. If -n is used, each name is disabled; otherwise, names are enabled. For example, to use the test binary found via the PATH instead of the shell builtin version, run enable -n test. The -f option means to load the new builtin command name from shared object filename, on systems that support dynamic loading. The -d option will delete a builtin previously loaded with -f. If no name arguments are given, or if the -p option is supplied, a list of shell builtins is printed. With no other option arguments, the list consists of all enabled shell builtins. If -n is supplied, only disabled builtins are printed. If -a is supplied, the list printed includes all builtins, with an indication of whether or not each is enabled. If -s is supplied, the output is restricted to the POSIX special builtins. The return value is 0 unless a name is not a shell builtin or there is an error loading a new builtin from a shared object.
eval [arg ...]
The args are read and concatenated together into a single command. This command is then read and executed by the shell, and its exit status is returned as the value of eval. If there are no args, or only null arguments, eval returns 0.
exec [-cl] [-a name] [command [arguments]]
If command is specified, it replaces the shell. No new process is created. The arguments become the arguments to command. If the -l option is supplied, the shell places a dash at the beginning of the zeroth argument passed to command. This is what login(1) does. The -c option causes command to be executed with an empty environment. If -a is supplied, the shell passes name as the zeroth argument to the executed command. If command cannot be executed for some reason, a non-interactive shell exits, unless the execfail shell option is enabled. In that case, it returns failure. An interactive shell returns failure if the file cannot be executed. If command is not specified, any redirections take effect in the current shell, and the return status is 0. If there is a redirection error, the return status is 1.
exit [n]
Cause the shell to exit with a status of n. If n is omitted, the exit status is that of the last command executed. A trap on EXIT is executed before the shell terminates.
export [-fn] [name[=word]] ...
export -p
The supplied names are marked for automatic export to the environment of subsequently executed commands. If the -f option is given, the names refer to functions. If no names are given, or if the -p option is supplied, a list of names of all exported variables is printed. The -n option causes the export property to be removed from each name. If a variable name is followed by =word, the value of the variable is set to word. export returns an exit status of 0 unless an invalid option is encountered, one of the names is not a valid shell variable name, or -f is supplied with a name that is not a function.
fc [-e ename] [-lnr] [first] [last]
fc -s [pat=rep] [cmd]
The first form selects a range of commands from first to last from the history list and displays or edits and re-executes them. First and last may be specified as a string (to locate the last command beginning with that string) or as a number (an index into the history list, where a negative number is used as an offset from the current command number). If last is not specified it is set to the current command for listing (so that fc -l -10 prints the last 10 commands) and to first otherwise. If first is not specified it is set to the previous command for editing and -16 for listing.

The -n option suppresses the command numbers when listing. The -r option reverses the order of the commands. If the -l option is given, the commands are listed on standard output. Otherwise, the editor given by ename is invoked on a file containing those commands. If ename is not given, the value of the FCEDIT variable is used, and the value of EDITOR if FCEDIT is not set. If neither variable is set, vi is used. When editing is complete, the edited commands are echoed and executed.

In the second form, command is re-executed after each instance of pat is replaced by rep. Command is intepreted the same as first above. A useful alias to use with this is r='fc -s', so that typing r cc runs the last command beginning with cc and typing r re-executes the last command.

If the first form is used, the return value is 0 unless an invalid option is encountered or first or last specify history lines out of range. If the -e option is supplied, the return value is the value of the last command executed or failure if an error occurs with the temporary file of commands. If the second form is used, the return status is that of the command re-executed, unless cmd does not specify a valid history line, in which case fc returns failure.

fg [jobspec]
Resume jobspec in the foreground, and make it the current job. If jobspec is not present, the shell's notion of the current job is used. The return value is that of the command placed into the foreground, or failure if run when job control is disabled or, when run with job control enabled, if jobspec does not specify a valid job or jobspec specifies a job that was started without job control.
getopts optstring name [args]
getopts is used by shell procedures to parse positional parameters. optstring contains the option characters to be recognized; if a character is followed by a colon, the option is expected to have an argument, which should be separated from it by white space. The colon and question mark characters may not be used as option characters. Each time it is invoked, getopts places the next option in the shell variable name, initializing name if it does not exist, and the index of the next argument to be processed into the variable OPTIND. OPTIND is initialized to 1 each time the shell or a shell script is invoked. When an option requires an argument, getopts places that argument into the variable OPTARG. The shell does not reset OPTIND automatically; it must be manually reset between multiple calls to getopts within the same shell invocation if a new set of parameters is to be used.

When the end of options is encountered, getopts exits with a return value greater than zero. OPTIND is set to the index of the first non-option argument, and name is set to ?.

getopts normally parses the positional parameters, but if more arguments are given in args, getopts parses those instead.

getopts can report errors in two ways. If the first character of optstring is a colon, silent error reporting is used. In normal operation, diagnostic messages are printed when invalid options or missing option arguments are encountered. If the variable OPTERR is set to 0, no error messages will be displayed, even if the first character of optstring is not a colon.

If an invalid option is seen, getopts places ? into name and, if not silent, prints an error message and unsets OPTARG. If getopts is silent, the option character found is placed in OPTARG and no diagnostic message is printed.

If a required argument is not found, and getopts is not silent, a question mark (?) is placed in name, OPTARG is unset, and a diagnostic message is printed. If getopts is silent, then a colon (:) is placed in name and OPTARG is set to the option character found.

getopts returns true if an option, specified or unspecified, is found. It returns false if the end of options is encountered or an error occurs.

hash [-lr] [-p filename] [-dt] [name]
Each time hash is invoked, the full pathname of the command name is determined by searching the directories in $PATH and remembered. Any previously-remembered pathname is discarded. If the -p option is supplied, no path search is performed, and filename is used as the full filename of the command. The -r option causes the shell to forget all remembered locations. The -d option causes the shell to forget the remembered location of each name. If the -t option is supplied, the full pathname to which each name corresponds is printed. If multiple name arguments are supplied with -t, the name is printed before the hashed full pathname. The -l option causes output to be displayed in a format that may be reused as input. If no arguments are given, or if only -l is supplied, information about remembered commands is printed. The return status is true unless a name is not found or an invalid option is supplied.
help [-dms] [pattern]
Display helpful information about builtin commands. If pattern is specified, help gives detailed help on all commands matching pattern; otherwise help for all the builtins and shell control structures is printed.
-d
Display a short description of each pattern
-m
Display the description of each pattern in a manpage-like format
-s
Display only a short usage synopsis for each pattern

The return status is 0 unless no command matches pattern.

history [n]
history -c
history -d offset
history -anrw [filename]
history -p arg [arg ...]
history -s arg [arg ...]
With no options, display the command history list with line numbers. Lines listed with a * have been modified. An argument of n lists only the last n lines. If the shell variable HISTTIMEFORMAT is set and not null, it is used as a format string for strftime(3) to display the time stamp associated with each displayed history entry. No intervening blank is printed between the formatted time stamp and the history line. If filename is supplied, it is used as the name of the history file; if not, the value of HISTFILE is used. Options, if supplied, have the following meanings:
-c
Clear the history list by deleting all the entries.
-d offset
Delete the history entry at position offset.
-a
Append the ``new'' history lines to the history file. These are history lines entered since the beginning of the current bash session, but not already appended to the history file.
-n
Read the history lines not already read from the history file into the current history list. These are lines appended to the history file since the beginning of the current bash session.
-r
Read the contents of the history file and append them to the current history list.
-w
Write the current history list to the history file, overwriting the history file's contents.
-p
Perform history substitution on the following args and display the result on the standard output. Does not store the results in the history list. Each arg must be quoted to disable normal history expansion.
-s
Store the args in the history list as a single entry. The last command in the history list is removed before the args are added.

If the HISTTIMEFORMAT variable is set, the time stamp information associated with each history entry is written to the history file, marked with the history comment character. When the history file is read, lines beginning with the history comment character followed immediately by a digit are interpreted as timestamps for the following history entry. The return value is 0 unless an invalid option is encountered, an error occurs while reading or writing the history file, an invalid offset is supplied as an argument to -d, or the history expansion supplied as an argument to -p fails.

jobs [-lnprs] [ jobspec ... ]
jobs -x command [ args ... ]
The first form lists the active jobs. The options have the following meanings:
-l
List process IDs in addition to the normal information.
-n
Display information only about jobs that have changed status since the user was last notified of their status.
-p
List only the process ID of the job's process group leader.
-r
Display only running jobs.
-s
Display only stopped jobs.

If jobspec is given, output is restricted to information about that job. The return status is 0 unless an invalid option is encountered or an invalid jobspec is supplied.

If the -x option is supplied, jobs replaces any jobspec found in command or args with the corresponding process group ID, and executes command passing it args, returning its exit status.

kill [-s sigspec | -n signum | -sigspec] [pid | jobspec] ...
kill -l|-L [sigspec | exit_status]
Send the signal named by sigspec or signum to the processes named by pid or jobspec. sigspec is either a case-insensitive signal name such as SIGKILL (with or without the SIG prefix) or a signal number; signum is a signal number. If sigspec is not present, then SIGTERM is assumed. An argument of -l lists the signal names. If any arguments are supplied when -l is given, the names of the signals corresponding to the arguments are listed, and the return status is 0. The exit_status argument to -l is a number specifying either a signal number or the exit status of a process terminated by a signal. The -L option is equivalent to -l. kill returns true if at least one signal was successfully sent, or false if an error occurs or an invalid option is encountered.
let arg [arg ...]
Each arg is an arithmetic expression to be evaluated (see ARITHMETIC EVALUATION above). If the last arg evaluates to 0, let returns 1; 0 is returned otherwise.
local [option] [name[=value] ... | - ]
For each argument, a local variable named name is created, and assigned value. The option can be any of the options accepted by declare. When local is used within a function, it causes the variable name to have a visible scope restricted to that function and its children. If name is -, the set of shell options is made local to the function in which local is invoked: shell options changed using the set builtin inside the function are restored to their original values when the function returns. With no operands, local writes a list of local variables to the standard output. It is an error to use local when not within a function. The return status is 0 unless local is used outside a function, an invalid name is supplied, or name is a readonly variable.
logout
Exit a login shell.
mapfile [-d delim] [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array]
readarray [-d delim] [-n count] [-O origin] [-s count] [-t] [-u fd] [-C callback] [-c quantum] [array]
Read lines from the standard input into the indexed array variable array, or from file descriptor fd if the -u option is supplied. The variable MAPFILE is the default array. Options, if supplied, have the following meanings:
-d
The first character of delim is used to terminate each input line, rather than newline.
-n
Copy at most count lines. If count is 0, all lines are copied.
-O
Begin assigning to array at index origin. The default index is 0.
-s
Discard the first count lines read.
-t
Remove a trailing delim (default newline) from each line read.
-u
Read lines from file descriptor fd instead of the standard input.
-C
Evaluate callback each time quantum lines are read. The -c option specifies quantum.
-c
Specify the number of lines read between each call to callback.

If -C is specified without -c, the default quantum is 5000. When callback is evaluated, it is supplied the index of the next array element to be assigned and the line to be assigned to that element as additional arguments. callback is evaluated after the line is read but before the array element is assigned.

If not supplied with an explicit origin, mapfile will clear array before assigning to it.

mapfile returns successfully unless an invalid option or option argument is supplied, array is invalid or unassignable, or if array is not an indexed array.

popd [-n] [+n] [-n]
Removes entries from the directory stack. With no arguments, removes the top directory from the stack, and performs a cd to the new top directory. Arguments, if supplied, have the following meanings:
-n
Suppresses the normal change of directory when removing directories from the stack, so that only the stack is manipulated.
+n
Removes the nth entry counting from the left of the list shown by dirs, starting with zero. For example: popd +0 removes the first directory, popd +1 the second.
-n
Removes the nth entry counting from the right of the list shown by dirs, starting with zero. For example: popd -0 removes the last directory, popd -1 the next to last.

If the popd command is successful, a dirs is performed as well, and the return status is 0. popd returns false if an invalid option is encountered, the directory stack is empty, a non-existent directory stack entry is specified, or the directory change fails.

printf [-v var] format [arguments]
Write the formatted arguments to the standard output under the control of the format. The -v option causes the output to be assigned to the variable var rather than being printed to the standard output.

The format is a character string which contains three types of objects: plain characters, which are simply copied to standard output, character escape sequences, which are converted and copied to the standard output, and format specifications, each of which causes printing of the next successive argument. In addition to the standard printf(1) format specifications, printf interprets the following extensions:

%b
causes printf to expand backslash escape sequences in the corresponding argument in the same way as echo -e.
%q
causes printf to output the corresponding argument in a format that can be reused as shell input.
%(datefmt)T
causes printf to output the date-time string resulting from using datefmt as a format string for strftime(3). The corresponding argument is an integer representing the number of seconds since the epoch. Two special argument values may be used: -1 represents the current time, and -2 represents the time the shell was invoked. If no argument is specified, conversion behaves as if -1 had been given. This is an exception to the usual printf behavior.

Arguments to non-string format specifiers are treated as C constants, except that a leading plus or minus sign is allowed, and if the leading character is a single or double quote, the value is the ASCII value of the following character.

The format is reused as necessary to consume all of the arguments. If the format requires more arguments than are supplied, the extra format specifications behave as if a zero value or null string, as appropriate, had been supplied. The return value is zero on success, non-zero on failure.

pushd [-n] [+n] [-n]
pushd [-n] [dir]
Adds a directory to the top of the directory stack, or rotates the stack, making the new top of the stack the current working directory. With no arguments, pushd exchanges the top two directories and returns 0, unless the directory stack is empty. Arguments, if supplied, have the following meanings:
-n
Suppresses the normal change of directory when rotating or adding directories to the stack, so that only the stack is manipulated.
+n
Rotates the stack so that the nth directory (counting from the left of the list shown by dirs, starting with zero) is at the top.
-n
Rotates the stack so that the nth directory (counting from the right of the list shown by dirs, starting with zero) is at the top.
dir
Adds dir to the directory stack at the top, making it the new current working directory as if it had been supplied as the argument to the cd builtin.

If the pushd command is successful, a dirs is performed as well. If the first form is used, pushd returns 0 unless the cd to dir fails. With the second form, pushd returns 0 unless the directory stack is empty, a non-existent directory stack element is specified, or the directory change to the specified new current directory fails.

pwd [-LP]
Print the absolute pathname of the current working directory. The pathname printed contains no symbolic links if the -P option is supplied or the -o physical option to the set builtin command is enabled. If the -L option is used, the pathname printed may contain symbolic links. The return status is 0 unless an error occurs while reading the name of the current directory or an invalid option is supplied.
read [-ers] [-a aname] [-d delim] [-i text] [-n nchars] [-N nchars] [-p prompt] [-t timeout] [-u fd] [name ...]
One line is read from the standard input, or from the file descriptor fd supplied as an argument to the -u option, split into words as described above under Word Splitting, and the first word is assigned to the first name, the second word to the second name, and so on. If there are more words than names, the remaining words and their intervening delimiters are assigned to the last name. If there are fewer words read from the input stream than names, the remaining names are assigned empty values. The characters in IFS are used to split the line into words using the same rules the shell uses for expansion (described above under Word Splitting). The backslash character (\) may be used to remove any special meaning for the next character read and for line continuation. Options, if supplied, have the following meanings:
-a aname
The words are assigned to sequential indices of the array variable aname, starting at 0. aname is unset before any new values are assigned. Other name arguments are ignored.
-d delim
The first character of delim is used to terminate the input line, rather than newline.
-e
If the standard input is coming from a terminal, readline (see READLINE above) is used to obtain the line. Readline uses the current (or default, if line editing was not previously active) editing settings.
-i text
If readline is being used to read the line, text is placed into the editing buffer before editing begins.
-n nchars
read returns after reading nchars characters rather than waiting for a complete line of input, but honors a delimiter if fewer than nchars characters are read before the delimiter.
-N nchars
read returns after reading exactly nchars characters rather than waiting for a complete line of input, unless EOF is encountered or read times out. Delimiter characters encountered in the input are not treated specially and do not cause read to return until nchars characters are read. The result is not split on the characters in IFS; the intent is that the variable is assigned exactly the characters read (with the exception of backslash; see the -r option below).
-p prompt
Display prompt on standard error, without a trailing newline, before attempting to read any input. The prompt is displayed only if input is coming from a terminal.
-r
Backslash does not act as an escape character. The backslash is considered to be part of the line. In particular, a backslash-newline pair may not be used as a line continuation.
-s
Silent mode. If input is coming from a terminal, characters are not echoed.
-t timeout
Cause read to time out and return failure if a complete line of input (or a specified number of characters) is not read within timeout seconds. timeout may be a decimal number with a fractional portion following the decimal point. This option is only effective if read is reading input from a terminal, pipe, or other special file; it has no effect when reading from regular files. If read times out, read saves any partial input read into the specified variable name. If timeout is 0, read returns immediately, without trying to read any data. The exit status is 0 if input is available on the specified file descriptor, non-zero otherwise. The exit status is greater than 128 if the timeout is exceeded.
-u fd
Read input from file descriptor fd.

If no names are supplied, the line read is assigned to the variable REPLY. The exit status is zero, unless end-of-file is encountered, read times out (in which case the status is greater than 128), a variable assignment error (such as assigning to a readonly variable) occurs, or an invalid file descriptor is supplied as the argument to -u.

readonly [-aAf] [-p] [name[=word] ...]
The given names are marked readonly; the values of these names may not be changed by subsequent assignment. If the -f option is supplied, the functions corresponding to the names are so marked. The -a option restricts the variables to indexed arrays; the -A option restricts the variables to associative arrays. If both options are supplied, -A takes precedence. If no name arguments are given, or if the -p option is supplied, a list of all readonly names is printed. The other options may be used to restrict the output to a subset of the set of readonly names. The -p option causes output to be displayed in a format that may be reused as input. If a variable name is followed by =word, the value of the variable is set to word. The return status is 0 unless an invalid option is encountered, one of the names is not a valid shell variable name, or -f is supplied with a name that is not a function.
return [n]
Causes a function to stop executing and return the value specified by n to its caller. If n is omitted, the return status is that of the last command executed in the function body. If return is executed by a trap handler, the last command used to determine the status is the last command executed before the trap handler. if return is executed during a DEBUG trap, the last command used to determine the status is the last command executed by the trap handler before return was invoked. If return is used outside a function, but during execution of a script by the . (source) command, it causes the shell to stop executing that script and return either n or the exit status of the last command executed within the script as the exit status of the script. If n is supplied, the return value is its least significant 8 bits. The return status is non-zero if return is supplied a non-numeric argument, or is used outside a function and not during execution of a script by . or source. Any command associated with the RETURN trap is executed before execution resumes after the function or script.
set [--abefhkmnptuvxBCEHPT] [-o option-name] [arg ...]
set [+abefhkmnptuvxBCEHPT] [+o option-name] [arg ...]
Without options, the name and value of each shell variable are displayed in a format that can be reused as input for setting or resetting the currently-set variables. Read-only variables cannot be reset. In posix mode, only shell variables are listed. The output is sorted according to the current locale. When options are specified, they set or unset shell attributes. Any arguments remaining after option processing are treated as values for the positional parameters and are assigned, in order, to $1, $2, ... $n. Options, if specified, have the following meanings:
-a
Each variable or function that is created or modified is given the export attribute and marked for export to the environment of subsequent commands.
-b
Report the status of terminated background jobs immediately, rather than before the next primary prompt. This is effective only when job control is enabled.
-e
Exit immediately if a pipeline (which may consist of a single simple command), a list, or a compound command (see SHELL GRAMMAR above), exits with a non-zero status. The shell does not exit if the command that fails is part of the command list immediately following a while or until keyword, part of the test following the if or elif reserved words, part of any command executed in a && or || list except the command following the final && or ||, any command in a pipeline but the last, or if the command's return value is being inverted with !. If a compound command other than a subshell returns a non-zero status because a command failed while -e was being ignored, the shell does not exit. A trap on ERR, if set, is executed before the shell exits. This option applies to the shell environment and each subshell environment separately (see COMMAND EXECUTION ENVIRONMENT above), and may cause subshells to exit before executing all the commands in the subshell.

If a compound command or shell function executes in a context where -e is being ignored, none of the commands executed within the compound command or function body will be affected by the -e setting, even if -e is set and a command returns a failure status. If a compound command or shell function sets -e while executing in a context where -e is ignored, that setting will not have any effect until the compound command or the command containing the function call completes.

-f
Disable pathname expansion.
-h
Remember the location of commands as they are looked up for execution. This is enabled by default.
-k
All arguments in the form of assignment statements are placed in the environment for a command, not just those that precede the command name.
-m
Monitor mode. Job control is enabled. This option is on by default for interactive shells on systems that support it (see JOB CONTROL above). All processes run in a separate process group. When a background job completes, the shell prints a line containing its exit status.
-n
Read commands but do not execute them. This may be used to check a shell script for syntax errors. This is ignored by interactive shells.
-o option-name
The option-name can be one of the following:
allexport
Same as -a.
braceexpand
Same as -B.
emacs
Use an emacs-style command line editing interface. This is enabled by default when the shell is interactive, unless the shell is started with the --noediting option. This also affects the editing interface used for read -e.
errexit
Same as -e.
errtrace
Same as -E.
functrace
Same as -T.
hashall
Same as -h.
histexpand
Same as -H.
history
Enable command history, as described above under HISTORY. This option is on by default in interactive shells.
ignoreeof
The effect is as if the shell command IGNOREEOF=10 had been executed (see Shell Variables above).
keyword
Same as -k.
monitor
Same as -m.
noclobber
Same as -C.
noexec
Same as -n.
noglob
Same as -f.
nolog
Currently ignored.
notify
Same as -b.
nounset
Same as -u.
onecmd
Same as -t.
physical
Same as -P.
pipefail
If set, the return value of a pipeline is the value of the last (rightmost) command to exit with a non-zero status, or zero if all commands in the pipeline exit successfully. This option is disabled by default.
posix
Change the behavior of bash where the default operation differs from the POSIX standard to match the standard (posix mode). See SEE ALSO below for a reference to a document that details how posix mode affects bash's behavior.
privileged
Same as -p.
verbose
Same as -v.
vi
Use a vi-style command line editing interface. This also affects the editing interface used for read -e.
xtrace
Same as -x.

If -o is supplied with no option-name, the values of the current options are printed. If +o is supplied with no option-name, a series of set commands to recreate the current option settings is displayed on the standard output.

-p
Turn on privileged mode. In this mode, the $ENV and $BASH_ENV files are not processed, shell functions are not inherited from the environment, and the SHELLOPTS, BASHOPTS, CDPATH, and GLOBIGNORE variables, if they appear in the environment, are ignored. If the shell is started with the effective user (group) id not equal to the real user (group) id, and the -p option is not supplied, these actions are taken and the effective user id is set to the real user id. If the -p option is supplied at startup, the effective user id is not reset. Turning this option off causes the effective user and group ids to be set to the real user and group ids.
-t
Exit after reading and executing one command.
-u
Treat unset variables and parameters other than the special parameters "@" and "*" as an error when performing parameter expansion. If expansion is attempted on an unset variable or parameter, the shell prints an error message, and, if not interactive, exits with a non-zero status.
-v
Print shell input lines as they are read.
-x
After expanding each simple command, for command, case command, select command, or arithmetic for command, display the expanded value of PS4, followed by the command and its expanded arguments or associated word list.
-B
The shell performs brace expansion (see Brace Expansion above). This is on by default.
-C
If set, bash does not overwrite an existing file with the >, >&, and <> redirection operators. This may be overridden when creating output files by using the redirection operator >| instead of >.
-E
If set, any trap on ERR is inherited by shell functions, command substitutions, and commands executed in a subshell environment. The ERR trap is normally not inherited in such cases.
-H
Enable ! style history substitution. This option is on by default when the shell is interactive.
-P
If set, the shell does not resolve symbolic links when executing commands such as cd that change the current working directory. It uses the physical directory structure instead. By default, bash follows the logical chain of directories when performing commands which change the current directory.
-T
If set, any traps on DEBUG and RETURN are inherited by shell functions, command substitutions, and commands executed in a subshell environment. The DEBUG and RETURN traps are normally not inherited in such cases.
--
If no arguments follow this option, then the positional parameters are unset. Otherwise, the positional parameters are set to the args, even if some of them begin with a -.
-
Signal the end of options, cause all remaining args to be assigned to the positional parameters. The -x and -v options are turned off. If there are no args, the positional parameters remain unchanged.

The options are off by default unless otherwise noted. Using + rather than - causes these options to be turned off. The options can also be specified as arguments to an invocation of the shell. The current set of options may be found in $-. The return status is always true unless an invalid option is encountered.

shift [n]
The positional parameters from n+1 ... are renamed to $1 .... Parameters represented by the numbers $# down to $#-n+1 are unset. n must be a non-negative number less than or equal to $#. If n is 0, no parameters are changed. If n is not given, it is assumed to be 1. If n is greater than $#, the positional parameters are not changed. The return status is greater than zero if n is greater than $# or less than zero; otherwise 0.
shopt [-pqsu] [-o] [optname ...]
Toggle the values of settings controlling optional shell behavior. The settings can be either those listed below, or, if the -o option is used, those available with the -o option to the set builtin command. With no options, or with the -p option, a list of all settable options is displayed, with an indication of whether or not each is set. The -p option causes output to be displayed in a form that may be reused as input. Other options have the following meanings:
-s
Enable (set) each optname.
-u
Disable (unset) each optname.
-q
Suppresses normal output (quiet mode); the return status indicates whether the optname is set or unset. If multiple optname arguments are given with -q, the return status is zero if all optnames are enabled; non-zero otherwise.
-o
Restricts the values of optname to be those defined for the -o option to the set builtin.

If either -s or -u is used with no optname arguments, shopt shows only those options which are set or unset, respectively. Unless otherwise noted, the shopt options are disabled (unset) by default.

The return status when listing options is zero if all optnames are enabled, non-zero otherwise. When setting or unsetting options, the return status is zero unless an optname is not a valid shell option.

The list of shopt options is:

autocd
If set, a command name that is the name of a directory is executed as if it were the argument to the cd command. This option is only used by interactive shells.
cdable_vars
If set, an argument to the cd builtin command that is not a directory is assumed to be the name of a variable whose value is the directory to change to.
cdspell
If set, minor errors in the spelling of a directory component in a cd command will be corrected. The errors checked for are transposed characters, a missing character, and one character too many. If a correction is found, the corrected filename is printed, and the command proceeds. This option is only used by interactive shells.
checkhash
If set, bash checks that a command found in the hash table exists before trying to execute it. If a hashed command no longer exists, a normal path search is performed.
checkjobs
If set, bash lists the status of any stopped and running jobs before exiting an interactive shell. If any jobs are running, this causes the exit to be deferred until a second exit is attempted without an intervening command (see JOB CONTROL above). The shell always postpones exiting if any jobs are stopped.
checkwinsize
If set, bash checks the window size after each command and, if necessary, updates the values of LINES and COLUMNS.
cmdhist
If set, bash attempts to save all lines of a multiple-line command in the same history entry. This allows easy re-editing of multi-line commands.
compat31
If set, bash changes its behavior to that of version 3.1 with respect to quoted arguments to the [[ conditional command's =~ operator and locale-specific string comparison when using the [[ conditional command's < and > operators. Bash versions prior to bash-4.1 use ASCII collation and strcmp(3); bash-4.1 and later use the current locale's collation sequence and strcoll(3).
compat32
If set, bash changes its behavior to that of version 3.2 with respect to locale-specific string comparison when using the [[ conditional command's < and > operators (see previous item) and the effect of interrupting a command list. Bash versions 3.2 and earlier continue with the next command in the list after one terminates due to an interrupt.
compat40
If set, bash changes its behavior to that of version 4.0 with respect to locale-specific string comparison when using the [[ conditional command's < and > operators (see description of compat31) and the effect of interrupting a command list. Bash versions 4.0 and later interrupt the list as if the shell received the interrupt; previous versions continue with the next command in the list.
compat41
If set, bash, when in posix mode, treats a single quote in a double-quoted parameter expansion as a special character. The single quotes must match (an even number) and the characters between the single quotes are considered quoted. This is the behavior of posix mode through version 4.1. The default bash behavior remains as in previous versions.
compat42
If set, bash does not process the replacement string in the pattern substitution word expansion using quote removal.
compat43
If set, bash does not print a warning message if an attempt is made to use a quoted compound array assignment as an argument to declare, makes word expansion errors non-fatal errors that cause the current command to fail (the default behavior is to make them fatal errors that cause the shell to exit), and does not reset the loop state when a shell function is executed (this allows break or continue in a shell function to affect loops in the caller's context).
complete_fullquote
If set, bash quotes all shell metacharacters in filenames and directory names when performing completion. If not set, bash removes metacharacters such as the dollar sign from the set of characters that will be quoted in completed filenames when these metacharacters appear in shell variable references in words to be completed. This means that dollar signs in variable names that expand to directories will not be quoted; however, any dollar signs appearing in filenames will not be quoted, either. This is active only when bash is using backslashes to quote completed filenames. This variable is set by default, which is the default bash behavior in versions through 4.2.
direxpand
If set, bash replaces directory names with the results of word expansion when performing filename completion. This changes the contents of the readline editing buffer. If not set, bash attempts to preserve what the user typed.
dirspell
If set, bash attempts spelling correction on directory names during word completion if the directory name initially supplied does not exist.
dotglob
If set, bash includes filenames beginning with a `.' in the results of pathname expansion.
execfail
If set, a non-interactive shell will not exit if it cannot execute the file specified as an argument to the exec builtin command. An interactive shell does not exit if exec fails.
expand_aliases
If set, aliases are expanded as described above under ALIASES. This option is enabled by default for interactive shells.
extdebug
If set at shell invocation, arrange to execute the debugger profile before the shell starts, identical to the --debugger option. If set after invocation, behavior intended for use by debuggers is enabled:
1.
The -F option to the declare builtin displays the source file name and line number corresponding to each function name supplied as an argument.
2.
If the command run by the DEBUG trap returns a non-zero value, the next command is skipped and not executed.
3.
If the command run by the DEBUG trap returns a value of 2, and the shell is executing in a subroutine (a shell function or a shell script executed by the . or source builtins), the shell simulates a call to return.
4.
BASH_ARGC and BASH_ARGV are updated as described in their descriptions above.
5.
Function tracing is enabled: command substitution, shell functions, and subshells invoked with ( command ) inherit the DEBUG and RETURN traps.
6.
Error tracing is enabled: command substitution, shell functions, and subshells invoked with ( command ) inherit the ERR trap.
extglob
If set, the extended pattern matching features described above under Pathname Expansion are enabled.
extquote
If set, $aqstringaq and $"string" quoting is performed within ${parameter} expansions enclosed in double quotes. This option is enabled by default.
failglob
If set, patterns which fail to match filenames during pathname expansion result in an expansion error.
force_fignore
If set, the suffixes specified by the FIGNORE shell variable cause words to be ignored when performing word completion even if the ignored words are the only possible completions. See SHELL VARIABLES above for a description of FIGNORE. This option is enabled by default.
globasciiranges
If set, range expressions used in pattern matching bracket expressions (see Pattern Matching above) behave as if in the traditional C locale when performing comparisons. That is, the current locale's collating sequence is not taken into account, so b will not collate between A and B, and upper-case and lower-case ASCII characters will collate together.
globstar
If set, the pattern ** used in a pathname expansion context will match all files and zero or more directories and subdirectories. If the pattern is followed by a /, only directories and subdirectories match.
gnu_errfmt
If set, shell error messages are written in the standard GNU error message format.
histappend
If set, the history list is appended to the file named by the value of the HISTFILE variable when the shell exits, rather than overwriting the file.
histreedit
If set, and readline is being used, a user is given the opportunity to re-edit a failed history substitution.
histverify
If set, and readline is being used, the results of history substitution are not immediately passed to the shell parser. Instead, the resulting line is loaded into the readline editing buffer, allowing further modification.
hostcomplete
If set, and readline is being used, bash will attempt to perform hostname completion when a word containing a @ is being completed (see Completing under READLINE above). This is enabled by default.
huponexit
If set, bash will send SIGHUP to all jobs when an interactive login shell exits.
inherit_errexit
If set, command substitution inherits the value of the errexit option, instead of unsetting it in the subshell environment. This option is enabled when posix mode is enabled.
interactive_comments
If set, allow a word beginning with # to cause that word and all remaining characters on that line to be ignored in an interactive shell (see COMMENTS above). This option is enabled by default.
lastpipe
If set, and job control is not active, the shell runs the last command of a pipeline not executed in the background in the current shell environment.
lithist
If set, and the cmdhist option is enabled, multi-line commands are saved to the history with embedded newlines rather than using semicolon separators where possible.
login_shell
The shell sets this option if it is started as a login shell (see INVOCATION above). The value may not be changed.
mailwarn
If set, and a file that bash is checking for mail has been accessed since the last time it was checked, the message ``The mail in mailfile has been read'' is displayed.
no_empty_cmd_completion
If set, and readline is being used, bash will not attempt to search the PATH for possible completions when completion is attempted on an empty line.
nocaseglob
If set, bash matches filenames in a case-insensitive fashion when performing pathname expansion (see Pathname Expansion above).
nocasematch
If set, bash matches patterns in a case-insensitive fashion when performing matching while executing case or [[ conditional commands, when performing pattern substitution word expansions, or when filtering possible completions as part of programmable completion.
nullglob
If set, bash allows patterns which match no files (see Pathname Expansion above) to expand to a null string, rather than themselves.
progcomp
If set, the programmable completion facilities (see Programmable Completion above) are enabled. This option is enabled by default.
promptvars
If set, prompt strings undergo parameter expansion, command substitution, arithmetic expansion, and quote removal after being expanded as described in PROMPTING above. This option is enabled by default.
restricted_shell
The shell sets this option if it is started in restricted mode (see RESTRICTED SHELL below). The value may not be changed. This is not reset when the startup files are executed, allowing the startup files to discover whether or not a shell is restricted.
shift_verbose
If set, the shift builtin prints an error message when the shift count exceeds the number of positional parameters.
sourcepath
If set, the source (.) builtin uses the value of PATH to find the directory containing the file supplied as an argument. This option is enabled by default.
xpg_echo
If set, the echo builtin expands backslash-escape sequences by default.
suspend [-f]
Suspend the execution of this shell until it receives a SIGCONT signal. A login shell cannot be suspended; the -f option can be used to override this and force the suspension. The return status is 0 unless the shell is a login shell and -f is not supplied, or if job control is not enabled.
test expr
[ expr ]
Return a status of 0 (true) or 1 (false) depending on the evaluation of the conditional expression expr. Each operator and operand must be a separate argument. Expressions are composed of the primaries described above under CONDITIONAL EXPRESSIONS. test does not accept any options, nor does it accept and ignore an argument of -- as signifying the end of options.

Expressions may be combined using the following operators, listed in decreasing order of precedence. The evaluation depends on the number of arguments; see below. Operator precedence is used when there are five or more arguments.

! expr
True if expr is false.
( expr )
Returns the value of expr. This may be used to override the normal precedence of operators.
expr1 -a expr2
True if both expr1 and expr2 are true.
expr1 -o expr2
True if either expr1 or expr2 is true.

test and [ evaluate conditional expressions using a set of rules based on the number of arguments.

0 arguments
The expression is false.
1 argument
The expression is true if and only if the argument is not null.
2 arguments
If the first argument is !, the expression is true if and only if the second argument is null. If the first argument is one of the unary conditional operators listed above under CONDITIONAL EXPRESSIONS, the expression is true if the unary test is true. If the first argument is not a valid unary conditional operator, the expression is false.
3 arguments
The following conditions are applied in the order listed. If the second argument is one of the binary conditional operators listed above under CONDITIONAL EXPRESSIONS, the result of the expression is the result of the binary test using the first and third arguments as operands. The -a and -o operators are considered binary operators when there are three arguments. If the first argument is !, the value is the negation of the two-argument test using the second and third arguments. If the first argument is exactly ( and the third argument is exactly ), the result is the one-argument test of the second argument. Otherwise, the expression is false.
4 arguments
If the first argument is !, the result is the negation of the three-argument expression composed of the remaining arguments. Otherwise, the expression is parsed and evaluated according to precedence using the rules listed above.
5 or more arguments
The expression is parsed and evaluated according to precedence using the rules listed above.

When used with test or [, the < and > operators sort lexicographically using ASCII ordering.

times
Print the accumulated user and system times for the shell and for processes run from the shell. The return status is 0.
trap [-lp] [[arg] sigspec ...]
The command arg is to be read and executed when the shell receives signal(s) sigspec. If arg is absent (and there is a single sigspec) or -, each specified signal is reset to its original disposition (the value it had upon entrance to the shell). If arg is the null string the signal specified by each sigspec is ignored by the shell and by the commands it invokes. If arg is not present and -p has been supplied, then the trap commands associated with each sigspec are displayed. If no arguments are supplied or if only -p is given, trap prints the list of commands associated with each signal. The -l option causes the shell to print a list of signal names and their corresponding numbers. Each sigspec is either a signal name defined in <signal.h>, or a signal number. Signal names are case insensitive and the SIG prefix is optional.

If a sigspec is EXIT (0) the command arg is executed on exit from the shell. If a sigspec is DEBUG, the command arg is executed before every simple command, for command, case command, select command, every arithmetic for command, and before the first command executes in a shell function (see SHELL GRAMMAR above). Refer to the description of the extdebug option to the shopt builtin for details of its effect on the DEBUG trap. If a sigspec is RETURN, the command arg is executed each time a shell function or a script executed with the . or source builtins finishes executing.

If a sigspec is ERR, the command arg is executed whenever a pipeline (which may consist of a single simple command), a list, or a compound command returns a non-zero exit status, subject to the following conditions. The ERR trap is not executed if the failed command is part of the command list immediately following a while or until keyword, part of the test in an if statement, part of a command executed in a && or || list except the command following the final && or ||, any command in a pipeline but the last, or if the command's return value is being inverted using !. These are the same conditions obeyed by the errexit (-e) option.

Signals ignored upon entry to the shell cannot be trapped or reset. Trapped signals that are not being ignored are reset to their original values in a subshell or subshell environment when one is created. The return status is false if any sigspec is invalid; otherwise trap returns true.

type [-aftpP] name [name ...]
With no options, indicate how each name would be interpreted if used as a command name. If the -t option is used, type prints a string which is one of alias, keyword, function, builtin, or file if name is an alias, shell reserved word, function, builtin, or disk file, respectively. If the name is not found, then nothing is printed, and an exit status of false is returned. If the -p option is used, type either returns the name of the disk file that would be executed if name were specified as a command name, or nothing if type -t name would not return file. The -P option forces a PATH search for each name, even if type -t name would not return file. If a command is hashed, -p and -P print the hashed value, which is not necessarily the file that appears first in PATH. If the -a option is used, type prints all of the places that contain an executable named name. This includes aliases and functions, if and only if the -p option is not also used. The table of hashed commands is not consulted when using -a. The -f option suppresses shell function lookup, as with the command builtin. type returns true if all of the arguments are found, false if any are not found.
ulimit [-HSabcdefiklmnpqrstuvxPT [limit]]
Provides control over the resources available to the shell and to processes started by it, on systems that allow such control. The -H and -S options specify that the hard or soft limit is set for the given resource. A hard limit cannot be increased by a non-root user once it is set; a soft limit may be increased up to the value of the hard limit. If neither -H nor -S is specified, both the soft and hard limits are set. The value of limit can be a number in the unit specified for the resource or one of the special values hard, soft, or unlimited, which stand for the current hard limit, the current soft limit, and no limit, respectively. If limit is omitted, the current value of the soft limit of the resource is printed, unless the -H option is given. When more than one resource is specified, the limit name and unit are printed before the value. Other options are interpreted as follows:
-a
All current limits are reported
-b
The maximum socket buffer size
-c
The maximum size of core files created
-d
The maximum size of a process's data segment
-e
The maximum scheduling priority ("nice")
-f
The maximum size of files written by the shell and its children
-i
The maximum number of pending signals
-k
The maximum number of kqueues that may be allocated
-l
The maximum size that may be locked into memory
-m
The maximum resident set size (many systems do not honor this limit)
-n
The maximum number of open file descriptors (most systems do not allow this value to be set)
-p
The pipe size in 512-byte blocks (this may not be set)
-q
The maximum number of bytes in POSIX message queues
-r
The maximum real-time scheduling priority
-s
The maximum stack size
-t
The maximum amount of cpu time in seconds
-u
The maximum number of processes available to a single user
-v
The maximum amount of virtual memory available to the shell and, on some systems, to its children
-x
The maximum number of file locks
-P
The maximum number of pseudoterminals
-T
The maximum number of threads

If limit is given, and the -a option is not used, limit is the new value of the specified resource. If no option is given, then -f is assumed. Values are in 1024-byte increments, except for -t, which is in seconds; -p, which is in units of 512-byte blocks; -P, -T, -b, -k, -n, and -u, which are unscaled values; and, when in Posix mode, -c and -f, which are in 512-byte increments. The return status is 0 unless an invalid option or argument is supplied, or an error occurs while setting a new limit.

umask [-p] [-S] [mode]
The user file-creation mask is set to mode. If mode begins with a digit, it is interpreted as an octal number; otherwise it is interpreted as a symbolic mode mask similar to that accepted by chmod(1). If mode is omitted, the current value of the mask is printed. The -S option causes the mask to be printed in symbolic form; the default output is an octal number. If the -p option is supplied, and mode is omitted, the output is in a form that may be reused as input. The return status is 0 if the mode was successfully changed or if no mode argument was supplied, and false otherwise.
unalias [-a] [name ...]
Remove each name from the list of defined aliases. If -a is supplied, all alias definitions are removed. The return value is true unless a supplied name is not a defined alias.
unset [-fv] [-n] [name ...]
For each name, remove the corresponding variable or function. If the -v option is given, each name refers to a shell variable, and that variable is removed. Read-only variables may not be unset. If -f is specified, each name refers to a shell function, and the function definition is removed. If the -n option is supplied, and name is a variable with the nameref attribute, name will be unset rather than the variable it references. -n has no effect if the -f option is supplied. If no options are supplied, each name refers to a variable; if there is no variable by that name, any function with that name is unset. Each unset variable or function is removed from the environment passed to subsequent commands. If any of COMP_WORDBREAKS, RANDOM, SECONDS, LINENO, HISTCMD, FUNCNAME, GROUPS, or DIRSTACK are unset, they lose their special properties, even if they are subsequently reset. The exit status is true unless a name is readonly.
wait [-n] [n ...]
Wait for each specified child process and return its termination status. Each n may be a process ID or a job specification; if a job spec is given, all processes in that job's pipeline are waited for. If n is not given, all currently active child processes are waited for, and the return status is zero. If the -n option is supplied, wait waits for any job to terminate and returns its exit status. If n specifies a non-existent process or job, the return status is 127. Otherwise, the return status is the exit status of the last process or job waited for.
 

RESTRICTED SHELL

If bash is started with the name rbash, or the -r option is supplied at invocation, the shell becomes restricted. A restricted shell is used to set up an environment more controlled than the standard shell. It behaves identically to bash with the exception that the following are disallowed or not performed:

*
changing directories with cd
*
setting or unsetting the values of SHELL, PATH, ENV, or BASH_ENV
*
specifying command names containing /
*
specifying a filename containing a / as an argument to the . builtin command
*
specifying a filename containing a slash as an argument to the -p option to the hash builtin command
*
importing function definitions from the shell environment at startup
*
parsing the value of SHELLOPTS from the shell environment at startup
*
redirecting output using the >, >|, <>, >&, &>, and >> redirection operators
*
using the exec builtin command to replace the shell with another command
*
adding or deleting builtin commands with the -f and -d options to the enable builtin command
*
using the enable builtin command to enable disabled shell builtins
*
specifying the -p option to the command builtin command
*
turning off restricted mode with set +r or set +o restricted.

These restrictions are enforced after any startup files are read.

When a command that is found to be a shell script is executed (see COMMAND EXECUTION above), rbash turns off any restrictions in the shell spawned to execute the script.  

SEE ALSO

Bash Reference Manual, Brian Fox and Chet Ramey
The Gnu Readline Library, Brian Fox and Chet Ramey
The Gnu History Library, Brian Fox and Chet Ramey
Portable Operating System Interface (POSIX) Part 2: Shell and Utilities, IEEE --
http://pubs.opengroup.org/onlinepubs/9699919799/
http://tiswww.case.edu/~chet/bash/POSIX -- a description of posix mode
sh(1), ksh(1), csh(1)
emacs(1), vi(1)
readline(3)
 

FILES

/bin/bash
The bash executable
/etc/profile
The systemwide initialization file, executed for login shells
~/.bash_profile
The personal initialization file, executed for login shells
~/.bashrc
The individual per-interactive-shell startup file
~/.bash_logout
The individual login shell cleanup file, executed when a login shell exits
~/.inputrc
Individual readline initialization file
 

AUTHORS

Brian Fox, Free Software Foundation
bfox@gnu.org

Chet Ramey, Case Western Reserve University
chet.ramey@case.edu  

BUG REPORTS

If you find a bug in bash, you should report it. But first, you should make sure that it really is a bug, and that it appears in the latest version of bash. The latest version is always available from ftp://ftp.gnu.org/pub/gnu/bash/.

Once you have determined that a bug actually exists, use the bashbug command to submit a bug report. If you have a fix, you are encouraged to mail that as well! Suggestions and `philosophical' bug reports may be mailed to bug-bash@gnu.org or posted to the Usenet newsgroup gnu.bash.bug.

ALL bug reports should include:

The version number of bash
The hardware and operating system
The compiler used to compile
A description of the bug behaviour
A short script or `recipe' which exercises the bug

bashbug inserts the first three items automatically into the template it provides for filing a bug report.

Comments and bug reports concerning this manual page should be directed to chet.ramey@case.edu.  

BUGS

It's too big and too slow.

There are some subtle differences between bash and traditional versions of sh, mostly because of the POSIX specification.

Aliases are confusing in some uses.

Shell builtin commands and functions are not stoppable/restartable.

Compound commands and command sequences of the form `a ; b ; c' are not handled gracefully when process suspension is attempted. When a process is stopped, the shell immediately executes the next command in the sequence. It suffices to place the sequence of commands between parentheses to force it into a subshell, which may be stopped as a unit.

Array variables may not (yet) be exported.

There may be only one active coprocess at a time.


GNU Bash 4.42016 August 26BASH(1)

 

Index

NAME
SYNOPSIS
COPYRIGHT
DESCRIPTION
OPTIONS
ARGUMENTS
INVOCATION
DEFINITIONS
RESERVED WORDS
SHELL GRAMMAR
Simple Commands
Pipelines
Lists
Compound Commands
Coprocesses
Shell Function Definitions
COMMENTS
QUOTING
PARAMETERS
Positional Parameters
Special Parameters
Shell Variables
Arrays
EXPANSION
Brace Expansion
Tilde Expansion
Parameter Expansion
Command Substitution
Arithmetic Expansion
Process Substitution
Word Splitting
Pathname Expansion
Quote Removal
REDIRECTION
Redirecting Input
Redirecting Output
Appending Redirected Output
Redirecting Standard Output and Standard Error
Appending Standard Output and Standard Error
Here Documents
Here Strings
Duplicating File Descriptors
Moving File Descriptors
Opening File Descriptors for Reading and Writing
ALIASES
FUNCTIONS
ARITHMETIC EVALUATION
CONDITIONAL EXPRESSIONS
SIMPLE COMMAND EXPANSION
COMMAND EXECUTION
COMMAND EXECUTION ENVIRONMENT
ENVIRONMENT
EXIT STATUS
SIGNALS
JOB CONTROL
PROMPTING
READLINE
Readline Notation
Readline Initialization
Readline Key Bindings
Readline Variables
Readline Conditional Constructs
Searching
Readline Command Names
Commands for Moving
Commands for Manipulating the History
Commands for Changing Text
Killing and Yanking
Numeric Arguments
Completing
Keyboard Macros
Miscellaneous
Programmable Completion
HISTORY
HISTORY EXPANSION
Event Designators
Word Designators
Modifiers
SHELL BUILTIN COMMANDS
RESTRICTED SHELL
SEE ALSO
FILES
AUTHORS
BUG REPORTS
BUGS

This document was created by man2html from bash.1.
Time: 31 August 2016 10:24:30 EDT bashref.html000064400002750533152530212110007053 0ustar00 Bash Reference Manual

Bash Reference Manual

Table of Contents

Next: , Previous: , Up: (dir)   [Contents][Index]

Bash Features

This text is a brief description of the features that are present in the Bash shell (version 4.4, 7 September 2016). The Bash home page is http://www.gnu.org/software/bash/.

This is Edition 4.4, last updated 7 September 2016, of The GNU Bash Reference Manual, for Bash, Version 4.4.

Bash contains features that appear in other popular shells, and some features that only appear in Bash. Some of the shells that Bash has borrowed concepts from are the Bourne Shell (sh), the Korn Shell (ksh), and the C-shell (csh and its successor, tcsh). The following menu breaks the features up into categories, noting which features were inspired by other shells and which are specific to Bash.

This manual is meant as a brief introduction to features found in Bash. The Bash manual page should be used as the definitive reference on shell behavior.


Next: , Up: Top   [Contents][Index]

1 Introduction


1.1 What is Bash?

Bash is the shell, or command language interpreter, for the GNU operating system. The name is an acronym for the ‘Bourne-Again SHell’, a pun on Stephen Bourne, the author of the direct ancestor of the current Unix shell sh, which appeared in the Seventh Edition Bell Labs Research version of Unix.

Bash is largely compatible with sh and incorporates useful features from the Korn shell ksh and the C shell csh. It is intended to be a conformant implementation of the IEEE POSIX Shell and Tools portion of the IEEE POSIX specification (IEEE Standard 1003.1). It offers functional improvements over sh for both interactive and programming use.

While the GNU operating system provides other shells, including a version of csh, Bash is the default shell. Like other GNU software, Bash is quite portable. It currently runs on nearly every version of Unix and a few other operating systems - independently-supported ports exist for MS-DOS, OS/2, and Windows platforms.


Previous: , Up: Introduction   [Contents][Index]

1.2 What is a shell?

At its base, a shell is simply a macro processor that executes commands. The term macro processor means functionality where text and symbols are expanded to create larger expressions.

A Unix shell is both a command interpreter and a programming language. As a command interpreter, the shell provides the user interface to the rich set of GNU utilities. The programming language features allow these utilities to be combined. Files containing commands can be created, and become commands themselves. These new commands have the same status as system commands in directories such as /bin, allowing users or groups to establish custom environments to automate their common tasks.

Shells may be used interactively or non-interactively. In interactive mode, they accept input typed from the keyboard. When executing non-interactively, shells execute commands read from a file.

A shell allows execution of GNU commands, both synchronously and asynchronously. The shell waits for synchronous commands to complete before accepting more input; asynchronous commands continue to execute in parallel with the shell while it reads and executes additional commands. The redirection constructs permit fine-grained control of the input and output of those commands. Moreover, the shell allows control over the contents of commands’ environments.

Shells also provide a small set of built-in commands (builtins) implementing functionality impossible or inconvenient to obtain via separate utilities. For example, cd, break, continue, and exec cannot be implemented outside of the shell because they directly manipulate the shell itself. The history, getopts, kill, or pwd builtins, among others, could be implemented in separate utilities, but they are more convenient to use as builtin commands. All of the shell builtins are described in subsequent sections.

While executing commands is essential, most of the power (and complexity) of shells is due to their embedded programming languages. Like any high-level language, the shell provides variables, flow control constructs, quoting, and functions.

Shells offer features geared specifically for interactive use rather than to augment the programming language. These interactive features include job control, command line editing, command history and aliases. Each of these features is described in this manual.


Next: , Previous: , Up: Top   [Contents][Index]

2 Definitions

These definitions are used throughout the remainder of this manual.

POSIX

A family of open system standards based on Unix. Bash is primarily concerned with the Shell and Utilities portion of the POSIX 1003.1 standard.

blank

A space or tab character.

builtin

A command that is implemented internally by the shell itself, rather than by an executable program somewhere in the file system.

control operator

A token that performs a control function. It is a newline or one of the following: ‘||’, ‘&&’, ‘&’, ‘;’, ‘;;’, ‘;&’, ‘;;&’, ‘|’, ‘|&’, ‘(’, or ‘)’.

exit status

The value returned by a command to its caller. The value is restricted to eight bits, so the maximum value is 255.

field

A unit of text that is the result of one of the shell expansions. After expansion, when executing a command, the resulting fields are used as the command name and arguments.

filename

A string of characters used to identify a file.

job

A set of processes comprising a pipeline, and any processes descended from it, that are all in the same process group.

job control

A mechanism by which users can selectively stop (suspend) and restart (resume) execution of processes.

metacharacter

A character that, when unquoted, separates words. A metacharacter is a space, tab, newline, or one of the following characters: ‘|’, ‘&’, ‘;’, ‘(’, ‘)’, ‘<’, or ‘>’.

name

A word consisting solely of letters, numbers, and underscores, and beginning with a letter or underscore. Names are used as shell variable and function names. Also referred to as an identifier.

operator

A control operator or a redirection operator. See Redirections, for a list of redirection operators. Operators contain at least one unquoted metacharacter.

process group

A collection of related processes each having the same process group ID.

process group ID

A unique identifier that represents a process group during its lifetime.

reserved word

A word that has a special meaning to the shell. Most reserved words introduce shell flow control constructs, such as for and while.

return status

A synonym for exit status.

signal

A mechanism by which a process may be notified by the kernel of an event occurring in the system.

special builtin

A shell builtin command that has been classified as special by the POSIX standard.

token

A sequence of characters considered a single unit by the shell. It is either a word or an operator.

word

A sequence of characters treated as a unit by the shell. Words may not include unquoted metacharacters.


Next: , Previous: , Up: Top   [Contents][Index]

3 Basic Shell Features

Bash is an acronym for ‘Bourne-Again SHell’. The Bourne shell is the traditional Unix shell originally written by Stephen Bourne. All of the Bourne shell builtin commands are available in Bash, The rules for evaluation and quoting are taken from the POSIX specification for the ‘standard’ Unix shell.

This chapter briefly summarizes the shell’s ‘building blocks’: commands, control structures, shell functions, shell parameters, shell expansions, redirections, which are a way to direct input and output from and to named files, and how the shell executes commands.


3.1 Shell Syntax

When the shell reads input, it proceeds through a sequence of operations. If the input indicates the beginning of a comment, the shell ignores the comment symbol (‘#’), and the rest of that line.

Otherwise, roughly speaking, the shell reads its input and divides the input into words and operators, employing the quoting rules to select which meanings to assign various words and characters.

The shell then parses these tokens into commands and other constructs, removes the special meaning of certain words or characters, expands others, redirects input and output as needed, executes the specified command, waits for the command’s exit status, and makes that exit status available for further inspection or processing.


Next: , Up: Shell Syntax   [Contents][Index]

3.1.1 Shell Operation

The following is a brief description of the shell’s operation when it reads and executes a command. Basically, the shell does the following:

  1. Reads its input from a file (see Shell Scripts), from a string supplied as an argument to the -c invocation option (see Invoking Bash), or from the user’s terminal.
  2. Breaks the input into words and operators, obeying the quoting rules described in Quoting. These tokens are separated by metacharacters. Alias expansion is performed by this step (see Aliases).
  3. Parses the tokens into simple and compound commands (see Shell Commands).
  4. Performs the various shell expansions (see Shell Expansions), breaking the expanded tokens into lists of filenames (see Filename Expansion) and commands and arguments.
  5. Performs any necessary redirections (see Redirections) and removes the redirection operators and their operands from the argument list.
  6. Executes the command (see Executing Commands).
  7. Optionally waits for the command to complete and collects its exit status (see Exit Status).

Next: , Previous: , Up: Shell Syntax   [Contents][Index]

3.1.2 Quoting

Quoting is used to remove the special meaning of certain characters or words to the shell. Quoting can be used to disable special treatment for special characters, to prevent reserved words from being recognized as such, and to prevent parameter expansion.

Each of the shell metacharacters (see Definitions) has special meaning to the shell and must be quoted if it is to represent itself. When the command history expansion facilities are being used (see History Interaction), the history expansion character, usually ‘!’, must be quoted to prevent history expansion. See Bash History Facilities, for more details concerning history expansion.

There are three quoting mechanisms: the escape character, single quotes, and double quotes.


Next: , Up: Quoting   [Contents][Index]

3.1.2.1 Escape Character

A non-quoted backslash ‘\’ is the Bash escape character. It preserves the literal value of the next character that follows, with the exception of newline. If a \newline pair appears, and the backslash itself is not quoted, the \newline is treated as a line continuation (that is, it is removed from the input stream and effectively ignored).


Next: , Previous: , Up: Quoting   [Contents][Index]

3.1.2.2 Single Quotes

Enclosing characters in single quotes (‘'’) preserves the literal value of each character within the quotes. A single quote may not occur between single quotes, even when preceded by a backslash.


Next: , Previous: , Up: Quoting   [Contents][Index]

3.1.2.3 Double Quotes

Enclosing characters in double quotes (‘"’) preserves the literal value of all characters within the quotes, with the exception of ‘$’, ‘`’, ‘\’, and, when history expansion is enabled, ‘!’. When the shell is in POSIX mode (see Bash POSIX Mode), the ‘!’ has no special meaning within double quotes, even when history expansion is enabled. The characters ‘$’ and ‘`’ retain their special meaning within double quotes (see Shell Expansions). The backslash retains its special meaning only when followed by one of the following characters: ‘$’, ‘`’, ‘"’, ‘\’, or newline. Within double quotes, backslashes that are followed by one of these characters are removed. Backslashes preceding characters without a special meaning are left unmodified. A double quote may be quoted within double quotes by preceding it with a backslash. If enabled, history expansion will be performed unless an ‘!’ appearing in double quotes is escaped using a backslash. The backslash preceding the ‘!’ is not removed.

The special parameters ‘*’ and ‘@’ have special meaning when in double quotes (see Shell Parameter Expansion).


Next: , Previous: , Up: Quoting   [Contents][Index]

3.1.2.4 ANSI-C Quoting

Words of the form $'string' are treated specially. The word expands to string, with backslash-escaped characters replaced as specified by the ANSI C standard. Backslash escape sequences, if present, are decoded as follows:

\a

alert (bell)

\b

backspace

\e
\E

an escape character (not ANSI C)

\f

form feed

\n

newline

\r

carriage return

\t

horizontal tab

\v

vertical tab

\\

backslash

\'

single quote

\"

double quote

\?

question mark

\nnn

the eight-bit character whose value is the octal value nnn (one to three digits)

\xHH

the eight-bit character whose value is the hexadecimal value HH (one or two hex digits)

\uHHHH

the Unicode (ISO/IEC 10646) character whose value is the hexadecimal value HHHH (one to four hex digits)

\UHHHHHHHH

the Unicode (ISO/IEC 10646) character whose value is the hexadecimal value HHHHHHHH (one to eight hex digits)

\cx

a control-x character

The expanded result is single-quoted, as if the dollar sign had not been present.


Previous: , Up: Quoting   [Contents][Index]

3.1.2.5 Locale-Specific Translation

A double-quoted string preceded by a dollar sign (‘$’) will cause the string to be translated according to the current locale. If the current locale is C or POSIX, the dollar sign is ignored. If the string is translated and replaced, the replacement is double-quoted.

Some systems use the message catalog selected by the LC_MESSAGES shell variable. Others create the name of the message catalog from the value of the TEXTDOMAIN shell variable, possibly adding a suffix of ‘.mo’. If you use the TEXTDOMAIN variable, you may need to set the TEXTDOMAINDIR variable to the location of the message catalog files. Still others use both variables in this fashion: TEXTDOMAINDIR/LC_MESSAGES/LC_MESSAGES/TEXTDOMAIN.mo.


Previous: , Up: Shell Syntax   [Contents][Index]

3.1.3 Comments

In a non-interactive shell, or an interactive shell in which the interactive_comments option to the shopt builtin is enabled (see The Shopt Builtin), a word beginning with ‘#’ causes that word and all remaining characters on that line to be ignored. An interactive shell without the interactive_comments option enabled does not allow comments. The interactive_comments option is on by default in interactive shells. See Interactive Shells, for a description of what makes a shell interactive.


3.2 Shell Commands

A simple shell command such as echo a b c consists of the command itself followed by arguments, separated by spaces.

More complex shell commands are composed of simple commands arranged together in a variety of ways: in a pipeline in which the output of one command becomes the input of a second, in a loop or conditional construct, or in some other grouping.


3.2.1 Simple Commands

A simple command is the kind of command encountered most often. It’s just a sequence of words separated by blanks, terminated by one of the shell’s control operators (see Definitions). The first word generally specifies a command to be executed, with the rest of the words being that command’s arguments.

The return status (see Exit Status) of a simple command is its exit status as provided by the POSIX 1003.1 waitpid function, or 128+n if the command was terminated by signal n.


Next: , Previous: , Up: Shell Commands   [Contents][Index]

3.2.2 Pipelines

A pipeline is a sequence of one or more commands separated by one of the control operators ‘|’ or ‘|&’.

The format for a pipeline is

[time [-p]] [!] command1 [ | or |& command2 ] …

The output of each command in the pipeline is connected via a pipe to the input of the next command. That is, each command reads the previous command’s output. This connection is performed before any redirections specified by the command.

If ‘|&’ is used, command1’s standard error, in addition to its standard output, is connected to command2’s standard input through the pipe; it is shorthand for 2>&1 |. This implicit redirection of the standard error to the standard output is performed after any redirections specified by the command.

The reserved word time causes timing statistics to be printed for the pipeline once it finishes. The statistics currently consist of elapsed (wall-clock) time and user and system time consumed by the command’s execution. The -p option changes the output format to that specified by POSIX. When the shell is in POSIX mode (see Bash POSIX Mode), it does not recognize time as a reserved word if the next token begins with a ‘-’. The TIMEFORMAT variable may be set to a format string that specifies how the timing information should be displayed. See Bash Variables, for a description of the available formats. The use of time as a reserved word permits the timing of shell builtins, shell functions, and pipelines. An external time command cannot time these easily.

When the shell is in POSIX mode (see Bash POSIX Mode), time may be followed by a newline. In this case, the shell displays the total user and system time consumed by the shell and its children. The TIMEFORMAT variable may be used to specify the format of the time information.

If the pipeline is not executed asynchronously (see Lists), the shell waits for all commands in the pipeline to complete.

Each command in a pipeline is executed in its own subshell (see Command Execution Environment). The exit status of a pipeline is the exit status of the last command in the pipeline, unless the pipefail option is enabled (see The Set Builtin). If pipefail is enabled, the pipeline’s return status is the value of the last (rightmost) command to exit with a non-zero status, or zero if all commands exit successfully. If the reserved word ‘!’ precedes the pipeline, the exit status is the logical negation of the exit status as described above. The shell waits for all commands in the pipeline to terminate before returning a value.


3.2.3 Lists of Commands

A list is a sequence of one or more pipelines separated by one of the operators ‘;’, ‘&’, ‘&&’, or ‘||’, and optionally terminated by one of ‘;’, ‘&’, or a newline.

Of these list operators, ‘&&’ and ‘||’ have equal precedence, followed by ‘;’ and ‘&’, which have equal precedence.

A sequence of one or more newlines may appear in a list to delimit commands, equivalent to a semicolon.

If a command is terminated by the control operator ‘&’, the shell executes the command asynchronously in a subshell. This is known as executing the command in the background. The shell does not wait for the command to finish, and the return status is 0 (true). When job control is not active (see Job Control), the standard input for asynchronous commands, in the absence of any explicit redirections, is redirected from /dev/null.

Commands separated by a ‘;’ are executed sequentially; the shell waits for each command to terminate in turn. The return status is the exit status of the last command executed.

AND and OR lists are sequences of one or more pipelines separated by the control operators ‘&&’ and ‘||’, respectively. AND and OR lists are executed with left associativity.

An AND list has the form

command1 && command2

command2 is executed if, and only if, command1 returns an exit status of zero.

An OR list has the form

command1 || command2

command2 is executed if, and only if, command1 returns a non-zero exit status.

The return status of AND and OR lists is the exit status of the last command executed in the list.


Next: , Previous: , Up: Shell Commands   [Contents][Index]

3.2.4 Compound Commands

Compound commands are the shell programming constructs. Each construct begins with a reserved word or control operator and is terminated by a corresponding reserved word or operator. Any redirections (see Redirections) associated with a compound command apply to all commands within that compound command unless explicitly overridden.

In most cases a list of commands in a compound command’s description may be separated from the rest of the command by one or more newlines, and may be followed by a newline in place of a semicolon.

Bash provides looping constructs, conditional commands, and mechanisms to group commands and execute them as a unit.


3.2.4.1 Looping Constructs

Bash supports the following looping constructs.

Note that wherever a ‘;’ appears in the description of a command’s syntax, it may be replaced with one or more newlines.

until

The syntax of the until command is:

until test-commands; do consequent-commands; done

Execute consequent-commands as long as test-commands has an exit status which is not zero. The return status is the exit status of the last command executed in consequent-commands, or zero if none was executed.

while

The syntax of the while command is:

while test-commands; do consequent-commands; done

Execute consequent-commands as long as test-commands has an exit status of zero. The return status is the exit status of the last command executed in consequent-commands, or zero if none was executed.

for

The syntax of the for command is:

for name [ [in [words …] ] ; ] do commands; done

Expand words, and execute commands once for each member in the resultant list, with name bound to the current member. If ‘in words’ is not present, the for command executes the commands once for each positional parameter that is set, as if ‘in "$@"’ had been specified (see Special Parameters). The return status is the exit status of the last command that executes. If there are no items in the expansion of words, no commands are executed, and the return status is zero.

An alternate form of the for command is also supported:

for (( expr1 ; expr2 ; expr3 )) ; do commands ; done

First, the arithmetic expression expr1 is evaluated according to the rules described below (see Shell Arithmetic). The arithmetic expression expr2 is then evaluated repeatedly until it evaluates to zero. Each time expr2 evaluates to a non-zero value, commands are executed and the arithmetic expression expr3 is evaluated. If any expression is omitted, it behaves as if it evaluates to 1. The return value is the exit status of the last command in commands that is executed, or false if any of the expressions is invalid.

The break and continue builtins (see Bourne Shell Builtins) may be used to control loop execution.


3.2.4.2 Conditional Constructs

if

The syntax of the if command is:

if test-commands; then
  consequent-commands;
[elif more-test-commands; then
  more-consequents;]
[else alternate-consequents;]
fi

The test-commands list is executed, and if its return status is zero, the consequent-commands list is executed. If test-commands returns a non-zero status, each elif list is executed in turn, and if its exit status is zero, the corresponding more-consequents is executed and the command completes. If ‘else alternate-consequents’ is present, and the final command in the final if or elif clause has a non-zero exit status, then alternate-consequents is executed. The return status is the exit status of the last command executed, or zero if no condition tested true.

case

The syntax of the case command is:

case word in [ [(] pattern [| pattern]…) command-list ;;]… esac

case will selectively execute the command-list corresponding to the first pattern that matches word. If the nocasematch shell option (see the description of shopt in The Shopt Builtin) is enabled, the match is performed without regard to the case of alphabetic characters. The ‘|’ is used to separate multiple patterns, and the ‘)’ operator terminates a pattern list. A list of patterns and an associated command-list is known as a clause.

Each clause must be terminated with ‘;;’, ‘;&’, or ‘;;&’. The word undergoes tilde expansion, parameter expansion, command substitution, arithmetic expansion, and quote removal before matching is attempted. Each pattern undergoes tilde expansion, parameter expansion, command substitution, and arithmetic expansion.

There may be an arbitrary number of case clauses, each terminated by a ‘;;’, ‘;&’, or ‘;;&’. The first pattern that matches determines the command-list that is executed. It’s a common idiom to use ‘*’ as the final pattern to define the default case, since that pattern will always match.

Here is an example using case in a script that could be used to describe one interesting feature of an animal:

echo -n "Enter the name of an animal: "
read ANIMAL
echo -n "The $ANIMAL has "
case $ANIMAL in
  horse | dog | cat) echo -n "four";;
  man | kangaroo ) echo -n "two";;
  *) echo -n "an unknown number of";;
esac
echo " legs."

If the ‘;;’ operator is used, no subsequent matches are attempted after the first pattern match. Using ‘;&’ in place of ‘;;’ causes execution to continue with the command-list associated with the next clause, if any. Using ‘;;&’ in place of ‘;;’ causes the shell to test the patterns in the next clause, if any, and execute any associated command-list on a successful match.

The return status is zero if no pattern is matched. Otherwise, the return status is the exit status of the command-list executed.

select

The select construct allows the easy generation of menus. It has almost the same syntax as the for command:

select name [in words …]; do commands; done

The list of words following in is expanded, generating a list of items. The set of expanded words is printed on the standard error output stream, each preceded by a number. If the ‘in words’ is omitted, the positional parameters are printed, as if ‘in "$@"’ had been specified. The PS3 prompt is then displayed and a line is read from the standard input. If the line consists of a number corresponding to one of the displayed words, then the value of name is set to that word. If the line is empty, the words and prompt are displayed again. If EOF is read, the select command completes. Any other value read causes name to be set to null. The line read is saved in the variable REPLY.

The commands are executed after each selection until a break command is executed, at which point the select command completes.

Here is an example that allows the user to pick a filename from the current directory, and displays the name and index of the file selected.

select fname in *;
do
	echo you picked $fname \($REPLY\)
	break;
done
((…))
(( expression ))

The arithmetic expression is evaluated according to the rules described below (see Shell Arithmetic). If the value of the expression is non-zero, the return status is 0; otherwise the return status is 1. This is exactly equivalent to

let "expression"

See Bash Builtins, for a full description of the let builtin.

[[…]]
[[ expression ]]

Return a status of 0 or 1 depending on the evaluation of the conditional expression expression. Expressions are composed of the primaries described below in Bash Conditional Expressions. Word splitting and filename expansion are not performed on the words between the [[ and ]]; tilde expansion, parameter and variable expansion, arithmetic expansion, command substitution, process substitution, and quote removal are performed. Conditional operators such as ‘-f’ must be unquoted to be recognized as primaries.

When used with [[, the ‘<’ and ‘>’ operators sort lexicographically using the current locale.

When the ‘==’ and ‘!=’ operators are used, the string to the right of the operator is considered a pattern and matched according to the rules described below in Pattern Matching, as if the extglob shell option were enabled. The ‘=’ operator is identical to ‘==’. If the nocasematch shell option (see the description of shopt in The Shopt Builtin) is enabled, the match is performed without regard to the case of alphabetic characters. The return value is 0 if the string matches (‘==’) or does not match (‘!=’)the pattern, and 1 otherwise. Any part of the pattern may be quoted to force the quoted portion to be matched as a string.

An additional binary operator, ‘=~’, is available, with the same precedence as ‘==’ and ‘!=’. When it is used, the string to the right of the operator is considered an extended regular expression and matched accordingly (as in regex3)). The return value is 0 if the string matches the pattern, and 1 otherwise. If the regular expression is syntactically incorrect, the conditional expression’s return value is 2. If the nocasematch shell option (see the description of shopt in The Shopt Builtin) is enabled, the match is performed without regard to the case of alphabetic characters. Any part of the pattern may be quoted to force the quoted portion to be matched as a string. Bracket expressions in regular expressions must be treated carefully, since normal quoting characters lose their meanings between brackets. If the pattern is stored in a shell variable, quoting the variable expansion forces the entire pattern to be matched as a string. Substrings matched by parenthesized subexpressions within the regular expression are saved in the array variable BASH_REMATCH. The element of BASH_REMATCH with index 0 is the portion of the string matching the entire regular expression. The element of BASH_REMATCH with index n is the portion of the string matching the nth parenthesized subexpression.

For example, the following will match a line (stored in the shell variable line) if there is a sequence of characters in the value consisting of any number, including zero, of space characters, zero or one instances of ‘a’, then a ‘b’:

[[ $line =~ [[:space:]]*(a)?b ]]

That means values like ‘aab’ and ‘ aaaaaab’ will match, as will a line containing a ‘b’ anywhere in its value.

Storing the regular expression in a shell variable is often a useful way to avoid problems with quoting characters that are special to the shell. It is sometimes difficult to specify a regular expression literally without using quotes, or to keep track of the quoting used by regular expressions while paying attention to the shell’s quote removal. Using a shell variable to store the pattern decreases these problems. For example, the following is equivalent to the above:

pattern='[[:space:]]*(a)?b'
[[ $line =~ $pattern ]]

If you want to match a character that’s special to the regular expression grammar, it has to be quoted to remove its special meaning. This means that in the pattern ‘xxx.txt’, the ‘.’ matches any character in the string (its usual regular expression meaning), but in the pattern ‘"xxx.txt"’ it can only match a literal ‘.’. Shell programmers should take special care with backslashes, since backslashes are used both by the shell and regular expressions to remove the special meaning from the following character. The following two sets of commands are not equivalent:

pattern='\.'

[[ . =~ $pattern ]]
[[ . =~ \. ]]

[[ . =~ "$pattern" ]]
[[ . =~ '\.' ]]

The first two matches will succeed, but the second two will not, because in the second two the backslash will be part of the pattern to be matched. In the first two examples, the backslash removes the special meaning from ‘.’, so the literal ‘.’ matches. If the string in the first examples were anything other than ‘.’, say ‘a’, the pattern would not match, because the quoted ‘.’ in the pattern loses its special meaning of matching any single character.

Expressions may be combined using the following operators, listed in decreasing order of precedence:

( expression )

Returns the value of expression. This may be used to override the normal precedence of operators.

! expression

True if expression is false.

expression1 && expression2

True if both expression1 and expression2 are true.

expression1 || expression2

True if either expression1 or expression2 is true.

The && and || operators do not evaluate expression2 if the value of expression1 is sufficient to determine the return value of the entire conditional expression.


3.2.4.3 Grouping Commands

Bash provides two ways to group a list of commands to be executed as a unit. When commands are grouped, redirections may be applied to the entire command list. For example, the output of all the commands in the list may be redirected to a single stream.

()
( list )

Placing a list of commands between parentheses causes a subshell environment to be created (see Command Execution Environment), and each of the commands in list to be executed in that subshell. Since the list is executed in a subshell, variable assignments do not remain in effect after the subshell completes.

{}
{ list; }

Placing a list of commands between curly braces causes the list to be executed in the current shell context. No subshell is created. The semicolon (or newline) following list is required.

In addition to the creation of a subshell, there is a subtle difference between these two constructs due to historical reasons. The braces are reserved words, so they must be separated from the list by blanks or other shell metacharacters. The parentheses are operators, and are recognized as separate tokens by the shell even if they are not separated from the list by whitespace.

The exit status of both of these constructs is the exit status of list.


3.2.5 Coprocesses

A coprocess is a shell command preceded by the coproc reserved word. A coprocess is executed asynchronously in a subshell, as if the command had been terminated with the ‘&’ control operator, with a two-way pipe established between the executing shell and the coprocess.

The format for a coprocess is:

coproc [NAME] command [redirections]

This creates a coprocess named NAME. If NAME is not supplied, the default name is COPROC. NAME must not be supplied if command is a simple command (see Simple Commands); otherwise, it is interpreted as the first word of the simple command.

When the coprocess is executed, the shell creates an array variable (see Arrays) named NAME in the context of the executing shell. The standard output of command is connected via a pipe to a file descriptor in the executing shell, and that file descriptor is assigned to NAME[0]. The standard input of command is connected via a pipe to a file descriptor in the executing shell, and that file descriptor is assigned to NAME[1]. This pipe is established before any redirections specified by the command (see Redirections). The file descriptors can be utilized as arguments to shell commands and redirections using standard word expansions. The file descriptors are not available in subshells.

The process ID of the shell spawned to execute the coprocess is available as the value of the variable NAME_PID. The wait builtin command may be used to wait for the coprocess to terminate.

Since the coprocess is created as an asynchronous command, the coproc command always returns success. The return status of a coprocess is the exit status of command.


Previous: , Up: Shell Commands   [Contents][Index]

3.2.6 GNU Parallel

There are ways to run commands in parallel that are not built into Bash. GNU Parallel is a tool to do just that.

GNU Parallel, as its name suggests, can be used to build and run commands in parallel. You may run the same command with different arguments, whether they are filenames, usernames, hostnames, or lines read from files. GNU Parallel provides shorthand references to many of the most common operations (input lines, various portions of the input line, different ways to specify the input source, and so on). Parallel can replace xargs or feed commands from its input sources to several different instances of Bash.

For a complete description, refer to the GNU Parallel documentation. A few examples should provide a brief introduction to its use.

For example, it is easy to replace xargs to gzip all html files in the current directory and its subdirectories:

find . -type f -name '*.html' -print | parallel gzip

If you need to protect special characters such as newlines in file names, use find’s -print0 option and parallel’s -0 option.

You can use Parallel to move files from the current directory when the number of files is too large to process with one mv invocation:

ls | parallel mv {} destdir

As you can see, the {} is replaced with each line read from standard input. While using ls will work in most instances, it is not sufficient to deal with all filenames. If you need to accommodate special characters in filenames, you can use

find . -depth 1 \! -name '.*' -print0 | parallel -0 mv {} destdir

as alluded to above.

This will run as many mv commands as there are files in the current directory. You can emulate a parallel xargs by adding the -X option:

find . -depth 1 \! -name '.*' -print0 | parallel -0 -X mv {} destdir

GNU Parallel can replace certain common idioms that operate on lines read from a file (in this case, filenames listed one per line):

	while IFS= read -r x; do
		do-something1 "$x" "config-$x"
		do-something2 < "$x"
	done < file | process-output

with a more compact syntax reminiscent of lambdas:

cat list | parallel "do-something1 {} config-{} ; do-something2 < {}" | process-output

Parallel provides a built-in mechanism to remove filename extensions, which lends itself to batch file transformations or renaming:

ls *.gz | parallel -j+0 "zcat {} | bzip2 >{.}.bz2 && rm {}"

This will recompress all files in the current directory with names ending in .gz using bzip2, running one job per CPU (-j+0) in parallel. (We use ls for brevity here; using find as above is more robust in the face of filenames containing unexpected characters.) Parallel can take arguments from the command line; the above can also be written as

parallel "zcat {} | bzip2 >{.}.bz2 && rm {}" ::: *.gz

If a command generates output, you may want to preserve the input order in the output. For instance, the following command

{ echo foss.org.my ; echo debian.org; echo freenetproject.org; } | parallel traceroute

will display as output the traceroute invocation that finishes first. Adding the -k option

{ echo foss.org.my ; echo debian.org; echo freenetproject.org; } | parallel -k traceroute

will ensure that the output of traceroute foss.org.my is displayed first.

Finally, Parallel can be used to run a sequence of shell commands in parallel, similar to ‘cat file | bash’. It is not uncommon to take a list of filenames, create a series of shell commands to operate on them, and feed that list of commnds to a shell. Parallel can speed this up. Assuming that file contains a list of shell commands, one per line,

parallel -j 10 < file

will evaluate the commands using the shell (since no explicit command is supplied as an argument), in blocks of ten shell jobs at a time.


3.3 Shell Functions

Shell functions are a way to group commands for later execution using a single name for the group. They are executed just like a "regular" command. When the name of a shell function is used as a simple command name, the list of commands associated with that function name is executed. Shell functions are executed in the current shell context; no new process is created to interpret them.

Functions are declared using this syntax:

name () compound-command [ redirections ]

or

function name [()] compound-command [ redirections ]

This defines a shell function named name. The reserved word function is optional. If the function reserved word is supplied, the parentheses are optional. The body of the function is the compound command compound-command (see Compound Commands). That command is usually a list enclosed between { and }, but may be any compound command listed above, with one exception: If the function reserved word is used, but the parentheses are not supplied, the braces are required. compound-command is executed whenever name is specified as the name of a command. When the shell is in POSIX mode (see Bash POSIX Mode), name may not be the same as one of the special builtins (see Special Builtins). Any redirections (see Redirections) associated with the shell function are performed when the function is executed.

A function definition may be deleted using the -f option to the unset builtin (see Bourne Shell Builtins).

The exit status of a function definition is zero unless a syntax error occurs or a readonly function with the same name already exists. When executed, the exit status of a function is the exit status of the last command executed in the body.

Note that for historical reasons, in the most common usage the curly braces that surround the body of the function must be separated from the body by blanks or newlines. This is because the braces are reserved words and are only recognized as such when they are separated from the command list by whitespace or another shell metacharacter. Also, when using the braces, the list must be terminated by a semicolon, a ‘&’, or a newline.

When a function is executed, the arguments to the function become the positional parameters during its execution (see Positional Parameters). The special parameter ‘#’ that expands to the number of positional parameters is updated to reflect the change. Special parameter 0 is unchanged. The first element of the FUNCNAME variable is set to the name of the function while the function is executing.

All other aspects of the shell execution environment are identical between a function and its caller with these exceptions: the DEBUG and RETURN traps are not inherited unless the function has been given the trace attribute using the declare builtin or the -o functrace option has been enabled with the set builtin, (in which case all functions inherit the DEBUG and RETURN traps), and the ERR trap is not inherited unless the -o errtrace shell option has been enabled. See Bourne Shell Builtins, for the description of the trap builtin.

The FUNCNEST variable, if set to a numeric value greater than 0, defines a maximum function nesting level. Function invocations that exceed the limit cause the entire command to abort.

If the builtin command return is executed in a function, the function completes and execution resumes with the next command after the function call. Any command associated with the RETURN trap is executed before execution resumes. When a function completes, the values of the positional parameters and the special parameter ‘#’ are restored to the values they had prior to the function’s execution. If a numeric argument is given to return, that is the function’s return status; otherwise the function’s return status is the exit status of the last command executed before the return.

Variables local to the function may be declared with the local builtin. These variables are visible only to the function and the commands it invokes.

Function names and definitions may be listed with the -f option to the declare (typeset) builtin command (see Bash Builtins). The -F option to declare or typeset will list the function names only (and optionally the source file and line number, if the extdebug shell option is enabled). Functions may be exported so that subshells automatically have them defined with the -f option to the export builtin (see Bourne Shell Builtins). Note that shell functions and variables with the same name may result in multiple identically-named entries in the environment passed to the shell’s children. Care should be taken in cases where this may cause a problem.

Functions may be recursive. The FUNCNEST variable may be used to limit the depth of the function call stack and restrict the number of function invocations. By default, no limit is placed on the number of recursive calls.


3.4 Shell Parameters

A parameter is an entity that stores values. It can be a name, a number, or one of the special characters listed below. A variable is a parameter denoted by a name. A variable has a value and zero or more attributes. Attributes are assigned using the declare builtin command (see the description of the declare builtin in Bash Builtins).

A parameter is set if it has been assigned a value. The null string is a valid value. Once a variable is set, it may be unset only by using the unset builtin command.

A variable may be assigned to by a statement of the form

name=[value]

If value is not given, the variable is assigned the null string. All values undergo tilde expansion, parameter and variable expansion, command substitution, arithmetic expansion, and quote removal (detailed below). If the variable has its integer attribute set, then value is evaluated as an arithmetic expression even if the $((…)) expansion is not used (see Arithmetic Expansion). Word splitting is not performed, with the exception of "$@" as explained below. Filename expansion is not performed. Assignment statements may also appear as arguments to the alias, declare, typeset, export, readonly, and local builtin commands (declaration commands). When in POSIX mode (see Bash POSIX Mode), these builtins may appear in a command after one or more instances of the command builtin and retain these assignment statement properties.

In the context where an assignment statement is assigning a value to a shell variable or array index (see Arrays), the ‘+=’ operator can be used to append to or add to the variable’s previous value. This includes arguments to builtin commands such as declare that accept assignment statements (declaration commands). When ‘+=’ is applied to a variable for which the integer attribute has been set, value is evaluated as an arithmetic expression and added to the variable’s current value, which is also evaluated. When ‘+=’ is applied to an array variable using compound assignment (see Arrays), the variable’s value is not unset (as it is when using ‘=’), and new values are appended to the array beginning at one greater than the array’s maximum index (for indexed arrays), or added as additional key-value pairs in an associative array. When applied to a string-valued variable, value is expanded and appended to the variable’s value.

A variable can be assigned the nameref attribute using the -n option to the declare or local builtin commands (see Bash Builtins) to create a nameref, or a reference to another variable. This allows variables to be manipulated indirectly. Whenever the nameref variable is referenced, assigned to, unset, or has its attributes modified (other than using or changing the nameref attribute itself), the operation is actually performed on the variable specified by the nameref variable’s value. A nameref is commonly used within shell functions to refer to a variable whose name is passed as an argument to the function. For instance, if a variable name is passed to a shell function as its first argument, running

declare -n ref=$1

inside the function creates a nameref variable ref whose value is the variable name passed as the first argument. References and assignments to ref, and changes to its attributes, are treated as references, assignments, and attribute modifications to the variable whose name was passed as $1.

If the control variable in a for loop has the nameref attribute, the list of words can be a list of shell variables, and a name reference will be established for each word in the list, in turn, when the loop is executed. Array variables cannot be given the nameref attribute. However, nameref variables can reference array variables and subscripted array variables. Namerefs can be unset using the -n option to the unset builtin (see Bourne Shell Builtins). Otherwise, if unset is executed with the name of a nameref variable as an argument, the variable referenced by the nameref variable will be unset.


3.4.1 Positional Parameters

A positional parameter is a parameter denoted by one or more digits, other than the single digit 0. Positional parameters are assigned from the shell’s arguments when it is invoked, and may be reassigned using the set builtin command. Positional parameter N may be referenced as ${N}, or as $N when N consists of a single digit. Positional parameters may not be assigned to with assignment statements. The set and shift builtins are used to set and unset them (see Shell Builtin Commands). The positional parameters are temporarily replaced when a shell function is executed (see Shell Functions).

When a positional parameter consisting of more than a single digit is expanded, it must be enclosed in braces.


3.4.2 Special Parameters

The shell treats several parameters specially. These parameters may only be referenced; assignment to them is not allowed.

*

($*) Expands to the positional parameters, starting from one. When the expansion is not within double quotes, each positional parameter expands to a separate word. In contexts where it is performed, those words are subject to further word splitting and pathname expansion. When the expansion occurs within double quotes, it expands to a single word with the value of each parameter separated by the first character of the IFS special variable. That is, "$*" is equivalent to "$1c$2c…", where c is the first character of the value of the IFS variable. If IFS is unset, the parameters are separated by spaces. If IFS is null, the parameters are joined without intervening separators.

@

($@) Expands to the positional parameters, starting from one. When the expansion occurs within double quotes, each parameter expands to a separate word. That is, "$@" is equivalent to "$1" "$2" …. If the double-quoted expansion occurs within a word, the expansion of the first parameter is joined with the beginning part of the original word, and the expansion of the last parameter is joined with the last part of the original word. When there are no positional parameters, "$@" and $@ expand to nothing (i.e., they are removed).

#

($#) Expands to the number of positional parameters in decimal.

?

($?) Expands to the exit status of the most recently executed foreground pipeline.

-

($-, a hyphen.) Expands to the current option flags as specified upon invocation, by the set builtin command, or those set by the shell itself (such as the -i option).

$

($$) Expands to the process ID of the shell. In a () subshell, it expands to the process ID of the invoking shell, not the subshell.

!

($!) Expands to the process ID of the job most recently placed into the background, whether executed as an asynchronous command or using the bg builtin (see Job Control Builtins).

0

($0) Expands to the name of the shell or shell script. This is set at shell initialization. If Bash is invoked with a file of commands (see Shell Scripts), $0 is set to the name of that file. If Bash is started with the -c option (see Invoking Bash), then $0 is set to the first argument after the string to be executed, if one is present. Otherwise, it is set to the filename used to invoke Bash, as given by argument zero.

_

($_, an underscore.) At shell startup, set to the absolute pathname used to invoke the shell or shell script being executed as passed in the environment or argument list. Subsequently, expands to the last argument to the previous command, after expansion. Also set to the full pathname used to invoke each command executed and placed in the environment exported to that command. When checking mail, this parameter holds the name of the mail file.


3.5 Shell Expansions

Expansion is performed on the command line after it has been split into tokens. There are seven kinds of expansion performed:

  • brace expansion
  • tilde expansion
  • parameter and variable expansion
  • command substitution
  • arithmetic expansion
  • word splitting
  • filename expansion

The order of expansions is: brace expansion; tilde expansion, parameter and variable expansion, arithmetic expansion, and command substitution (done in a left-to-right fashion); word splitting; and filename expansion.

On systems that can support it, there is an additional expansion available: process substitution. This is performed at the same time as tilde, parameter, variable, and arithmetic expansion and command substitution.

After these expansions are performed, quote characters present in the original word are removed unless they have been quoted themselves (quote removal).

Only brace expansion, word splitting, and filename expansion can change the number of words of the expansion; other expansions expand a single word to a single word. The only exceptions to this are the expansions of "$@" (see Special Parameters) and "${name[@]}" (see Arrays).

After all expansions, quote removal (see Quote Removal) is performed.


3.5.1 Brace Expansion

Brace expansion is a mechanism by which arbitrary strings may be generated. This mechanism is similar to filename expansion (see Filename Expansion), but the filenames generated need not exist. Patterns to be brace expanded take the form of an optional preamble, followed by either a series of comma-separated strings or a sequence expression between a pair of braces, followed by an optional postscript. The preamble is prefixed to each string contained within the braces, and the postscript is then appended to each resulting string, expanding left to right.

Brace expansions may be nested. The results of each expanded string are not sorted; left to right order is preserved. For example,

bash$ echo a{d,c,b}e
ade ace abe

A sequence expression takes the form {x..y[..incr]}, where x and y are either integers or single characters, and incr, an optional increment, is an integer. When integers are supplied, the expression expands to each number between x and y, inclusive. Supplied integers may be prefixed with ‘0’ to force each term to have the same width. When either x or y begins with a zero, the shell attempts to force all generated terms to contain the same number of digits, zero-padding where necessary. When characters are supplied, the expression expands to each character lexicographically between x and y, inclusive, using the default C locale. Note that both x and y must be of the same type. When the increment is supplied, it is used as the difference between each term. The default increment is 1 or -1 as appropriate.

Brace expansion is performed before any other expansions, and any characters special to other expansions are preserved in the result. It is strictly textual. Bash does not apply any syntactic interpretation to the context of the expansion or the text between the braces. To avoid conflicts with parameter expansion, the string ‘${’ is not considered eligible for brace expansion.

A correctly-formed brace expansion must contain unquoted opening and closing braces, and at least one unquoted comma or a valid sequence expression. Any incorrectly formed brace expansion is left unchanged.

A { or ‘,’ may be quoted with a backslash to prevent its being considered part of a brace expression. To avoid conflicts with parameter expansion, the string ‘${’ is not considered eligible for brace expansion.

This construct is typically used as shorthand when the common prefix of the strings to be generated is longer than in the above example:

mkdir /usr/local/src/bash/{old,new,dist,bugs}

or

chown root /usr/{ucb/{ex,edit},lib/{ex?.?*,how_ex}}

3.5.2 Tilde Expansion

If a word begins with an unquoted tilde character (‘~’), all of the characters up to the first unquoted slash (or all characters, if there is no unquoted slash) are considered a tilde-prefix. If none of the characters in the tilde-prefix are quoted, the characters in the tilde-prefix following the tilde are treated as a possible login name. If this login name is the null string, the tilde is replaced with the value of the HOME shell variable. If HOME is unset, the home directory of the user executing the shell is substituted instead. Otherwise, the tilde-prefix is replaced with the home directory associated with the specified login name.

If the tilde-prefix is ‘~+’, the value of the shell variable PWD replaces the tilde-prefix. If the tilde-prefix is ‘~-’, the value of the shell variable OLDPWD, if it is set, is substituted.

If the characters following the tilde in the tilde-prefix consist of a number N, optionally prefixed by a ‘+’ or a ‘-’, the tilde-prefix is replaced with the corresponding element from the directory stack, as it would be displayed by the dirs builtin invoked with the characters following tilde in the tilde-prefix as an argument (see The Directory Stack). If the tilde-prefix, sans the tilde, consists of a number without a leading ‘+’ or ‘-’, ‘+’ is assumed.

If the login name is invalid, or the tilde expansion fails, the word is left unchanged.

Each variable assignment is checked for unquoted tilde-prefixes immediately following a ‘:’ or the first ‘=’. In these cases, tilde expansion is also performed. Consequently, one may use filenames with tildes in assignments to PATH, MAILPATH, and CDPATH, and the shell assigns the expanded value.

The following table shows how Bash treats unquoted tilde-prefixes:

~

The value of $HOME

~/foo

$HOME/foo

~fred/foo

The subdirectory foo of the home directory of the user fred

~+/foo

$PWD/foo

~-/foo

${OLDPWD-'~-'}/foo

~N

The string that would be displayed by ‘dirs +N

~+N

The string that would be displayed by ‘dirs +N

~-N

The string that would be displayed by ‘dirs -N


3.5.3 Shell Parameter Expansion

The ‘$’ character introduces parameter expansion, command substitution, or arithmetic expansion. The parameter name or symbol to be expanded may be enclosed in braces, which are optional but serve to protect the variable to be expanded from characters immediately following it which could be interpreted as part of the name.

When braces are used, the matching ending brace is the first ‘}’ not escaped by a backslash or within a quoted string, and not within an embedded arithmetic expansion, command substitution, or parameter expansion.

The basic form of parameter expansion is ${parameter}. The value of parameter is substituted. The parameter is a shell parameter as described above (see Shell Parameters) or an array reference (see Arrays). The braces are required when parameter is a positional parameter with more than one digit, or when parameter is followed by a character that is not to be interpreted as part of its name.

If the first character of parameter is an exclamation point (!), and parameter is not a nameref, it introduces a level of variable indirection. Bash uses the value of the variable formed from the rest of parameter as the name of the variable; this variable is then expanded and that value is used in the rest of the substitution, rather than the value of parameter itself. This is known as indirect expansion. If parameter is a nameref, this expands to the name of the variable referenced by parameter instead of performing the complete indirect expansion. The exceptions to this are the expansions of ${!prefix*} and ${!name[@]} described below. The exclamation point must immediately follow the left brace in order to introduce indirection.

In each of the cases below, word is subject to tilde expansion, parameter expansion, command substitution, and arithmetic expansion.

When not performing substring expansion, using the form described below (e.g., ‘:-’), Bash tests for a parameter that is unset or null. Omitting the colon results in a test only for a parameter that is unset. Put another way, if the colon is included, the operator tests for both parameter’s existence and that its value is not null; if the colon is omitted, the operator tests only for existence.

${parameter:-word}

If parameter is unset or null, the expansion of word is substituted. Otherwise, the value of parameter is substituted.

${parameter:=word}

If parameter is unset or null, the expansion of word is assigned to parameter. The value of parameter is then substituted. Positional parameters and special parameters may not be assigned to in this way.

${parameter:?word}

If parameter is null or unset, the expansion of word (or a message to that effect if word is not present) is written to the standard error and the shell, if it is not interactive, exits. Otherwise, the value of parameter is substituted.

${parameter:+word}

If parameter is null or unset, nothing is substituted, otherwise the expansion of word is substituted.

${parameter:offset}
${parameter:offset:length}

This is referred to as Substring Expansion. It expands to up to length characters of the value of parameter starting at the character specified by offset. If parameter is ‘@’, an indexed array subscripted by ‘@’ or ‘*’, or an associative array name, the results differ as described below. If length is omitted, it expands to the substring of the value of parameter starting at the character specified by offset and extending to the end of the value. length and offset are arithmetic expressions (see Shell Arithmetic).

If offset evaluates to a number less than zero, the value is used as an offset in characters from the end of the value of parameter. If length evaluates to a number less than zero, it is interpreted as an offset in characters from the end of the value of parameter rather than a number of characters, and the expansion is the characters between offset and that result. Note that a negative offset must be separated from the colon by at least one space to avoid being confused with the ‘:-’ expansion.

Here are some examples illustrating substring expansion on parameters and subscripted arrays:

$ string=01234567890abcdefgh
$ echo ${string:7}
7890abcdefgh
$ echo ${string:7:0}

$ echo ${string:7:2}
78
$ echo ${string:7:-2}
7890abcdef
$ echo ${string: -7}
bcdefgh
$ echo ${string: -7:0}

$ echo ${string: -7:2}
bc
$ echo ${string: -7:-2}
bcdef
$ set -- 01234567890abcdefgh
$ echo ${1:7}
7890abcdefgh
$ echo ${1:7:0}

$ echo ${1:7:2}
78
$ echo ${1:7:-2}
7890abcdef
$ echo ${1: -7}
bcdefgh
$ echo ${1: -7:0}

$ echo ${1: -7:2}
bc
$ echo ${1: -7:-2}
bcdef
$ array[0]=01234567890abcdefgh
$ echo ${array[0]:7}
7890abcdefgh
$ echo ${array[0]:7:0}

$ echo ${array[0]:7:2}
78
$ echo ${array[0]:7:-2}
7890abcdef
$ echo ${array[0]: -7}
bcdefgh
$ echo ${array[0]: -7:0}

$ echo ${array[0]: -7:2}
bc
$ echo ${array[0]: -7:-2}
bcdef

If parameter is ‘@’, the result is length positional parameters beginning at offset. A negative offset is taken relative to one greater than the greatest positional parameter, so an offset of -1 evaluates to the last positional parameter. It is an expansion error if length evaluates to a number less than zero.

The following examples illustrate substring expansion using positional parameters:

$ set -- 1 2 3 4 5 6 7 8 9 0 a b c d e f g h
$ echo ${@:7}
7 8 9 0 a b c d e f g h
$ echo ${@:7:0}

$ echo ${@:7:2}
7 8
$ echo ${@:7:-2}
bash: -2: substring expression < 0
$ echo ${@: -7:2}
b c
$ echo ${@:0}
./bash 1 2 3 4 5 6 7 8 9 0 a b c d e f g h
$ echo ${@:0:2}
./bash 1
$ echo ${@: -7:0}

If parameter is an indexed array name subscripted by ‘@’ or ‘*’, the result is the length members of the array beginning with ${parameter[offset]}. A negative offset is taken relative to one greater than the maximum index of the specified array. It is an expansion error if length evaluates to a number less than zero.

These examples show how you can use substring expansion with indexed arrays:

$ array=(0 1 2 3 4 5 6 7 8 9 0 a b c d e f g h)
$ echo ${array[@]:7}
7 8 9 0 a b c d e f g h
$ echo ${array[@]:7:2}
7 8
$ echo ${array[@]: -7:2}
b c
$ echo ${array[@]: -7:-2}
bash: -2: substring expression < 0
$ echo ${array[@]:0}
0 1 2 3 4 5 6 7 8 9 0 a b c d e f g h
$ echo ${array[@]:0:2}
0 1
$ echo ${array[@]: -7:0}

Substring expansion applied to an associative array produces undefined results.

Substring indexing is zero-based unless the positional parameters are used, in which case the indexing starts at 1 by default. If offset is 0, and the positional parameters are used, $@ is prefixed to the list.

${!prefix*}
${!prefix@}

Expands to the names of variables whose names begin with prefix, separated by the first character of the IFS special variable. When ‘@’ is used and the expansion appears within double quotes, each variable name expands to a separate word.

${!name[@]}
${!name[*]}

If name is an array variable, expands to the list of array indices (keys) assigned in name. If name is not an array, expands to 0 if name is set and null otherwise. When ‘@’ is used and the expansion appears within double quotes, each key expands to a separate word.

${#parameter}

The length in characters of the expanded value of parameter is substituted. If parameter is ‘*’ or ‘@’, the value substituted is the number of positional parameters. If parameter is an array name subscripted by ‘*’ or ‘@’, the value substituted is the number of elements in the array. If parameter is an indexed array name subscripted by a negative number, that number is interpreted as relative to one greater than the maximum index of parameter, so negative indices count back from the end of the array, and an index of -1 references the last element.

${parameter#word}
${parameter##word}

The word is expanded to produce a pattern just as in filename expansion (see Filename Expansion). If the pattern matches the beginning of the expanded value of parameter, then the result of the expansion is the expanded value of parameter with the shortest matching pattern (the ‘#’ case) or the longest matching pattern (the ‘##’ case) deleted. If parameter is ‘@’ or ‘*’, the pattern removal operation is applied to each positional parameter in turn, and the expansion is the resultant list. If parameter is an array variable subscripted with ‘@’ or ‘*’, the pattern removal operation is applied to each member of the array in turn, and the expansion is the resultant list.

${parameter%word}
${parameter%%word}

The word is expanded to produce a pattern just as in filename expansion. If the pattern matches a trailing portion of the expanded value of parameter, then the result of the expansion is the value of parameter with the shortest matching pattern (the ‘%’ case) or the longest matching pattern (the ‘%%’ case) deleted. If parameter is ‘@’ or ‘*’, the pattern removal operation is applied to each positional parameter in turn, and the expansion is the resultant list. If parameter is an array variable subscripted with ‘@’ or ‘*’, the pattern removal operation is applied to each member of the array in turn, and the expansion is the resultant list.

${parameter/pattern/string}

The pattern is expanded to produce a pattern just as in filename expansion. Parameter is expanded and the longest match of pattern against its value is replaced with string. If pattern begins with ‘/’, all matches of pattern are replaced with string. Normally only the first match is replaced. If pattern begins with ‘#’, it must match at the beginning of the expanded value of parameter. If pattern begins with ‘%’, it must match at the end of the expanded value of parameter. If string is null, matches of pattern are deleted and the / following pattern may be omitted. If the nocasematch shell option (see the description of shopt in The Shopt Builtin) is enabled, the match is performed without regard to the case of alphabetic characters. If parameter is ‘@’ or ‘*’, the substitution operation is applied to each positional parameter in turn, and the expansion is the resultant list. If parameter is an array variable subscripted with ‘@’ or ‘*’, the substitution operation is applied to each member of the array in turn, and the expansion is the resultant list.

${parameter^pattern}
${parameter^^pattern}
${parameter,pattern}
${parameter,,pattern}

This expansion modifies the case of alphabetic characters in parameter. The pattern is expanded to produce a pattern just as in filename expansion. Each character in the expanded value of parameter is tested against pattern, and, if it matches the pattern, its case is converted. The pattern should not attempt to match more than one character. The ‘^’ operator converts lowercase letters matching pattern to uppercase; the ‘,’ operator converts matching uppercase letters to lowercase. The ‘^^’ and ‘,,’ expansions convert each matched character in the expanded value; the ‘^’ and ‘,’ expansions match and convert only the first character in the expanded value. If pattern is omitted, it is treated like a ‘?’, which matches every character. If parameter is ‘@’ or ‘*’, the case modification operation is applied to each positional parameter in turn, and the expansion is the resultant list. If parameter is an array variable subscripted with ‘@’ or ‘*’, the case modification operation is applied to each member of the array in turn, and the expansion is the resultant list.

${parameter@operator}

The expansion is either a transformation of the value of parameter or information about parameter itself, depending on the value of operator. Each operator is a single letter:

Q

The expansion is a string that is the value of parameter quoted in a format that can be reused as input.

E

The expansion is a string that is the value of parameter with backslash escape sequences expanded as with the $'…' quoting mechansim.

P

The expansion is a string that is the result of expanding the value of parameter as if it were a prompt string (see Controlling the Prompt).

A

The expansion is a string in the form of an assignment statement or declare command that, if evaluated, will recreate parameter with its attributes and value.

a

The expansion is a string consisting of flag values representing parameter’s attributes.

If parameter is ‘@’ or ‘*’, the operation is applied to each positional parameter in turn, and the expansion is the resultant list. If parameter is an array variable subscripted with ‘@’ or ‘*’, the operation is applied to each member of the array in turn, and the expansion is the resultant list.

The result of the expansion is subject to word splitting and pathname expansion as described below.


3.5.4 Command Substitution

Command substitution allows the output of a command to replace the command itself. Command substitution occurs when a command is enclosed as follows:

$(command)

or

`command`

Bash performs the expansion by executing command in a subshell environment and replacing the command substitution with the standard output of the command, with any trailing newlines deleted. Embedded newlines are not deleted, but they may be removed during word splitting. The command substitution $(cat file) can be replaced by the equivalent but faster $(< file).

When the old-style backquote form of substitution is used, backslash retains its literal meaning except when followed by ‘$’, ‘`’, or ‘\’. The first backquote not preceded by a backslash terminates the command substitution. When using the $(command) form, all characters between the parentheses make up the command; none are treated specially.

Command substitutions may be nested. To nest when using the backquoted form, escape the inner backquotes with backslashes.

If the substitution appears within double quotes, word splitting and filename expansion are not performed on the results.


3.5.5 Arithmetic Expansion

Arithmetic expansion allows the evaluation of an arithmetic expression and the substitution of the result. The format for arithmetic expansion is:

$(( expression ))

The expression is treated as if it were within double quotes, but a double quote inside the parentheses is not treated specially. All tokens in the expression undergo parameter and variable expansion, command substitution, and quote removal. The result is treated as the arithmetic expression to be evaluated. Arithmetic expansions may be nested.

The evaluation is performed according to the rules listed below (see Shell Arithmetic). If the expression is invalid, Bash prints a message indicating failure to the standard error and no substitution occurs.


3.5.6 Process Substitution

Process substitution allows a process’s input or output to be referred to using a filename. It takes the form of

<(list)

or

>(list)

The process list is run asynchronously, and its input or output appears as a filename. This filename is passed as an argument to the current command as the result of the expansion. If the >(list) form is used, writing to the file will provide input for list. If the <(list) form is used, the file passed as an argument should be read to obtain the output of list. Note that no space may appear between the < or > and the left parenthesis, otherwise the construct would be interpreted as a redirection. Process substitution is supported on systems that support named pipes (FIFOs) or the /dev/fd method of naming open files.

When available, process substitution is performed simultaneously with parameter and variable expansion, command substitution, and arithmetic expansion.


3.5.7 Word Splitting

The shell scans the results of parameter expansion, command substitution, and arithmetic expansion that did not occur within double quotes for word splitting.

The shell treats each character of $IFS as a delimiter, and splits the results of the other expansions into words using these characters as field terminators. If IFS is unset, or its value is exactly <space><tab><newline>, the default, then sequences of <space>, <tab>, and <newline> at the beginning and end of the results of the previous expansions are ignored, and any sequence of IFS characters not at the beginning or end serves to delimit words. If IFS has a value other than the default, then sequences of the whitespace characters space, tab, and newline are ignored at the beginning and end of the word, as long as the whitespace character is in the value of IFS (an IFS whitespace character). Any character in IFS that is not IFS whitespace, along with any adjacent IFS whitespace characters, delimits a field. A sequence of IFS whitespace characters is also treated as a delimiter. If the value of IFS is null, no word splitting occurs.

Explicit null arguments ("" or '') are retained and passed to commands as empty strings. Unquoted implicit null arguments, resulting from the expansion of parameters that have no values, are removed. If a parameter with no value is expanded within double quotes, a null argument results and is retained and passed to a command as an empty string. When a quoted null argument appears as part of a word whose expansion is non-null, the null argument is removed. That is, the word -d'' becomes -d after word splitting and null argument removal.

Note that if no expansion occurs, no splitting is performed.


3.5.8 Filename Expansion

After word splitting, unless the -f option has been set (see The Set Builtin), Bash scans each word for the characters ‘*’, ‘?’, and ‘[’. If one of these characters appears, then the word is regarded as a pattern, and replaced with an alphabetically sorted list of filenames matching the pattern (see Pattern Matching). If no matching filenames are found, and the shell option nullglob is disabled, the word is left unchanged. If the nullglob option is set, and no matches are found, the word is removed. If the failglob shell option is set, and no matches are found, an error message is printed and the command is not executed. If the shell option nocaseglob is enabled, the match is performed without regard to the case of alphabetic characters.

When a pattern is used for filename expansion, the character ‘.’ at the start of a filename or immediately following a slash must be matched explicitly, unless the shell option dotglob is set. When matching a filename, the slash character must always be matched explicitly. In other cases, the ‘.’ character is not treated specially.

See the description of shopt in The Shopt Builtin, for a description of the nocaseglob, nullglob, failglob, and dotglob options.

The GLOBIGNORE shell variable may be used to restrict the set of filenames matching a pattern. If GLOBIGNORE is set, each matching filename that also matches one of the patterns in GLOBIGNORE is removed from the list of matches. If the nocaseglob option is set, the matching against the patterns in GLOBIGNORE is performed without regard to case. The filenames . and .. are always ignored when GLOBIGNORE is set and not null. However, setting GLOBIGNORE to a non-null value has the effect of enabling the dotglob shell option, so all other filenames beginning with a ‘.’ will match. To get the old behavior of ignoring filenames beginning with a ‘.’, make ‘.*’ one of the patterns in GLOBIGNORE. The dotglob option is disabled when GLOBIGNORE is unset.


3.5.8.1 Pattern Matching

Any character that appears in a pattern, other than the special pattern characters described below, matches itself. The NUL character may not occur in a pattern. A backslash escapes the following character; the escaping backslash is discarded when matching. The special pattern characters must be quoted if they are to be matched literally.

The special pattern characters have the following meanings:

*

Matches any string, including the null string. When the globstar shell option is enabled, and ‘*’ is used in a filename expansion context, two adjacent ‘*’s used as a single pattern will match all files and zero or more directories and subdirectories. If followed by a ‘/’, two adjacent ‘*’s will match only directories and subdirectories.

?

Matches any single character.

[…]

Matches any one of the enclosed characters. A pair of characters separated by a hyphen denotes a range expression; any character that falls between those two characters, inclusive, using the current locale’s collating sequence and character set, is matched. If the first character following the ‘[’ is a ‘!’ or a ‘^’ then any character not enclosed is matched. A ‘-’ may be matched by including it as the first or last character in the set. A ‘]’ may be matched by including it as the first character in the set. The sorting order of characters in range expressions is determined by the current locale and the values of the LC_COLLATE and LC_ALL shell variables, if set.

For example, in the default C locale, ‘[a-dx-z]’ is equivalent to ‘[abcdxyz]’. Many locales sort characters in dictionary order, and in these locales ‘[a-dx-z]’ is typically not equivalent to ‘[abcdxyz]’; it might be equivalent to ‘[aBbCcDdxXyYz]’, for example. To obtain the traditional interpretation of ranges in bracket expressions, you can force the use of the C locale by setting the LC_COLLATE or LC_ALL environment variable to the value ‘C’, or enable the globasciiranges shell option.

Within ‘[’ and ‘]’, character classes can be specified using the syntax [:class:], where class is one of the following classes defined in the POSIX standard:

alnum   alpha   ascii   blank   cntrl   digit   graph   lower
print   punct   space   upper   word    xdigit

A character class matches any character belonging to that class. The word character class matches letters, digits, and the character ‘_’.

Within ‘[’ and ‘]’, an equivalence class can be specified using the syntax [=c=], which matches all characters with the same collation weight (as defined by the current locale) as the character c.

Within ‘[’ and ‘]’, the syntax [.symbol.] matches the collating symbol symbol.

If the extglob shell option is enabled using the shopt builtin, several extended pattern matching operators are recognized. In the following description, a pattern-list is a list of one or more patterns separated by a ‘|’. Composite patterns may be formed using one or more of the following sub-patterns:

?(pattern-list)

Matches zero or one occurrence of the given patterns.

*(pattern-list)

Matches zero or more occurrences of the given patterns.

+(pattern-list)

Matches one or more occurrences of the given patterns.

@(pattern-list)

Matches one of the given patterns.

!(pattern-list)

Matches anything except one of the given patterns.


3.5.9 Quote Removal

After the preceding expansions, all unquoted occurrences of the characters ‘\’, ‘'’, and ‘"’ that did not result from one of the above expansions are removed.


3.6 Redirections

Before a command is executed, its input and output may be redirected using a special notation interpreted by the shell. Redirection allows commands’ file handles to be duplicated, opened, closed, made to refer to different files, and can change the files the command reads from and writes to. Redirection may also be used to modify file handles in the current shell execution environment. The following redirection operators may precede or appear anywhere within a simple command or may follow a command. Redirections are processed in the order they appear, from left to right.

Each redirection that may be preceded by a file descriptor number may instead be preceded by a word of the form {varname}. In this case, for each redirection operator except >&- and <&-, the shell will allocate a file descriptor greater than 10 and assign it to {varname}. If >&- or <&- is preceded by {varname}, the value of varname defines the file descriptor to close.

In the following descriptions, if the file descriptor number is omitted, and the first character of the redirection operator is ‘<’, the redirection refers to the standard input (file descriptor 0). If the first character of the redirection operator is ‘>’, the redirection refers to the standard output (file descriptor 1).

The word following the redirection operator in the following descriptions, unless otherwise noted, is subjected to brace expansion, tilde expansion, parameter expansion, command substitution, arithmetic expansion, quote removal, filename expansion, and word splitting. If it expands to more than one word, Bash reports an error.

Note that the order of redirections is significant. For example, the command

ls > dirlist 2>&1

directs both standard output (file descriptor 1) and standard error (file descriptor 2) to the file dirlist, while the command

ls 2>&1 > dirlist

directs only the standard output to file dirlist, because the standard error was made a copy of the standard output before the standard output was redirected to dirlist.

Bash handles several filenames specially when they are used in redirections, as described in the following table. If the operating system on which Bash is running provides these special files, bash will use them; otherwise it will emulate them internally with the behavior described below.

/dev/fd/fd

If fd is a valid integer, file descriptor fd is duplicated.

/dev/stdin

File descriptor 0 is duplicated.

/dev/stdout

File descriptor 1 is duplicated.

/dev/stderr

File descriptor 2 is duplicated.

/dev/tcp/host/port

If host is a valid hostname or Internet address, and port is an integer port number or service name, Bash attempts to open the corresponding TCP socket.

/dev/udp/host/port

If host is a valid hostname or Internet address, and port is an integer port number or service name, Bash attempts to open the corresponding UDP socket.

A failure to open or create a file causes the redirection to fail.

Redirections using file descriptors greater than 9 should be used with care, as they may conflict with file descriptors the shell uses internally.

3.6.1 Redirecting Input

Redirection of input causes the file whose name results from the expansion of word to be opened for reading on file descriptor n, or the standard input (file descriptor 0) if n is not specified.

The general format for redirecting input is:

[n]<word

3.6.2 Redirecting Output

Redirection of output causes the file whose name results from the expansion of word to be opened for writing on file descriptor n, or the standard output (file descriptor 1) if n is not specified. If the file does not exist it is created; if it does exist it is truncated to zero size.

The general format for redirecting output is:

[n]>[|]word

If the redirection operator is ‘>’, and the noclobber option to the set builtin has been enabled, the redirection will fail if the file whose name results from the expansion of word exists and is a regular file. If the redirection operator is ‘>|’, or the redirection operator is ‘>’ and the noclobber option is not enabled, the redirection is attempted even if the file named by word exists.

3.6.3 Appending Redirected Output

Redirection of output in this fashion causes the file whose name results from the expansion of word to be opened for appending on file descriptor n, or the standard output (file descriptor 1) if n is not specified. If the file does not exist it is created.

The general format for appending output is:

[n]>>word

3.6.4 Redirecting Standard Output and Standard Error

This construct allows both the standard output (file descriptor 1) and the standard error output (file descriptor 2) to be redirected to the file whose name is the expansion of word.

There are two formats for redirecting standard output and standard error:

&>word

and

>&word

Of the two forms, the first is preferred. This is semantically equivalent to

>word 2>&1

When using the second form, word may not expand to a number or ‘-’. If it does, other redirection operators apply (see Duplicating File Descriptors below) for compatibility reasons.

3.6.5 Appending Standard Output and Standard Error

This construct allows both the standard output (file descriptor 1) and the standard error output (file descriptor 2) to be appended to the file whose name is the expansion of word.

The format for appending standard output and standard error is:

&>>word

This is semantically equivalent to

>>word 2>&1

(see Duplicating File Descriptors below).

3.6.6 Here Documents

This type of redirection instructs the shell to read input from the current source until a line containing only word (with no trailing blanks) is seen. All of the lines read up to that point are then used as the standard input (or file descriptor n if n is specified) for a command.

The format of here-documents is:

[n]<<[-]word
        here-document
delimiter

No parameter and variable expansion, command substitution, arithmetic expansion, or filename expansion is performed on word. If any part of word is quoted, the delimiter is the result of quote removal on word, and the lines in the here-document are not expanded. If word is unquoted, all lines of the here-document are subjected to parameter expansion, command substitution, and arithmetic expansion, the character sequence \newline is ignored, and ‘\’ must be used to quote the characters ‘\’, ‘$’, and ‘`’.

If the redirection operator is ‘<<-’, then all leading tab characters are stripped from input lines and the line containing delimiter. This allows here-documents within shell scripts to be indented in a natural fashion.

3.6.7 Here Strings

A variant of here documents, the format is:

[n]<<< word

The word undergoes brace expansion, tilde expansion, parameter and variable expansion, command substitution, arithmetic expansion, and quote removal. Pathname expansion and word splitting are not performed. The result is supplied as a single string, with a newline appended, to the command on its standard input (or file descriptor n if n is specified).

3.6.8 Duplicating File Descriptors

The redirection operator

[n]<&word

is used to duplicate input file descriptors. If word expands to one or more digits, the file descriptor denoted by n is made to be a copy of that file descriptor. If the digits in word do not specify a file descriptor open for input, a redirection error occurs. If word evaluates to ‘-’, file descriptor n is closed. If n is not specified, the standard input (file descriptor 0) is used.

The operator

[n]>&word

is used similarly to duplicate output file descriptors. If n is not specified, the standard output (file descriptor 1) is used. If the digits in word do not specify a file descriptor open for output, a redirection error occurs. If word evaluates to ‘-’, file descriptor n is closed. As a special case, if n is omitted, and word does not expand to one or more digits or ‘-’, the standard output and standard error are redirected as described previously.

3.6.9 Moving File Descriptors

The redirection operator

[n]<&digit-

moves the file descriptor digit to file descriptor n, or the standard input (file descriptor 0) if n is not specified. digit is closed after being duplicated to n.

Similarly, the redirection operator

[n]>&digit-

moves the file descriptor digit to file descriptor n, or the standard output (file descriptor 1) if n is not specified.

3.6.10 Opening File Descriptors for Reading and Writing

The redirection operator

[n]<>word

causes the file whose name is the expansion of word to be opened for both reading and writing on file descriptor n, or on file descriptor 0 if n is not specified. If the file does not exist, it is created.


3.7 Executing Commands


3.7.1 Simple Command Expansion

When a simple command is executed, the shell performs the following expansions, assignments, and redirections, from left to right.

  1. The words that the parser has marked as variable assignments (those preceding the command name) and redirections are saved for later processing.
  2. The words that are not variable assignments or redirections are expanded (see Shell Expansions). If any words remain after expansion, the first word is taken to be the name of the command and the remaining words are the arguments.
  3. Redirections are performed as described above (see Redirections).
  4. The text after the ‘=’ in each variable assignment undergoes tilde expansion, parameter expansion, command substitution, arithmetic expansion, and quote removal before being assigned to the variable.

If no command name results, the variable assignments affect the current shell environment. Otherwise, the variables are added to the environment of the executed command and do not affect the current shell environment. If any of the assignments attempts to assign a value to a readonly variable, an error occurs, and the command exits with a non-zero status.

If no command name results, redirections are performed, but do not affect the current shell environment. A redirection error causes the command to exit with a non-zero status.

If there is a command name left after expansion, execution proceeds as described below. Otherwise, the command exits. If one of the expansions contained a command substitution, the exit status of the command is the exit status of the last command substitution performed. If there were no command substitutions, the command exits with a status of zero.


3.7.2 Command Search and Execution

After a command has been split into words, if it results in a simple command and an optional list of arguments, the following actions are taken.

  1. If the command name contains no slashes, the shell attempts to locate it. If there exists a shell function by that name, that function is invoked as described in Shell Functions.
  2. If the name does not match a function, the shell searches for it in the list of shell builtins. If a match is found, that builtin is invoked.
  3. If the name is neither a shell function nor a builtin, and contains no slashes, Bash searches each element of $PATH for a directory containing an executable file by that name. Bash uses a hash table to remember the full pathnames of executable files to avoid multiple PATH searches (see the description of hash in Bourne Shell Builtins). A full search of the directories in $PATH is performed only if the command is not found in the hash table. If the search is unsuccessful, the shell searches for a defined shell function named command_not_found_handle. If that function exists, it is invoked with the original command and the original command’s arguments as its arguments, and the function’s exit status becomes the exit status of the shell. If that function is not defined, the shell prints an error message and returns an exit status of 127.
  4. If the search is successful, or if the command name contains one or more slashes, the shell executes the named program in a separate execution environment. Argument 0 is set to the name given, and the remaining arguments to the command are set to the arguments supplied, if any.
  5. If this execution fails because the file is not in executable format, and the file is not a directory, it is assumed to be a shell script and the shell executes it as described in Shell Scripts.
  6. If the command was not begun asynchronously, the shell waits for the command to complete and collects its exit status.

3.7.3 Command Execution Environment

The shell has an execution environment, which consists of the following:

  • open files inherited by the shell at invocation, as modified by redirections supplied to the exec builtin
  • the current working directory as set by cd, pushd, or popd, or inherited by the shell at invocation
  • the file creation mode mask as set by umask or inherited from the shell’s parent
  • current traps set by trap
  • shell parameters that are set by variable assignment or with set or inherited from the shell’s parent in the environment
  • shell functions defined during execution or inherited from the shell’s parent in the environment
  • options enabled at invocation (either by default or with command-line arguments) or by set
  • options enabled by shopt (see The Shopt Builtin)
  • shell aliases defined with alias (see Aliases)
  • various process IDs, including those of background jobs (see Lists), the value of $$, and the value of $PPID

When a simple command other than a builtin or shell function is to be executed, it is invoked in a separate execution environment that consists of the following. Unless otherwise noted, the values are inherited from the shell.

  • the shell’s open files, plus any modifications and additions specified by redirections to the command
  • the current working directory
  • the file creation mode mask
  • shell variables and functions marked for export, along with variables exported for the command, passed in the environment (see Environment)
  • traps caught by the shell are reset to the values inherited from the shell’s parent, and traps ignored by the shell are ignored

A command invoked in this separate environment cannot affect the shell’s execution environment.

Command substitution, commands grouped with parentheses, and asynchronous commands are invoked in a subshell environment that is a duplicate of the shell environment, except that traps caught by the shell are reset to the values that the shell inherited from its parent at invocation. Builtin commands that are invoked as part of a pipeline are also executed in a subshell environment. Changes made to the subshell environment cannot affect the shell’s execution environment.

Subshells spawned to execute command substitutions inherit the value of the -e option from the parent shell. When not in POSIX mode, Bash clears the -e option in such subshells.

If a command is followed by a ‘&’ and job control is not active, the default standard input for the command is the empty file /dev/null. Otherwise, the invoked command inherits the file descriptors of the calling shell as modified by redirections.


3.7.4 Environment

When a program is invoked it is given an array of strings called the environment. This is a list of name-value pairs, of the form name=value.

Bash provides several ways to manipulate the environment. On invocation, the shell scans its own environment and creates a parameter for each name found, automatically marking it for export to child processes. Executed commands inherit the environment. The export and ‘declare -x’ commands allow parameters and functions to be added to and deleted from the environment. If the value of a parameter in the environment is modified, the new value becomes part of the environment, replacing the old. The environment inherited by any executed command consists of the shell’s initial environment, whose values may be modified in the shell, less any pairs removed by the unset and ‘export -n’ commands, plus any additions via the export and ‘declare -x’ commands.

The environment for any simple command or function may be augmented temporarily by prefixing it with parameter assignments, as described in Shell Parameters. These assignment statements affect only the environment seen by that command.

If the -k option is set (see The Set Builtin), then all parameter assignments are placed in the environment for a command, not just those that precede the command name.

When Bash invokes an external command, the variable ‘$_’ is set to the full pathname of the command and passed to that command in its environment.


Next: , Previous: , Up: Executing Commands   [Contents][Index]

3.7.5 Exit Status

The exit status of an executed command is the value returned by the waitpid system call or equivalent function. Exit statuses fall between 0 and 255, though, as explained below, the shell may use values above 125 specially. Exit statuses from shell builtins and compound commands are also limited to this range. Under certain circumstances, the shell will use special values to indicate specific failure modes.

For the shell’s purposes, a command which exits with a zero exit status has succeeded. A non-zero exit status indicates failure. This seemingly counter-intuitive scheme is used so there is one well-defined way to indicate success and a variety of ways to indicate various failure modes. When a command terminates on a fatal signal whose number is N, Bash uses the value 128+N as the exit status.

If a command is not found, the child process created to execute it returns a status of 127. If a command is found but is not executable, the return status is 126.

If a command fails because of an error during expansion or redirection, the exit status is greater than zero.

The exit status is used by the Bash conditional commands (see Conditional Constructs) and some of the list constructs (see Lists).

All of the Bash builtins return an exit status of zero if they succeed and a non-zero status on failure, so they may be used by the conditional and list constructs. All builtins return an exit status of 2 to indicate incorrect usage, generally invalid options or missing arguments.


3.7.6 Signals

When Bash is interactive, in the absence of any traps, it ignores SIGTERM (so that ‘kill 0’ does not kill an interactive shell), and SIGINT is caught and handled (so that the wait builtin is interruptible). When Bash receives a SIGINT, it breaks out of any executing loops. In all cases, Bash ignores SIGQUIT. If job control is in effect (see Job Control), Bash ignores SIGTTIN, SIGTTOU, and SIGTSTP.

Non-builtin commands started by Bash have signal handlers set to the values inherited by the shell from its parent. When job control is not in effect, asynchronous commands ignore SIGINT and SIGQUIT in addition to these inherited handlers. Commands run as a result of command substitution ignore the keyboard-generated job control signals SIGTTIN, SIGTTOU, and SIGTSTP.

The shell exits by default upon receipt of a SIGHUP. Before exiting, an interactive shell resends the SIGHUP to all jobs, running or stopped. Stopped jobs are sent SIGCONT to ensure that they receive the SIGHUP. To prevent the shell from sending the SIGHUP signal to a particular job, it should be removed from the jobs table with the disown builtin (see Job Control Builtins) or marked to not receive SIGHUP using disown -h.

If the huponexit shell option has been set with shopt (see The Shopt Builtin), Bash sends a SIGHUP to all jobs when an interactive login shell exits.

If Bash is waiting for a command to complete and receives a signal for which a trap has been set, the trap will not be executed until the command completes. When Bash is waiting for an asynchronous command via the wait builtin, the reception of a signal for which a trap has been set will cause the wait builtin to return immediately with an exit status greater than 128, immediately after which the trap is executed.


3.8 Shell Scripts

A shell script is a text file containing shell commands. When such a file is used as the first non-option argument when invoking Bash, and neither the -c nor -s option is supplied (see Invoking Bash), Bash reads and executes commands from the file, then exits. This mode of operation creates a non-interactive shell. The shell first searches for the file in the current directory, and looks in the directories in $PATH if not found there.

When Bash runs a shell script, it sets the special parameter 0 to the name of the file, rather than the name of the shell, and the positional parameters are set to the remaining arguments, if any are given. If no additional arguments are supplied, the positional parameters are unset.

A shell script may be made executable by using the chmod command to turn on the execute bit. When Bash finds such a file while searching the $PATH for a command, it spawns a subshell to execute it. In other words, executing

filename arguments

is equivalent to executing

bash filename arguments

if filename is an executable shell script. This subshell reinitializes itself, so that the effect is as if a new shell had been invoked to interpret the script, with the exception that the locations of commands remembered by the parent (see the description of hash in Bourne Shell Builtins) are retained by the child.

Most versions of Unix make this a part of the operating system’s command execution mechanism. If the first line of a script begins with the two characters ‘#!’, the remainder of the line specifies an interpreter for the program. Thus, you can specify Bash, awk, Perl, or some other interpreter and write the rest of the script file in that language.

The arguments to the interpreter consist of a single optional argument following the interpreter name on the first line of the script file, followed by the name of the script file, followed by the rest of the arguments. Bash will perform this action on operating systems that do not handle it themselves. Note that some older versions of Unix limit the interpreter name and argument to a maximum of 32 characters.

Bash scripts often begin with #! /bin/bash (assuming that Bash has been installed in /bin), since this ensures that Bash will be used to interpret the script, even if it is executed under another shell.


Next: , Previous: , Up: Top   [Contents][Index]

4 Shell Builtin Commands

Builtin commands are contained within the shell itself. When the name of a builtin command is used as the first word of a simple command (see Simple Commands), the shell executes the command directly, without invoking another program. Builtin commands are necessary to implement functionality impossible or inconvenient to obtain with separate utilities.

This section briefly describes the builtins which Bash inherits from the Bourne Shell, as well as the builtin commands which are unique to or have been extended in Bash.

Several builtin commands are described in other chapters: builtin commands which provide the Bash interface to the job control facilities (see Job Control Builtins), the directory stack (see Directory Stack Builtins), the command history (see Bash History Builtins), and the programmable completion facilities (see Programmable Completion Builtins).

Many of the builtins have been extended by POSIX or Bash.

Unless otherwise noted, each builtin command documented as accepting options preceded by ‘-’ accepts ‘--’ to signify the end of the options. The :, true, false, and test builtins do not accept options and do not treat ‘--’ specially. The exit, logout, return, break, continue, let, and shift builtins accept and process arguments beginning with ‘-’ without requiring ‘--’. Other builtins that accept arguments but are not specified as accepting options interpret arguments beginning with ‘-’ as invalid options and require ‘--’ to prevent this interpretation.


4.1 Bourne Shell Builtins

The following shell builtin commands are inherited from the Bourne Shell. These commands are implemented as specified by the POSIX standard.

: (a colon)
: [arguments]

Do nothing beyond expanding arguments and performing redirections. The return status is zero.

. (a period)
. filename [arguments]

Read and execute commands from the filename argument in the current shell context. If filename does not contain a slash, the PATH variable is used to find filename. When Bash is not in POSIX mode, the current directory is searched if filename is not found in $PATH. If any arguments are supplied, they become the positional parameters when filename is executed. Otherwise the positional parameters are unchanged. If the -T option is enabled, source inherits any trap on DEBUG; if it is not, any DEBUG trap string is saved and restored around the call to source, and source unsets the DEBUG trap while it executes. If -T is not set, and the sourced file changes the DEBUG trap, the new value is retained when source completes. The return status is the exit status of the last command executed, or zero if no commands are executed. If filename is not found, or cannot be read, the return status is non-zero. This builtin is equivalent to source.

break
break [n]

Exit from a for, while, until, or select loop. If n is supplied, the nth enclosing loop is exited. n must be greater than or equal to 1. The return status is zero unless n is not greater than or equal to 1.

cd
cd [-L|[-P [-e]] [-@] [directory]

Change the current working directory to directory. If directory is not supplied, the value of the HOME shell variable is used. Any additional arguments following directory are ignored. If the shell variable CDPATH exists, it is used as a search path: each directory name in CDPATH is searched for directory, with alternative directory names in CDPATH separated by a colon (‘:’). If directory begins with a slash, CDPATH is not used.

The -P option means to not follow symbolic links: symbolic links are resolved while cd is traversing directory and before processing an instance of ‘..’ in directory.

By default, or when the -L option is supplied, symbolic links in directory are resolved after cd processes an instance of ‘..’ in directory.

If ‘..’ appears in directory, it is processed by removing the immediately preceding pathname component, back to a slash or the beginning of directory.

If the -e option is supplied with -P and the current working directory cannot be successfully determined after a successful directory change, cd will return an unsuccessful status.

On systems that support it, the -@ option presents the extended attributes associated with a file as a directory.

If directory is ‘-’, it is converted to $OLDPWD before the directory change is attempted.

If a non-empty directory name from CDPATH is used, or if ‘-’ is the first argument, and the directory change is successful, the absolute pathname of the new working directory is written to the standard output.

The return status is zero if the directory is successfully changed, non-zero otherwise.

continue
continue [n]

Resume the next iteration of an enclosing for, while, until, or select loop. If n is supplied, the execution of the nth enclosing loop is resumed. n must be greater than or equal to 1. The return status is zero unless n is not greater than or equal to 1.

eval
eval [arguments]

The arguments are concatenated together into a single command, which is then read and executed, and its exit status returned as the exit status of eval. If there are no arguments or only empty arguments, the return status is zero.

exec
exec [-cl] [-a name] [command [arguments]]

If command is supplied, it replaces the shell without creating a new process. If the -l option is supplied, the shell places a dash at the beginning of the zeroth argument passed to command. This is what the login program does. The -c option causes command to be executed with an empty environment. If -a is supplied, the shell passes name as the zeroth argument to command. If command cannot be executed for some reason, a non-interactive shell exits, unless the execfail shell option is enabled. In that case, it returns failure. An interactive shell returns failure if the file cannot be executed. If no command is specified, redirections may be used to affect the current shell environment. If there are no redirection errors, the return status is zero; otherwise the return status is non-zero.

exit
exit [n]

Exit the shell, returning a status of n to the shell’s parent. If n is omitted, the exit status is that of the last command executed. Any trap on EXIT is executed before the shell terminates.

export
export [-fn] [-p] [name[=value]]

Mark each name to be passed to child processes in the environment. If the -f option is supplied, the names refer to shell functions; otherwise the names refer to shell variables. The -n option means to no longer mark each name for export. If no names are supplied, or if the -p option is given, a list of names of all exported variables is displayed. The -p option displays output in a form that may be reused as input. If a variable name is followed by =value, the value of the variable is set to value.

The return status is zero unless an invalid option is supplied, one of the names is not a valid shell variable name, or -f is supplied with a name that is not a shell function.

getopts
getopts optstring name [args]

getopts is used by shell scripts to parse positional parameters. optstring contains the option characters to be recognized; if a character is followed by a colon, the option is expected to have an argument, which should be separated from it by whitespace. The colon (‘:’) and question mark (‘?’) may not be used as option characters. Each time it is invoked, getopts places the next option in the shell variable name, initializing name if it does not exist, and the index of the next argument to be processed into the variable OPTIND. OPTIND is initialized to 1 each time the shell or a shell script is invoked. When an option requires an argument, getopts places that argument into the variable OPTARG. The shell does not reset OPTIND automatically; it must be manually reset between multiple calls to getopts within the same shell invocation if a new set of parameters is to be used.

When the end of options is encountered, getopts exits with a return value greater than zero. OPTIND is set to the index of the first non-option argument, and name is set to ‘?’.

getopts normally parses the positional parameters, but if more arguments are given in args, getopts parses those instead.

getopts can report errors in two ways. If the first character of optstring is a colon, silent error reporting is used. In normal operation, diagnostic messages are printed when invalid options or missing option arguments are encountered. If the variable OPTERR is set to 0, no error messages will be displayed, even if the first character of optstring is not a colon.

If an invalid option is seen, getopts places ‘?’ into name and, if not silent, prints an error message and unsets OPTARG. If getopts is silent, the option character found is placed in OPTARG and no diagnostic message is printed.

If a required argument is not found, and getopts is not silent, a question mark (‘?’) is placed in name, OPTARG is unset, and a diagnostic message is printed. If getopts is silent, then a colon (‘:’) is placed in name and OPTARG is set to the option character found.

hash
hash [-r] [-p filename] [-dt] [name]

Each time hash is invoked, it remembers the full pathnames of the commands specified as name arguments, so they need not be searched for on subsequent invocations. The commands are found by searching through the directories listed in $PATH. Any previously-remembered pathname is discarded. The -p option inhibits the path search, and filename is used as the location of name. The -r option causes the shell to forget all remembered locations. The -d option causes the shell to forget the remembered location of each name. If the -t option is supplied, the full pathname to which each name corresponds is printed. If multiple name arguments are supplied with -t the name is printed before the hashed full pathname. The -l option causes output to be displayed in a format that may be reused as input. If no arguments are given, or if only -l is supplied, information about remembered commands is printed. The return status is zero unless a name is not found or an invalid option is supplied.

pwd
pwd [-LP]

Print the absolute pathname of the current working directory. If the -P option is supplied, the pathname printed will not contain symbolic links. If the -L option is supplied, the pathname printed may contain symbolic links. The return status is zero unless an error is encountered while determining the name of the current directory or an invalid option is supplied.

readonly
readonly [-aAf] [-p] [name[=value]] …

Mark each name as readonly. The values of these names may not be changed by subsequent assignment. If the -f option is supplied, each name refers to a shell function. The -a option means each name refers to an indexed array variable; the -A option means each name refers to an associative array variable. If both options are supplied, -A takes precedence. If no name arguments are given, or if the -p option is supplied, a list of all readonly names is printed. The other options may be used to restrict the output to a subset of the set of readonly names. The -p option causes output to be displayed in a format that may be reused as input. If a variable name is followed by =value, the value of the variable is set to value. The return status is zero unless an invalid option is supplied, one of the name arguments is not a valid shell variable or function name, or the -f option is supplied with a name that is not a shell function.

return
return [n]

Cause a shell function to stop executing and return the value n to its caller. If n is not supplied, the return value is the exit status of the last command executed in the function. If return is executed by a trap handler, the last command used to determine the status is the last command executed before the trap handler. if return is executed during a DEBUG trap, the last command used to determine the status is the last command executed by the trap handler before return was invoked. return may also be used to terminate execution of a script being executed with the . (source) builtin, returning either n or the exit status of the last command executed within the script as the exit status of the script. If n is supplied, the return value is its least significant 8 bits. Any command associated with the RETURN trap is executed before execution resumes after the function or script. The return status is non-zero if return is supplied a non-numeric argument or is used outside a function and not during the execution of a script by . or source.

shift
shift [n]

Shift the positional parameters to the left by n. The positional parameters from n+1 … $# are renamed to $1$#-n. Parameters represented by the numbers $# to $#-n+1 are unset. n must be a non-negative number less than or equal to $#. If n is zero or greater than $#, the positional parameters are not changed. If n is not supplied, it is assumed to be 1. The return status is zero unless n is greater than $# or less than zero, non-zero otherwise.

test
[
test expr

Evaluate a conditional expression expr and return a status of 0 (true) or 1 (false). Each operator and operand must be a separate argument. Expressions are composed of the primaries described below in Bash Conditional Expressions. test does not accept any options, nor does it accept and ignore an argument of -- as signifying the end of options.

When the [ form is used, the last argument to the command must be a ].

Expressions may be combined using the following operators, listed in decreasing order of precedence. The evaluation depends on the number of arguments; see below. Operator precedence is used when there are five or more arguments.

! expr

True if expr is false.

( expr )

Returns the value of expr. This may be used to override the normal precedence of operators.

expr1 -a expr2

True if both expr1 and expr2 are true.

expr1 -o expr2

True if either expr1 or expr2 is true.

The test and [ builtins evaluate conditional expressions using a set of rules based on the number of arguments.

0 arguments

The expression is false.

1 argument

The expression is true if and only if the argument is not null.

2 arguments

If the first argument is ‘!’, the expression is true if and only if the second argument is null. If the first argument is one of the unary conditional operators (see Bash Conditional Expressions), the expression is true if the unary test is true. If the first argument is not a valid unary operator, the expression is false.

3 arguments

The following conditions are applied in the order listed. If the second argument is one of the binary conditional operators (see Bash Conditional Expressions), the result of the expression is the result of the binary test using the first and third arguments as operands. The ‘-a’ and ‘-o’ operators are considered binary operators when there are three arguments. If the first argument is ‘!’, the value is the negation of the two-argument test using the second and third arguments. If the first argument is exactly ‘(’ and the third argument is exactly ‘)’, the result is the one-argument test of the second argument. Otherwise, the expression is false.

4 arguments

If the first argument is ‘!’, the result is the negation of the three-argument expression composed of the remaining arguments. Otherwise, the expression is parsed and evaluated according to precedence using the rules listed above.

5 or more arguments

The expression is parsed and evaluated according to precedence using the rules listed above.

When used with test or ‘[’, the ‘<’ and ‘>’ operators sort lexicographically using ASCII ordering.

times
times

Print out the user and system times used by the shell and its children. The return status is zero.

trap
trap [-lp] [arg] [sigspec …]

The commands in arg are to be read and executed when the shell receives signal sigspec. If arg is absent (and there is a single sigspec) or equal to ‘-’, each specified signal’s disposition is reset to the value it had when the shell was started. If arg is the null string, then the signal specified by each sigspec is ignored by the shell and commands it invokes. If arg is not present and -p has been supplied, the shell displays the trap commands associated with each sigspec. If no arguments are supplied, or only -p is given, trap prints the list of commands associated with each signal number in a form that may be reused as shell input. The -l option causes the shell to print a list of signal names and their corresponding numbers. Each sigspec is either a signal name or a signal number. Signal names are case insensitive and the SIG prefix is optional.

If a sigspec is 0 or EXIT, arg is executed when the shell exits. If a sigspec is DEBUG, the command arg is executed before every simple command, for command, case command, select command, every arithmetic for command, and before the first command executes in a shell function. Refer to the description of the extdebug option to the shopt builtin (see The Shopt Builtin) for details of its effect on the DEBUG trap. If a sigspec is RETURN, the command arg is executed each time a shell function or a script executed with the . or source builtins finishes executing.

If a sigspec is ERR, the command arg is executed whenever a pipeline (which may consist of a single simple command), a list, or a compound command returns a non-zero exit status, subject to the following conditions. The ERR trap is not executed if the failed command is part of the command list immediately following an until or while keyword, part of the test following the if or elif reserved words, part of a command executed in a && or || list except the command following the final && or ||, any command in a pipeline but the last, or if the command’s return status is being inverted using !. These are the same conditions obeyed by the errexit (-e) option.

Signals ignored upon entry to the shell cannot be trapped or reset. Trapped signals that are not being ignored are reset to their original values in a subshell or subshell environment when one is created.

The return status is zero unless a sigspec does not specify a valid signal.

umask
umask [-p] [-S] [mode]

Set the shell process’s file creation mask to mode. If mode begins with a digit, it is interpreted as an octal number; if not, it is interpreted as a symbolic mode mask similar to that accepted by the chmod command. If mode is omitted, the current value of the mask is printed. If the -S option is supplied without a mode argument, the mask is printed in a symbolic format. If the -p option is supplied, and mode is omitted, the output is in a form that may be reused as input. The return status is zero if the mode is successfully changed or if no mode argument is supplied, and non-zero otherwise.

Note that when the mode is interpreted as an octal number, each number of the umask is subtracted from 7. Thus, a umask of 022 results in permissions of 755.

unset
unset [-fnv] [name]

Remove each variable or function name. If the -v option is given, each name refers to a shell variable and that variable is removed. If the -f option is given, the names refer to shell functions, and the function definition is removed. If the -n option is supplied, and name is a variable with the nameref attribute, name will be unset rather than the variable it references. -n has no effect if the -f option is supplied. If no options are supplied, each name refers to a variable; if there is no variable by that name, any function with that name is unset. Readonly variables and functions may not be unset. The return status is zero unless a name is readonly.


4.2 Bash Builtin Commands

This section describes builtin commands which are unique to or have been extended in Bash. Some of these commands are specified in the POSIX standard.

alias
alias [-p] [name[=value] …]

Without arguments or with the -p option, alias prints the list of aliases on the standard output in a form that allows them to be reused as input. If arguments are supplied, an alias is defined for each name whose value is given. If no value is given, the name and value of the alias is printed. Aliases are described in Aliases.

bind
bind [-m keymap] [-lpsvPSVX]
bind [-m keymap] [-q function] [-u function] [-r keyseq]
bind [-m keymap] -f filename
bind [-m keymap] -x keyseq:shell-command
bind [-m keymap] keyseq:function-name
bind [-m keymap] keyseq:readline-command

Display current Readline (see Command Line Editing) key and function bindings, bind a key sequence to a Readline function or macro, or set a Readline variable. Each non-option argument is a command as it would appear in a Readline initialization file (see Readline Init File), but each binding or command must be passed as a separate argument; e.g., ‘"\C-x\C-r":re-read-init-file’.

Options, if supplied, have the following meanings:

-m keymap

Use keymap as the keymap to be affected by the subsequent bindings. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. vi is equivalent to vi-command (vi-move is also a synonym); emacs is equivalent to emacs-standard.

-l

List the names of all Readline functions.

-p

Display Readline function names and bindings in such a way that they can be used as input or in a Readline initialization file.

-P

List current Readline function names and bindings.

-v

Display Readline variable names and values in such a way that they can be used as input or in a Readline initialization file.

-V

List current Readline variable names and values.

-s

Display Readline key sequences bound to macros and the strings they output in such a way that they can be used as input or in a Readline initialization file.

-S

Display Readline key sequences bound to macros and the strings they output.

-f filename

Read key bindings from filename.

-q function

Query about which keys invoke the named function.

-u function

Unbind all keys bound to the named function.

-r keyseq

Remove any current binding for keyseq.

-x keyseq:shell-command

Cause shell-command to be executed whenever keyseq is entered. When shell-command is executed, the shell sets the READLINE_LINE variable to the contents of the Readline line buffer and the READLINE_POINT variable to the current location of the insertion point. If the executed command changes the value of READLINE_LINE or READLINE_POINT, those new values will be reflected in the editing state.

-X

List all key sequences bound to shell commands and the associated commands in a format that can be reused as input.

The return status is zero unless an invalid option is supplied or an error occurs.

builtin
builtin [shell-builtin [args]]

Run a shell builtin, passing it args, and return its exit status. This is useful when defining a shell function with the same name as a shell builtin, retaining the functionality of the builtin within the function. The return status is non-zero if shell-builtin is not a shell builtin command.

caller
caller [expr]

Returns the context of any active subroutine call (a shell function or a script executed with the . or source builtins).

Without expr, caller displays the line number and source filename of the current subroutine call. If a non-negative integer is supplied as expr, caller displays the line number, subroutine name, and source file corresponding to that position in the current execution call stack. This extra information may be used, for example, to print a stack trace. The current frame is frame 0.

The return value is 0 unless the shell is not executing a subroutine call or expr does not correspond to a valid position in the call stack.

command
command [-pVv] command [arguments …]

Runs command with arguments ignoring any shell function named command. Only shell builtin commands or commands found by searching the PATH are executed. If there is a shell function named ls, running ‘command ls’ within the function will execute the external command ls instead of calling the function recursively. The -p option means to use a default value for PATH that is guaranteed to find all of the standard utilities. The return status in this case is 127 if command cannot be found or an error occurred, and the exit status of command otherwise.

If either the -V or -v option is supplied, a description of command is printed. The -v option causes a single word indicating the command or file name used to invoke command to be displayed; the -V option produces a more verbose description. In this case, the return status is zero if command is found, and non-zero if not.

declare
declare [-aAfFgilnrtux] [-p] [name[=value] …]

Declare variables and give them attributes. If no names are given, then display the values of variables instead.

The -p option will display the attributes and values of each name. When -p is used with name arguments, additional options, other than -f and -F, are ignored.

When -p is supplied without name arguments, declare will display the attributes and values of all variables having the attributes specified by the additional options. If no other options are supplied with -p, declare will display the attributes and values of all shell variables. The -f option will restrict the display to shell functions.

The -F option inhibits the display of function definitions; only the function name and attributes are printed. If the extdebug shell option is enabled using shopt (see The Shopt Builtin), the source file name and line number where each name is defined are displayed as well. -F implies -f.

The -g option forces variables to be created or modified at the global scope, even when declare is executed in a shell function. It is ignored in all other cases.

The following options can be used to restrict output to variables with the specified attributes or to give variables attributes:

-a

Each name is an indexed array variable (see Arrays).

-A

Each name is an associative array variable (see Arrays).

-f

Use function names only.

-i

The variable is to be treated as an integer; arithmetic evaluation (see Shell Arithmetic) is performed when the variable is assigned a value.

-l

When the variable is assigned a value, all upper-case characters are converted to lower-case. The upper-case attribute is disabled.

-n

Give each name the nameref attribute, making it a name reference to another variable. That other variable is defined by the value of name. All references, assignments, and attribute modifications to name, except for those using or changing the -n attribute itself, are performed on the variable referenced by name’s value. The nameref attribute cannot be applied to array variables.

-r

Make names readonly. These names cannot then be assigned values by subsequent assignment statements or unset.

-t

Give each name the trace attribute. Traced functions inherit the DEBUG and RETURN traps from the calling shell. The trace attribute has no special meaning for variables.

-u

When the variable is assigned a value, all lower-case characters are converted to upper-case. The lower-case attribute is disabled.

-x

Mark each name for export to subsequent commands via the environment.

Using ‘+’ instead of ‘-’ turns off the attribute instead, with the exceptions that ‘+a’ may not be used to destroy an array variable and ‘+r’ will not remove the readonly attribute. When used in a function, declare makes each name local, as with the local command, unless the -g option is used. If a variable name is followed by =value, the value of the variable is set to value.

When using -a or -A and the compound assignment syntax to create array variables, additional attributes do not take effect until subsequent assignments.

The return status is zero unless an invalid option is encountered, an attempt is made to define a function using ‘-f foo=bar’, an attempt is made to assign a value to a readonly variable, an attempt is made to assign a value to an array variable without using the compound assignment syntax (see Arrays), one of the names is not a valid shell variable name, an attempt is made to turn off readonly status for a readonly variable, an attempt is made to turn off array status for an array variable, or an attempt is made to display a non-existent function with -f.

echo
echo [-neE] [arg …]

Output the args, separated by spaces, terminated with a newline. The return status is 0 unless a write error occurs. If -n is specified, the trailing newline is suppressed. If the -e option is given, interpretation of the following backslash-escaped characters is enabled. The -E option disables the interpretation of these escape characters, even on systems where they are interpreted by default. The xpg_echo shell option may be used to dynamically determine whether or not echo expands these escape characters by default. echo does not interpret -- to mean the end of options.

echo interprets the following escape sequences:

\a

alert (bell)

\b

backspace

\c

suppress further output

\e
\E

escape

\f

form feed

\n

new line

\r

carriage return

\t

horizontal tab

\v

vertical tab

\\

backslash

\0nnn

the eight-bit character whose value is the octal value nnn (zero to three octal digits)

\xHH

the eight-bit character whose value is the hexadecimal value HH (one or two hex digits)

\uHHHH

the Unicode (ISO/IEC 10646) character whose value is the hexadecimal value HHHH (one to four hex digits)

\UHHHHHHHH

the Unicode (ISO/IEC 10646) character whose value is the hexadecimal value HHHHHHHH (one to eight hex digits)

enable
enable [-a] [-dnps] [-f filename] [name …]

Enable and disable builtin shell commands. Disabling a builtin allows a disk command which has the same name as a shell builtin to be executed without specifying a full pathname, even though the shell normally searches for builtins before disk commands. If -n is used, the names become disabled. Otherwise names are enabled. For example, to use the test binary found via $PATH instead of the shell builtin version, type ‘enable -n test’.

If the -p option is supplied, or no name arguments appear, a list of shell builtins is printed. With no other arguments, the list consists of all enabled shell builtins. The -a option means to list each builtin with an indication of whether or not it is enabled.

The -f option means to load the new builtin command name from shared object filename, on systems that support dynamic loading. The -d option will delete a builtin loaded with -f.

If there are no options, a list of the shell builtins is displayed. The -s option restricts enable to the POSIX special builtins. If -s is used with -f, the new builtin becomes a special builtin (see Special Builtins).

The return status is zero unless a name is not a shell builtin or there is an error loading a new builtin from a shared object.

help
help [-dms] [pattern]

Display helpful information about builtin commands. If pattern is specified, help gives detailed help on all commands matching pattern, otherwise a list of the builtins is printed.

Options, if supplied, have the following meanings:

-d

Display a short description of each pattern

-m

Display the description of each pattern in a manpage-like format

-s

Display only a short usage synopsis for each pattern

The return status is zero unless no command matches pattern.

let
let expression [expression …]

The let builtin allows arithmetic to be performed on shell variables. Each expression is evaluated according to the rules given below in Shell Arithmetic. If the last expression evaluates to 0, let returns 1; otherwise 0 is returned.

local
local [option] name[=value] …

For each argument, a local variable named name is created, and assigned value. The option can be any of the options accepted by declare. local can only be used within a function; it makes the variable name have a visible scope restricted to that function and its children. If name is ‘-’, the set of shell options is made local to the function in which local is invoked: shell options changed using the set builtin inside the function are restored to their original values when the function returns. The return status is zero unless local is used outside a function, an invalid name is supplied, or name is a readonly variable.

logout
logout [n]

Exit a login shell, returning a status of n to the shell’s parent.

mapfile
mapfile [-d delim] [-n count] [-O origin] [-s count] [-t] [-u fd]
    [-C callback] [-c quantum] [array]

Read lines from the standard input into the indexed array variable array, or from file descriptor fd if the -u option is supplied. The variable MAPFILE is the default array. Options, if supplied, have the following meanings:

-d

The first character of delim is used to terminate each input line, rather than newline.

-n

Copy at most count lines. If count is 0, all lines are copied.

-O

Begin assigning to array at index origin. The default index is 0.

-s

Discard the first count lines read.

-t

Remove a trailing delim (default newline) from each line read.

-u

Read lines from file descriptor fd instead of the standard input.

-C

Evaluate callback each time quantumP lines are read. The -c option specifies quantum.

-c

Specify the number of lines read between each call to callback.

If -C is specified without -c, the default quantum is 5000. When callback is evaluated, it is supplied the index of the next array element to be assigned and the line to be assigned to that element as additional arguments. callback is evaluated after the line is read but before the array element is assigned.

If not supplied with an explicit origin, mapfile will clear array before assigning to it.

mapfile returns successfully unless an invalid option or option argument is supplied, array is invalid or unassignable, or array is not an indexed array.

printf
printf [-v var] format [arguments]

Write the formatted arguments to the standard output under the control of the format. The -v option causes the output to be assigned to the variable var rather than being printed to the standard output.

The format is a character string which contains three types of objects: plain characters, which are simply copied to standard output, character escape sequences, which are converted and copied to the standard output, and format specifications, each of which causes printing of the next successive argument. In addition to the standard printf(1) formats, printf interprets the following extensions:

%b

Causes printf to expand backslash escape sequences in the corresponding argument in the same way as echo -e (see Bash Builtins).

%q

Causes printf to output the corresponding argument in a format that can be reused as shell input.

%(datefmt)T

Causes printf to output the date-time string resulting from using datefmt as a format string for strftime(3). The corresponding argument is an integer representing the number of seconds since the epoch. Two special argument values may be used: -1 represents the current time, and -2 represents the time the shell was invoked. If no argument is specified, conversion behaves as if -1 had been given. This is an exception to the usual printf behavior.

Arguments to non-string format specifiers are treated as C language constants, except that a leading plus or minus sign is allowed, and if the leading character is a single or double quote, the value is the ASCII value of the following character.

The format is reused as necessary to consume all of the arguments. If the format requires more arguments than are supplied, the extra format specifications behave as if a zero value or null string, as appropriate, had been supplied. The return value is zero on success, non-zero on failure.

read
read [-ers] [-a aname] [-d delim] [-i text] [-n nchars]
    [-N nchars] [-p prompt] [-t timeout] [-u fd] [name …]

One line is read from the standard input, or from the file descriptor fd supplied as an argument to the -u option, split into words as described above in Word Splitting, and the first word is assigned to the first name, the second word to the second name, and so on. If there are more words than names, the remaining words and their intervening delimiters are assigned to the last name. If there are fewer words read from the input stream than names, the remaining names are assigned empty values. The characters in the value of the IFS variable are used to split the line into words using the same rules the shell uses for expansion (described above in Word Splitting). The backslash character ‘\’ may be used to remove any special meaning for the next character read and for line continuation. If no names are supplied, the line read is assigned to the variable REPLY. The exit status is zero, unless end-of-file is encountered, read times out (in which case the status is greater than 128), a variable assignment error (such as assigning to a readonly variable) occurs, or an invalid file descriptor is supplied as the argument to -u.

Options, if supplied, have the following meanings:

-a aname

The words are assigned to sequential indices of the array variable aname, starting at 0. All elements are removed from aname before the assignment. Other name arguments are ignored.

-d delim

The first character of delim is used to terminate the input line, rather than newline.

-e

Readline (see Command Line Editing) is used to obtain the line. Readline uses the current (or default, if line editing was not previously active) editing settings.

-i text

If Readline is being used to read the line, text is placed into the editing buffer before editing begins.

-n nchars

read returns after reading nchars characters rather than waiting for a complete line of input, but honors a delimiter if fewer than nchars characters are read before the delimiter.

-N nchars

read returns after reading exactly nchars characters rather than waiting for a complete line of input, unless EOF is encountered or read times out. Delimiter characters encountered in the input are not treated specially and do not cause read to return until nchars characters are read. The result is not split on the characters in IFS; the intent is that the variable is assigned exactly the characters read (with the exception of backslash; see the -r option below).

-p prompt

Display prompt, without a trailing newline, before attempting to read any input. The prompt is displayed only if input is coming from a terminal.

-r

If this option is given, backslash does not act as an escape character. The backslash is considered to be part of the line. In particular, a backslash-newline pair may not be used as a line continuation.

-s

Silent mode. If input is coming from a terminal, characters are not echoed.

-t timeout

Cause read to time out and return failure if a complete line of input (or a specified number of characters) is not read within timeout seconds. timeout may be a decimal number with a fractional portion following the decimal point. This option is only effective if read is reading input from a terminal, pipe, or other special file; it has no effect when reading from regular files. If read times out, read saves any partial input read into the specified variable name. If timeout is 0, read returns immediately, without trying to read and data. The exit status is 0 if input is available on the specified file descriptor, non-zero otherwise. The exit status is greater than 128 if the timeout is exceeded.

-u fd

Read input from file descriptor fd.

readarray
readarray [-d delim] [-n count] [-O origin] [-s count] [-t] [-u fd]
    [-C callback] [-c quantum] [array]

Read lines from the standard input into the indexed array variable array, or from file descriptor fd if the -u option is supplied.

A synonym for mapfile.

source
source filename

A synonym for . (see Bourne Shell Builtins).

type
type [-afptP] [name …]

For each name, indicate how it would be interpreted if used as a command name.

If the -t option is used, type prints a single word which is one of ‘alias’, ‘function’, ‘builtin’, ‘file’ or ‘keyword’, if name is an alias, shell function, shell builtin, disk file, or shell reserved word, respectively. If the name is not found, then nothing is printed, and type returns a failure status.

If the -p option is used, type either returns the name of the disk file that would be executed, or nothing if -t would not return ‘file’.

The -P option forces a path search for each name, even if -t would not return ‘file’.

If a command is hashed, -p and -P print the hashed value, which is not necessarily the file that appears first in $PATH.

If the -a option is used, type returns all of the places that contain an executable named file. This includes aliases and functions, if and only if the -p option is not also used.

If the -f option is used, type does not attempt to find shell functions, as with the command builtin.

The return status is zero if all of the names are found, non-zero if any are not found.

typeset
typeset [-afFgrxilnrtux] [-p] [name[=value] …]

The typeset command is supplied for compatibility with the Korn shell. It is a synonym for the declare builtin command.

ulimit
ulimit [-HSabcdefiklmnpqrstuvxPT] [limit]

ulimit provides control over the resources available to processes started by the shell, on systems that allow such control. If an option is given, it is interpreted as follows:

-S

Change and report the soft limit associated with a resource.

-H

Change and report the hard limit associated with a resource.

-a

All current limits are reported.

-b

The maximum socket buffer size.

-c

The maximum size of core files created.

-d

The maximum size of a process’s data segment.

-e

The maximum scheduling priority ("nice").

-f

The maximum size of files written by the shell and its children.

-i

The maximum number of pending signals.

-k

The maximum number of kqueues that may be allocated.

-l

The maximum size that may be locked into memory.

-m

The maximum resident set size (many systems do not honor this limit).

-n

The maximum number of open file descriptors (most systems do not allow this value to be set).

-p

The pipe buffer size.

-q

The maximum number of bytes in POSIX message queues.

-r

The maximum real-time scheduling priority.

-s

The maximum stack size.

-t

The maximum amount of cpu time in seconds.

-u

The maximum number of processes available to a single user.

-v

The maximum amount of virtual memory available to the shell, and, on some systems, to its children.

-x

The maximum number of file locks.

-P

The maximum number of pseudoterminals.

-T

The maximum number of threads.

If limit is given, and the -a option is not used, limit is the new value of the specified resource. The special limit values hard, soft, and unlimited stand for the current hard limit, the current soft limit, and no limit, respectively. A hard limit cannot be increased by a non-root user once it is set; a soft limit may be increased up to the value of the hard limit. Otherwise, the current value of the soft limit for the specified resource is printed, unless the -H option is supplied. When setting new limits, if neither -H nor -S is supplied, both the hard and soft limits are set. If no option is given, then -f is assumed. Values are in 1024-byte increments, except for -t, which is in seconds; -p, which is in units of 512-byte blocks; -P, -T, -b, -k, -n and -u, which are unscaled values; and, when in POSIX Mode (see Bash POSIX Mode), -c and -f, which are in 512-byte increments.

The return status is zero unless an invalid option or argument is supplied, or an error occurs while setting a new limit.

unalias
unalias [-a] [name … ]

Remove each name from the list of aliases. If -a is supplied, all aliases are removed. Aliases are described in Aliases.


4.3 Modifying Shell Behavior


4.3.1 The Set Builtin

This builtin is so complicated that it deserves its own section. set allows you to change the values of shell options and set the positional parameters, or to display the names and values of shell variables.

set
set [--abefhkmnptuvxBCEHPT] [-o option-name] [argument …]
set [+abefhkmnptuvxBCEHPT] [+o option-name] [argument …]

If no options or arguments are supplied, set displays the names and values of all shell variables and functions, sorted according to the current locale, in a format that may be reused as input for setting or resetting the currently-set variables. Read-only variables cannot be reset. In POSIX mode, only shell variables are listed.

When options are supplied, they set or unset shell attributes. Options, if specified, have the following meanings:

-a

Each variable or function that is created or modified is given the export attribute and marked for export to the environment of subsequent commands.

-b

Cause the status of terminated background jobs to be reported immediately, rather than before printing the next primary prompt.

-e

Exit immediately if a pipeline (see Pipelines), which may consist of a single simple command (see Simple Commands), a list (see Lists), or a compound command (see Compound Commands) returns a non-zero status. The shell does not exit if the command that fails is part of the command list immediately following a while or until keyword, part of the test in an if statement, part of any command executed in a && or || list except the command following the final && or ||, any command in a pipeline but the last, or if the command’s return status is being inverted with !. If a compound command other than a subshell returns a non-zero status because a command failed while -e was being ignored, the shell does not exit. A trap on ERR, if set, is executed before the shell exits.

This option applies to the shell environment and each subshell environment separately (see Command Execution Environment), and may cause subshells to exit before executing all the commands in the subshell.

If a compound command or shell function executes in a context where -e is being ignored, none of the commands executed within the compound command or function body will be affected by the -e setting, even if -e is set and a command returns a failure status. If a compound command or shell function sets -e while executing in a context where -e is ignored, that setting will not have any effect until the compound command or the command containing the function call completes.

-f

Disable filename expansion (globbing).

-h

Locate and remember (hash) commands as they are looked up for execution. This option is enabled by default.

-k

All arguments in the form of assignment statements are placed in the environment for a command, not just those that precede the command name.

-m

Job control is enabled (see Job Control). All processes run in a separate process group. When a background job completes, the shell prints a line containing its exit status.

-n

Read commands but do not execute them. This may be used to check a script for syntax errors. This option is ignored by interactive shells.

-o option-name

Set the option corresponding to option-name:

allexport

Same as -a.

braceexpand

Same as -B.

emacs

Use an emacs-style line editing interface (see Command Line Editing). This also affects the editing interface used for read -e.

errexit

Same as -e.

errtrace

Same as -E.

functrace

Same as -T.

hashall

Same as -h.

histexpand

Same as -H.

history

Enable command history, as described in Bash History Facilities. This option is on by default in interactive shells.

ignoreeof

An interactive shell will not exit upon reading EOF.

keyword

Same as -k.

monitor

Same as -m.

noclobber

Same as -C.

noexec

Same as -n.

noglob

Same as -f.

nolog

Currently ignored.

notify

Same as -b.

nounset

Same as -u.

onecmd

Same as -t.

physical

Same as -P.

pipefail

If set, the return value of a pipeline is the value of the last (rightmost) command to exit with a non-zero status, or zero if all commands in the pipeline exit successfully. This option is disabled by default.

posix

Change the behavior of Bash where the default operation differs from the POSIX standard to match the standard (see Bash POSIX Mode). This is intended to make Bash behave as a strict superset of that standard.

privileged

Same as -p.

verbose

Same as -v.

vi

Use a vi-style line editing interface. This also affects the editing interface used for read -e.

xtrace

Same as -x.

-p

Turn on privileged mode. In this mode, the $BASH_ENV and $ENV files are not processed, shell functions are not inherited from the environment, and the SHELLOPTS, BASHOPTS, CDPATH and GLOBIGNORE variables, if they appear in the environment, are ignored. If the shell is started with the effective user (group) id not equal to the real user (group) id, and the -p option is not supplied, these actions are taken and the effective user id is set to the real user id. If the -p option is supplied at startup, the effective user id is not reset. Turning this option off causes the effective user and group ids to be set to the real user and group ids.

-t

Exit after reading and executing one command.

-u

Treat unset variables and parameters other than the special parameters ‘@’ or ‘*’ as an error when performing parameter expansion. An error message will be written to the standard error, and a non-interactive shell will exit.

-v

Print shell input lines as they are read.

-x

Print a trace of simple commands, for commands, case commands, select commands, and arithmetic for commands and their arguments or associated word lists after they are expanded and before they are executed. The value of the PS4 variable is expanded and the resultant value is printed before the command and its expanded arguments.

-B

The shell will perform brace expansion (see Brace Expansion). This option is on by default.

-C

Prevent output redirection using ‘>’, ‘>&’, and ‘<>’ from overwriting existing files.

-E

If set, any trap on ERR is inherited by shell functions, command substitutions, and commands executed in a subshell environment. The ERR trap is normally not inherited in such cases.

-H

Enable ‘!’ style history substitution (see History Interaction). This option is on by default for interactive shells.

-P

If set, do not resolve symbolic links when performing commands such as cd which change the current directory. The physical directory is used instead. By default, Bash follows the logical chain of directories when performing commands which change the current directory.

For example, if /usr/sys is a symbolic link to /usr/local/sys then:

$ cd /usr/sys; echo $PWD
/usr/sys
$ cd ..; pwd
/usr

If set -P is on, then:

$ cd /usr/sys; echo $PWD
/usr/local/sys
$ cd ..; pwd
/usr/local
-T

If set, any trap on DEBUG and RETURN are inherited by shell functions, command substitutions, and commands executed in a subshell environment. The DEBUG and RETURN traps are normally not inherited in such cases.

--

If no arguments follow this option, then the positional parameters are unset. Otherwise, the positional parameters are set to the arguments, even if some of them begin with a ‘-’.

-

Signal the end of options, cause all remaining arguments to be assigned to the positional parameters. The -x and -v options are turned off. If there are no arguments, the positional parameters remain unchanged.

Using ‘+’ rather than ‘-’ causes these options to be turned off. The options can also be used upon invocation of the shell. The current set of options may be found in $-.

The remaining N arguments are positional parameters and are assigned, in order, to $1, $2, … $N. The special parameter # is set to N.

The return status is always zero unless an invalid option is supplied.


4.3.2 The Shopt Builtin

This builtin allows you to change additional shell optional behavior.

shopt
shopt [-pqsu] [-o] [optname …]

Toggle the values of settings controlling optional shell behavior. The settings can be either those listed below, or, if the -o option is used, those available with the -o option to the set builtin command (see The Set Builtin). With no options, or with the -p option, a list of all settable options is displayed, with an indication of whether or not each is set. The -p option causes output to be displayed in a form that may be reused as input. Other options have the following meanings:

-s

Enable (set) each optname.

-u

Disable (unset) each optname.

-q

Suppresses normal output; the return status indicates whether the optname is set or unset. If multiple optname arguments are given with -q, the return status is zero if all optnames are enabled; non-zero otherwise.

-o

Restricts the values of optname to be those defined for the -o option to the set builtin (see The Set Builtin).

If either -s or -u is used with no optname arguments, shopt shows only those options which are set or unset, respectively.

Unless otherwise noted, the shopt options are disabled (off) by default.

The return status when listing options is zero if all optnames are enabled, non-zero otherwise. When setting or unsetting options, the return status is zero unless an optname is not a valid shell option.

The list of shopt options is:

autocd

If set, a command name that is the name of a directory is executed as if it were the argument to the cd command. This option is only used by interactive shells.

cdable_vars

If this is set, an argument to the cd builtin command that is not a directory is assumed to be the name of a variable whose value is the directory to change to.

cdspell

If set, minor errors in the spelling of a directory component in a cd command will be corrected. The errors checked for are transposed characters, a missing character, and a character too many. If a correction is found, the corrected path is printed, and the command proceeds. This option is only used by interactive shells.

checkhash

If this is set, Bash checks that a command found in the hash table exists before trying to execute it. If a hashed command no longer exists, a normal path search is performed.

checkjobs

If set, Bash lists the status of any stopped and running jobs before exiting an interactive shell. If any jobs are running, this causes the exit to be deferred until a second exit is attempted without an intervening command (see Job Control). The shell always postpones exiting if any jobs are stopped.

checkwinsize

If set, Bash checks the window size after each command and, if necessary, updates the values of LINES and COLUMNS.

cmdhist

If set, Bash attempts to save all lines of a multiple-line command in the same history entry. This allows easy re-editing of multi-line commands.

compat31

If set, Bash changes its behavior to that of version 3.1 with respect to quoted arguments to the conditional command’s ‘=~’ operator and with respect to locale-specific string comparison when using the [[ conditional command’s ‘<’ and ‘>’ operators. Bash versions prior to bash-4.1 use ASCII collation and strcmp(3); bash-4.1 and later use the current locale’s collation sequence and strcoll(3).

compat32

If set, Bash changes its behavior to that of version 3.2 with respect to locale-specific string comparison when using the [[ conditional command’s ‘<’ and ‘>’ operators (see previous item) and the effect of interrupting a command list. Bash versions 3.2 and earlier continue with the next command in the list after one terminates due to an interrupt.

compat40

If set, Bash changes its behavior to that of version 4.0 with respect to locale-specific string comparison when using the [[ conditional command’s ‘<’ and ‘>’ operators (see description of compat31) and the effect of interrupting a command list. Bash versions 4.0 and later interrupt the list as if the shell received the interrupt; previous versions continue with the next command in the list.

compat41

If set, Bash, when in POSIX mode, treats a single quote in a double-quoted parameter expansion as a special character. The single quotes must match (an even number) and the characters between the single quotes are considered quoted. This is the behavior of POSIX mode through version 4.1. The default Bash behavior remains as in previous versions.

compat42

If set, Bash does not process the replacement string in the pattern substitution word expansion using quote removal.

compat43

If set, Bash does not print a warning message if an attempt is made to use a quoted compound array assignment as an argument to declare, makes word expansion errors non-fatal errors that cause the current command to fail (the default behavior is to make them fatal errors that cause the shell to exit), and does not reset the loop state when a shell function is executed (this allows break or continue in a shell function to affect loops in the caller’s context).

complete_fullquote

If set, Bash quotes all shell metacharacters in filenames and directory names when performing completion. If not set, Bash removes metacharacters such as the dollar sign from the set of characters that will be quoted in completed filenames when these metacharacters appear in shell variable references in words to be completed. This means that dollar signs in variable names that expand to directories will not be quoted; however, any dollar signs appearing in filenames will not be quoted, either. This is active only when bash is using backslashes to quote completed filenames. This variable is set by default, which is the default Bash behavior in versions through 4.2.

direxpand

If set, Bash replaces directory names with the results of word expansion when performing filename completion. This changes the contents of the readline editing buffer. If not set, Bash attempts to preserve what the user typed.

dirspell

If set, Bash attempts spelling correction on directory names during word completion if the directory name initially supplied does not exist.

dotglob

If set, Bash includes filenames beginning with a ‘.’ in the results of filename expansion.

execfail

If this is set, a non-interactive shell will not exit if it cannot execute the file specified as an argument to the exec builtin command. An interactive shell does not exit if exec fails.

expand_aliases

If set, aliases are expanded as described below under Aliases, Aliases. This option is enabled by default for interactive shells.

extdebug

If set at shell invocation, arrange to execute the debugger profile before the shell starts, identical to the --debugger option. If set after invocation, behavior intended for use by debuggers is enabled:

  1. The -F option to the declare builtin (see Bash Builtins) displays the source file name and line number corresponding to each function name supplied as an argument.
  2. If the command run by the DEBUG trap returns a non-zero value, the next command is skipped and not executed.
  3. If the command run by the DEBUG trap returns a value of 2, and the shell is executing in a subroutine (a shell function or a shell script executed by the . or source builtins), the shell simulates a call to return.
  4. BASH_ARGC and BASH_ARGV are updated as described in their descriptions (see Bash Variables).
  5. Function tracing is enabled: command substitution, shell functions, and subshells invoked with ( command ) inherit the DEBUG and RETURN traps.
  6. Error tracing is enabled: command substitution, shell functions, and subshells invoked with ( command ) inherit the ERR trap.
extglob

If set, the extended pattern matching features described above (see Pattern Matching) are enabled.

extquote

If set, $'string' and $"string" quoting is performed within ${parameter} expansions enclosed in double quotes. This option is enabled by default.

failglob

If set, patterns which fail to match filenames during filename expansion result in an expansion error.

force_fignore

If set, the suffixes specified by the FIGNORE shell variable cause words to be ignored when performing word completion even if the ignored words are the only possible completions. See Bash Variables, for a description of FIGNORE. This option is enabled by default.

globasciiranges

If set, range expressions used in pattern matching bracket expressions (see Pattern Matching) behave as if in the traditional C locale when performing comparisons. That is, the current locale’s collating sequence is not taken into account, so ‘b’ will not collate between ‘A’ and ‘B’, and upper-case and lower-case ASCII characters will collate together.

globstar

If set, the pattern ‘**’ used in a filename expansion context will match all files and zero or more directories and subdirectories. If the pattern is followed by a ‘/’, only directories and subdirectories match.

gnu_errfmt

If set, shell error messages are written in the standard GNU error message format.

histappend

If set, the history list is appended to the file named by the value of the HISTFILE variable when the shell exits, rather than overwriting the file.

histreedit

If set, and Readline is being used, a user is given the opportunity to re-edit a failed history substitution.

histverify

If set, and Readline is being used, the results of history substitution are not immediately passed to the shell parser. Instead, the resulting line is loaded into the Readline editing buffer, allowing further modification.

hostcomplete

If set, and Readline is being used, Bash will attempt to perform hostname completion when a word containing a ‘@’ is being completed (see Commands For Completion). This option is enabled by default.

huponexit

If set, Bash will send SIGHUP to all jobs when an interactive login shell exits (see Signals).

inherit_errexit

If set, command substitution inherits the value of the errexit option, instead of unsetting it in the subshell environment. This option is enabled when POSIX mode is enabled.

interactive_comments

Allow a word beginning with ‘#’ to cause that word and all remaining characters on that line to be ignored in an interactive shell. This option is enabled by default.

lastpipe

If set, and job control is not active, the shell runs the last command of a pipeline not executed in the background in the current shell environment.

lithist

If enabled, and the cmdhist option is enabled, multi-line commands are saved to the history with embedded newlines rather than using semicolon separators where possible.

login_shell

The shell sets this option if it is started as a login shell (see Invoking Bash). The value may not be changed.

mailwarn

If set, and a file that Bash is checking for mail has been accessed since the last time it was checked, the message "The mail in mailfile has been read" is displayed.

no_empty_cmd_completion

If set, and Readline is being used, Bash will not attempt to search the PATH for possible completions when completion is attempted on an empty line.

nocaseglob

If set, Bash matches filenames in a case-insensitive fashion when performing filename expansion.

nocasematch

If set, Bash matches patterns in a case-insensitive fashion when performing matching while executing case or [[ conditional commands, when performing pattern substitution word expansions, or when filtering possible completions as part of programmable completion.

nullglob

If set, Bash allows filename patterns which match no files to expand to a null string, rather than themselves.

progcomp

If set, the programmable completion facilities (see Programmable Completion) are enabled. This option is enabled by default.

promptvars

If set, prompt strings undergo parameter expansion, command substitution, arithmetic expansion, and quote removal after being expanded as described below (see Controlling the Prompt). This option is enabled by default.

restricted_shell

The shell sets this option if it is started in restricted mode (see The Restricted Shell). The value may not be changed. This is not reset when the startup files are executed, allowing the startup files to discover whether or not a shell is restricted.

shift_verbose

If this is set, the shift builtin prints an error message when the shift count exceeds the number of positional parameters.

sourcepath

If set, the source builtin uses the value of PATH to find the directory containing the file supplied as an argument. This option is enabled by default.

xpg_echo

If set, the echo builtin expands backslash-escape sequences by default.

The return status when listing options is zero if all optnames are enabled, non-zero otherwise. When setting or unsetting options, the return status is zero unless an optname is not a valid shell option.


4.4 Special Builtins

For historical reasons, the POSIX standard has classified several builtin commands as special. When Bash is executing in POSIX mode, the special builtins differ from other builtin commands in three respects:

  1. Special builtins are found before shell functions during command lookup.
  2. If a special builtin returns an error status, a non-interactive shell exits.
  3. Assignment statements preceding the command stay in effect in the shell environment after the command completes.

When Bash is not executing in POSIX mode, these builtins behave no differently than the rest of the Bash builtin commands. The Bash POSIX mode is described in Bash POSIX Mode.

These are the POSIX special builtins:

break : . continue eval exec exit export readonly return set
shift trap unset

Next: , Previous: , Up: Top   [Contents][Index]

5 Shell Variables

This chapter describes the shell variables that Bash uses. Bash automatically assigns default values to a number of variables.


5.1 Bourne Shell Variables

Bash uses certain shell variables in the same way as the Bourne shell. In some cases, Bash assigns a default value to the variable.

CDPATH

A colon-separated list of directories used as a search path for the cd builtin command.

HOME

The current user’s home directory; the default for the cd builtin command. The value of this variable is also used by tilde expansion (see Tilde Expansion).

IFS

A list of characters that separate fields; used when the shell splits words as part of expansion.

MAIL

If this parameter is set to a filename or directory name and the MAILPATH variable is not set, Bash informs the user of the arrival of mail in the specified file or Maildir-format directory.

MAILPATH

A colon-separated list of filenames which the shell periodically checks for new mail. Each list entry can specify the message that is printed when new mail arrives in the mail file by separating the filename from the message with a ‘?’. When used in the text of the message, $_ expands to the name of the current mail file.

OPTARG

The value of the last option argument processed by the getopts builtin.

OPTIND

The index of the last option argument processed by the getopts builtin.

PATH

A colon-separated list of directories in which the shell looks for commands. A zero-length (null) directory name in the value of PATH indicates the current directory. A null directory name may appear as two adjacent colons, or as an initial or trailing colon.

PS1

The primary prompt string. The default value is ‘\s-\v\$ ’. See Controlling the Prompt, for the complete list of escape sequences that are expanded before PS1 is displayed.

PS2

The secondary prompt string. The default value is ‘> ’.


5.2 Bash Variables

These variables are set or used by Bash, but other shells do not normally treat them specially.

A few variables used by Bash are described in different chapters: variables for controlling the job control facilities (see Job Control Variables).

BASH

The full pathname used to execute the current instance of Bash.

BASHOPTS

A colon-separated list of enabled shell options. Each word in the list is a valid argument for the -s option to the shopt builtin command (see The Shopt Builtin). The options appearing in BASHOPTS are those reported as ‘on’ by ‘shopt’. If this variable is in the environment when Bash starts up, each shell option in the list will be enabled before reading any startup files. This variable is readonly.

BASHPID

Expands to the process ID of the current Bash process. This differs from $$ under certain circumstances, such as subshells that do not require Bash to be re-initialized.

BASH_ALIASES

An associative array variable whose members correspond to the internal list of aliases as maintained by the alias builtin. (see Bourne Shell Builtins). Elements added to this array appear in the alias list; however, unsetting array elements currently does not cause aliases to be removed from the alias list. If BASH_ALIASES is unset, it loses its special properties, even if it is subsequently reset.

BASH_ARGC

An array variable whose values are the number of parameters in each frame of the current bash execution call stack. The number of parameters to the current subroutine (shell function or script executed with . or source) is at the top of the stack. When a subroutine is executed, the number of parameters passed is pushed onto BASH_ARGC. The shell sets BASH_ARGC only when in extended debugging mode (see The Shopt Builtin for a description of the extdebug option to the shopt builtin).

BASH_ARGV

An array variable containing all of the parameters in the current bash execution call stack. The final parameter of the last subroutine call is at the top of the stack; the first parameter of the initial call is at the bottom. When a subroutine is executed, the parameters supplied are pushed onto BASH_ARGV. The shell sets BASH_ARGV only when in extended debugging mode (see The Shopt Builtin for a description of the extdebug option to the shopt builtin).

BASH_CMDS

An associative array variable whose members correspond to the internal hash table of commands as maintained by the hash builtin (see Bourne Shell Builtins). Elements added to this array appear in the hash table; however, unsetting array elements currently does not cause command names to be removed from the hash table. If BASH_CMDS is unset, it loses its special properties, even if it is subsequently reset.

BASH_COMMAND

The command currently being executed or about to be executed, unless the shell is executing a command as the result of a trap, in which case it is the command executing at the time of the trap.

BASH_COMPAT

The value is used to set the shell’s compatibility level. See The Shopt Builtin, for a description of the various compatibility levels and their effects. The value may be a decimal number (e.g., 4.2) or an integer (e.g., 42) corresponding to the desired compatibility level. If BASH_COMPAT is unset or set to the empty string, the compatibility level is set to the default for the current version. If BASH_COMPAT is set to a value that is not one of the valid compatibility levels, the shell prints an error message and sets the compatibility level to the default for the current version. The valid compatibility levels correspond to the compatibility options accepted by the shopt builtin described above (for example, compat42 means that 4.2 and 42 are valid values). The current version is also a valid value.

BASH_ENV

If this variable is set when Bash is invoked to execute a shell script, its value is expanded and used as the name of a startup file to read before executing the script. See Bash Startup Files.

BASH_EXECUTION_STRING

The command argument to the -c invocation option.

BASH_LINENO

An array variable whose members are the line numbers in source files where each corresponding member of FUNCNAME was invoked. ${BASH_LINENO[$i]} is the line number in the source file (${BASH_SOURCE[$i+1]}) where ${FUNCNAME[$i]} was called (or ${BASH_LINENO[$i-1]} if referenced within another shell function). Use LINENO to obtain the current line number.

BASH_LOADABLES_PATH

A colon-separated list of directories in which the shell looks for dynamically loadable builtins specified by the enable command.

BASH_REMATCH

An array variable whose members are assigned by the ‘=~’ binary operator to the [[ conditional command (see Conditional Constructs). The element with index 0 is the portion of the string matching the entire regular expression. The element with index n is the portion of the string matching the nth parenthesized subexpression. This variable is read-only.

BASH_SOURCE

An array variable whose members are the source filenames where the corresponding shell function names in the FUNCNAME array variable are defined. The shell function ${FUNCNAME[$i]} is defined in the file ${BASH_SOURCE[$i]} and called from ${BASH_SOURCE[$i+1]}

BASH_SUBSHELL

Incremented by one within each subshell or subshell environment when the shell begins executing in that environment. The initial value is 0.

BASH_VERSINFO

A readonly array variable (see Arrays) whose members hold version information for this instance of Bash. The values assigned to the array members are as follows:

BASH_VERSINFO[0]

The major version number (the release).

BASH_VERSINFO[1]

The minor version number (the version).

BASH_VERSINFO[2]

The patch level.

BASH_VERSINFO[3]

The build version.

BASH_VERSINFO[4]

The release status (e.g., beta1).

BASH_VERSINFO[5]

The value of MACHTYPE.

BASH_VERSION

The version number of the current instance of Bash.

BASH_XTRACEFD

If set to an integer corresponding to a valid file descriptor, Bash will write the trace output generated when ‘set -x’ is enabled to that file descriptor. This allows tracing output to be separated from diagnostic and error messages. The file descriptor is closed when BASH_XTRACEFD is unset or assigned a new value. Unsetting BASH_XTRACEFD or assigning it the empty string causes the trace output to be sent to the standard error. Note that setting BASH_XTRACEFD to 2 (the standard error file descriptor) and then unsetting it will result in the standard error being closed.

CHILD_MAX

Set the number of exited child status values for the shell to remember. Bash will not allow this value to be decreased below a POSIX-mandated minimum, and there is a maximum value (currently 8192) that this may not exceed. The minimum value is system-dependent.

COLUMNS

Used by the select command to determine the terminal width when printing selection lists. Automatically set if the checkwinsize option is enabled (see The Shopt Builtin), or in an interactive shell upon receipt of a SIGWINCH.

COMP_CWORD

An index into ${COMP_WORDS} of the word containing the current cursor position. This variable is available only in shell functions invoked by the programmable completion facilities (see Programmable Completion).

COMP_LINE

The current command line. This variable is available only in shell functions and external commands invoked by the programmable completion facilities (see Programmable Completion).

COMP_POINT

The index of the current cursor position relative to the beginning of the current command. If the current cursor position is at the end of the current command, the value of this variable is equal to ${#COMP_LINE}. This variable is available only in shell functions and external commands invoked by the programmable completion facilities (see Programmable Completion).

COMP_TYPE

Set to an integer value corresponding to the type of completion attempted that caused a completion function to be called: TAB, for normal completion, ‘?’, for listing completions after successive tabs, ‘!’, for listing alternatives on partial word completion, ‘@’, to list completions if the word is not unmodified, or ‘%’, for menu completion. This variable is available only in shell functions and external commands invoked by the programmable completion facilities (see Programmable Completion).

COMP_KEY

The key (or final key of a key sequence) used to invoke the current completion function.

COMP_WORDBREAKS

The set of characters that the Readline library treats as word separators when performing word completion. If COMP_WORDBREAKS is unset, it loses its special properties, even if it is subsequently reset.

COMP_WORDS

An array variable consisting of the individual words in the current command line. The line is split into words as Readline would split it, using COMP_WORDBREAKS as described above. This variable is available only in shell functions invoked by the programmable completion facilities (see Programmable Completion).

COMPREPLY

An array variable from which Bash reads the possible completions generated by a shell function invoked by the programmable completion facility (see Programmable Completion). Each array element contains one possible completion.

COPROC

An array variable created to hold the file descriptors for output from and input to an unnamed coprocess (see Coprocesses).

DIRSTACK

An array variable containing the current contents of the directory stack. Directories appear in the stack in the order they are displayed by the dirs builtin. Assigning to members of this array variable may be used to modify directories already in the stack, but the pushd and popd builtins must be used to add and remove directories. Assignment to this variable will not change the current directory. If DIRSTACK is unset, it loses its special properties, even if it is subsequently reset.

EMACS

If Bash finds this variable in the environment when the shell starts with value ‘t’, it assumes that the shell is running in an Emacs shell buffer and disables line editing.

ENV

Similar to BASH_ENV; used when the shell is invoked in POSIX Mode (see Bash POSIX Mode).

EUID

The numeric effective user id of the current user. This variable is readonly.

EXECIGNORE

A colon-separated list of shell patterns (see Pattern Matching) defining the list of filenames to be ignored by command search using PATH. Files whose full pathnames match one of these patterns are not considered executable files for the purposes of completion and command execution via PATH lookup. This does not affect the behavior of the [, test, and [[ commands. Full pathnames in the command hash table are not subject to EXECIGNORE. Use this variable to ignore shared library files that have the executable bit set, but are not executable files. The pattern matching honors the setting of the extglob shell option.

FCEDIT

The editor used as a default by the -e option to the fc builtin command.

FIGNORE

A colon-separated list of suffixes to ignore when performing filename completion. A filename whose suffix matches one of the entries in FIGNORE is excluded from the list of matched filenames. A sample value is ‘.o:~

FUNCNAME

An array variable containing the names of all shell functions currently in the execution call stack. The element with index 0 is the name of any currently-executing shell function. The bottom-most element (the one with the highest index) is "main". This variable exists only when a shell function is executing. Assignments to FUNCNAME have no effect. If FUNCNAME is unset, it loses its special properties, even if it is subsequently reset.

This variable can be used with BASH_LINENO and BASH_SOURCE. Each element of FUNCNAME has corresponding elements in BASH_LINENO and BASH_SOURCE to describe the call stack. For instance, ${FUNCNAME[$i]} was called from the file ${BASH_SOURCE[$i+1]} at line number ${BASH_LINENO[$i]}. The caller builtin displays the current call stack using this information.

FUNCNEST

If set to a numeric value greater than 0, defines a maximum function nesting level. Function invocations that exceed this nesting level will cause the current command to abort.

GLOBIGNORE

A colon-separated list of patterns defining the set of filenames to be ignored by filename expansion. If a filename matched by a filename expansion pattern also matches one of the patterns in GLOBIGNORE, it is removed from the list of matches. The pattern matching honors the setting of the extglob shell option.

GROUPS

An array variable containing the list of groups of which the current user is a member. Assignments to GROUPS have no effect. If GROUPS is unset, it loses its special properties, even if it is subsequently reset.

histchars

Up to three characters which control history expansion, quick substitution, and tokenization (see History Interaction). The first character is the history expansion character, that is, the character which signifies the start of a history expansion, normally ‘!’. The second character is the character which signifies ‘quick substitution’ when seen as the first character on a line, normally ‘^’. The optional third character is the character which indicates that the remainder of the line is a comment when found as the first character of a word, usually ‘#’. The history comment character causes history substitution to be skipped for the remaining words on the line. It does not necessarily cause the shell parser to treat the rest of the line as a comment.

HISTCMD

The history number, or index in the history list, of the current command. If HISTCMD is unset, it loses its special properties, even if it is subsequently reset.

HISTCONTROL

A colon-separated list of values controlling how commands are saved on the history list. If the list of values includes ‘ignorespace’, lines which begin with a space character are not saved in the history list. A value of ‘ignoredups’ causes lines which match the previous history entry to not be saved. A value of ‘ignoreboth’ is shorthand for ‘ignorespace’ and ‘ignoredups’. A value of ‘erasedups’ causes all previous lines matching the current line to be removed from the history list before that line is saved. Any value not in the above list is ignored. If HISTCONTROL is unset, or does not include a valid value, all lines read by the shell parser are saved on the history list, subject to the value of HISTIGNORE. The second and subsequent lines of a multi-line compound command are not tested, and are added to the history regardless of the value of HISTCONTROL.

HISTFILE

The name of the file to which the command history is saved. The default value is ~/.bash_history.

HISTFILESIZE

The maximum number of lines contained in the history file. When this variable is assigned a value, the history file is truncated, if necessary, to contain no more than that number of lines by removing the oldest entries. The history file is also truncated to this size after writing it when a shell exits. If the value is 0, the history file is truncated to zero size. Non-numeric values and numeric values less than zero inhibit truncation. The shell sets the default value to the value of HISTSIZE after reading any startup files.

HISTIGNORE

A colon-separated list of patterns used to decide which command lines should be saved on the history list. Each pattern is anchored at the beginning of the line and must match the complete line (no implicit ‘*’ is appended). Each pattern is tested against the line after the checks specified by HISTCONTROL are applied. In addition to the normal shell pattern matching characters, ‘&’ matches the previous history line. ‘&’ may be escaped using a backslash; the backslash is removed before attempting a match. The second and subsequent lines of a multi-line compound command are not tested, and are added to the history regardless of the value of HISTIGNORE. The pattern matching honors the setting of the extglob shell option.

HISTIGNORE subsumes the function of HISTCONTROL. A pattern of ‘&’ is identical to ignoredups, and a pattern of ‘[ ]*’ is identical to ignorespace. Combining these two patterns, separating them with a colon, provides the functionality of ignoreboth.

HISTSIZE

The maximum number of commands to remember on the history list. If the value is 0, commands are not saved in the history list. Numeric values less than zero result in every command being saved on the history list (there is no limit). The shell sets the default value to 500 after reading any startup files.

HISTTIMEFORMAT

If this variable is set and not null, its value is used as a format string for strftime to print the time stamp associated with each history entry displayed by the history builtin. If this variable is set, time stamps are written to the history file so they may be preserved across shell sessions. This uses the history comment character to distinguish timestamps from other history lines.

HOSTFILE

Contains the name of a file in the same format as /etc/hosts that should be read when the shell needs to complete a hostname. The list of possible hostname completions may be changed while the shell is running; the next time hostname completion is attempted after the value is changed, Bash adds the contents of the new file to the existing list. If HOSTFILE is set, but has no value, or does not name a readable file, Bash attempts to read /etc/hosts to obtain the list of possible hostname completions. When HOSTFILE is unset, the hostname list is cleared.

HOSTNAME

The name of the current host.

HOSTTYPE

A string describing the machine Bash is running on.

IGNOREEOF

Controls the action of the shell on receipt of an EOF character as the sole input. If set, the value denotes the number of consecutive EOF characters that can be read as the first character on an input line before the shell will exit. If the variable exists but does not have a numeric value (or has no value) then the default is 10. If the variable does not exist, then EOF signifies the end of input to the shell. This is only in effect for interactive shells.

INPUTRC

The name of the Readline initialization file, overriding the default of ~/.inputrc.

LANG

Used to determine the locale category for any category not specifically selected with a variable starting with LC_.

LC_ALL

This variable overrides the value of LANG and any other LC_ variable specifying a locale category.

LC_COLLATE

This variable determines the collation order used when sorting the results of filename expansion, and determines the behavior of range expressions, equivalence classes, and collating sequences within filename expansion and pattern matching (see Filename Expansion).

LC_CTYPE

This variable determines the interpretation of characters and the behavior of character classes within filename expansion and pattern matching (see Filename Expansion).

LC_MESSAGES

This variable determines the locale used to translate double-quoted strings preceded by a ‘$’ (see Locale Translation).

LC_NUMERIC

This variable determines the locale category used for number formatting.

LC_TIME

This variable determines the locale category used for data and time formatting.

LINENO

The line number in the script or shell function currently executing.

LINES

Used by the select command to determine the column length for printing selection lists. Automatically set if the checkwinsize option is enabled (see The Shopt Builtin), or in an interactive shell upon receipt of a SIGWINCH.

MACHTYPE

A string that fully describes the system type on which Bash is executing, in the standard GNU cpu-company-system format.

MAILCHECK

How often (in seconds) that the shell should check for mail in the files specified in the MAILPATH or MAIL variables. The default is 60 seconds. When it is time to check for mail, the shell does so before displaying the primary prompt. If this variable is unset, or set to a value that is not a number greater than or equal to zero, the shell disables mail checking.

MAPFILE

An array variable created to hold the text read by the mapfile builtin when no variable name is supplied.

OLDPWD

The previous working directory as set by the cd builtin.

OPTERR

If set to the value 1, Bash displays error messages generated by the getopts builtin command.

OSTYPE

A string describing the operating system Bash is running on.

PIPESTATUS

An array variable (see Arrays) containing a list of exit status values from the processes in the most-recently-executed foreground pipeline (which may contain only a single command).

POSIXLY_CORRECT

If this variable is in the environment when Bash starts, the shell enters POSIX mode (see Bash POSIX Mode) before reading the startup files, as if the --posix invocation option had been supplied. If it is set while the shell is running, Bash enables POSIX mode, as if the command

set -o posix

had been executed.

PPID

The process ID of the shell’s parent process. This variable is readonly.

PROMPT_COMMAND

If set, the value is interpreted as a command to execute before the printing of each primary prompt ($PS1).

PROMPT_DIRTRIM

If set to a number greater than zero, the value is used as the number of trailing directory components to retain when expanding the \w and \W prompt string escapes (see Controlling the Prompt). Characters removed are replaced with an ellipsis.

PS0

The value of this parameter is expanded like PS1 and displayed by interactive shells after reading a command and before the command is executed.

PS3

The value of this variable is used as the prompt for the select command. If this variable is not set, the select command prompts with ‘#?

PS4

The value is the prompt printed before the command line is echoed when the -x option is set (see The Set Builtin). The first character of PS4 is replicated multiple times, as necessary, to indicate multiple levels of indirection. The default is ‘+ ’.

PWD

The current working directory as set by the cd builtin.

RANDOM

Each time this parameter is referenced, a random integer between 0 and 32767 is generated. Assigning a value to this variable seeds the random number generator.

READLINE_LINE

The contents of the Readline line buffer, for use with ‘bind -x’ (see Bash Builtins).

READLINE_POINT

The position of the insertion point in the Readline line buffer, for use with ‘bind -x’ (see Bash Builtins).

REPLY

The default variable for the read builtin.

SECONDS

This variable expands to the number of seconds since the shell was started. Assignment to this variable resets the count to the value assigned, and the expanded value becomes the value assigned plus the number of seconds since the assignment.

SHELL

The full pathname to the shell is kept in this environment variable. If it is not set when the shell starts, Bash assigns to it the full pathname of the current user’s login shell.

SHELLOPTS

A colon-separated list of enabled shell options. Each word in the list is a valid argument for the -o option to the set builtin command (see The Set Builtin). The options appearing in SHELLOPTS are those reported as ‘on’ by ‘set -o’. If this variable is in the environment when Bash starts up, each shell option in the list will be enabled before reading any startup files. This variable is readonly.

SHLVL

Incremented by one each time a new instance of Bash is started. This is intended to be a count of how deeply your Bash shells are nested.

TIMEFORMAT

The value of this parameter is used as a format string specifying how the timing information for pipelines prefixed with the time reserved word should be displayed. The ‘%’ character introduces an escape sequence that is expanded to a time value or other information. The escape sequences and their meanings are as follows; the braces denote optional portions.

%%

A literal ‘%’.

%[p][l]R

The elapsed time in seconds.

%[p][l]U

The number of CPU seconds spent in user mode.

%[p][l]S

The number of CPU seconds spent in system mode.

%P

The CPU percentage, computed as (%U + %S) / %R.

The optional p is a digit specifying the precision, the number of fractional digits after a decimal point. A value of 0 causes no decimal point or fraction to be output. At most three places after the decimal point may be specified; values of p greater than 3 are changed to 3. If p is not specified, the value 3 is used.

The optional l specifies a longer format, including minutes, of the form MMmSS.FFs. The value of p determines whether or not the fraction is included.

If this variable is not set, Bash acts as if it had the value

$'\nreal\t%3lR\nuser\t%3lU\nsys\t%3lS'

If the value is null, no timing information is displayed. A trailing newline is added when the format string is displayed.

TMOUT

If set to a value greater than zero, TMOUT is treated as the default timeout for the read builtin (see Bash Builtins). The select command (see Conditional Constructs) terminates if input does not arrive after TMOUT seconds when input is coming from a terminal.

In an interactive shell, the value is interpreted as the number of seconds to wait for a line of input after issuing the primary prompt. Bash terminates after waiting for that number of seconds if a complete line of input does not arrive.

TMPDIR

If set, Bash uses its value as the name of a directory in which Bash creates temporary files for the shell’s use.

UID

The numeric real user id of the current user. This variable is readonly.


Next: , Previous: , Up: Top   [Contents][Index]

6 Bash Features

This chapter describes features unique to Bash.


6.1 Invoking Bash

bash [long-opt] [-ir] [-abefhkmnptuvxdBCDHP] [-o option] [-O shopt_option] [argument …]
bash [long-opt] [-abefhkmnptuvxdBCDHP] [-o option] [-O shopt_option] -c string [argument …]
bash [long-opt] -s [-abefhkmnptuvxdBCDHP] [-o option] [-O shopt_option] [argument …]

All of the single-character options used with the set builtin (see The Set Builtin) can be used as options when the shell is invoked. In addition, there are several multi-character options that you can use. These options must appear on the command line before the single-character options to be recognized.

--debugger

Arrange for the debugger profile to be executed before the shell starts. Turns on extended debugging mode (see The Shopt Builtin for a description of the extdebug option to the shopt builtin).

--dump-po-strings

A list of all double-quoted strings preceded by ‘$’ is printed on the standard output in the GNU gettext PO (portable object) file format. Equivalent to -D except for the output format.

--dump-strings

Equivalent to -D.

--help

Display a usage message on standard output and exit successfully.

--init-file filename
--rcfile filename

Execute commands from filename (instead of ~/.bashrc) in an interactive shell.

--login

Equivalent to -l.

--noediting

Do not use the GNU Readline library (see Command Line Editing) to read command lines when the shell is interactive.

--noprofile

Don’t load the system-wide startup file /etc/profile or any of the personal initialization files ~/.bash_profile, ~/.bash_login, or ~/.profile when Bash is invoked as a login shell.

--norc

Don’t read the ~/.bashrc initialization file in an interactive shell. This is on by default if the shell is invoked as sh.

--posix

Change the behavior of Bash where the default operation differs from the POSIX standard to match the standard. This is intended to make Bash behave as a strict superset of that standard. See Bash POSIX Mode, for a description of the Bash POSIX mode.

--restricted

Make the shell a restricted shell (see The Restricted Shell).

--verbose

Equivalent to -v. Print shell input lines as they’re read.

--version

Show version information for this instance of Bash on the standard output and exit successfully.

There are several single-character options that may be supplied at invocation which are not available with the set builtin.

-c

Read and execute commands from the first non-option argument command_string, then exit. If there are arguments after the command_string, the first argument is assigned to $0 and any remaining arguments are assigned to the positional parameters. The assignment to $0 sets the name of the shell, which is used in warning and error messages.

-i

Force the shell to run interactively. Interactive shells are described in Interactive Shells.

-l

Make this shell act as if it had been directly invoked by login. When the shell is interactive, this is equivalent to starting a login shell with ‘exec -l bash’. When the shell is not interactive, the login shell startup files will be executed. ‘exec bash -l’ or ‘exec bash --login’ will replace the current shell with a Bash login shell. See Bash Startup Files, for a description of the special behavior of a login shell.

-r

Make the shell a restricted shell (see The Restricted Shell).

-s

If this option is present, or if no arguments remain after option processing, then commands are read from the standard input. This option allows the positional parameters to be set when invoking an interactive shell.

-D

A list of all double-quoted strings preceded by ‘$’ is printed on the standard output. These are the strings that are subject to language translation when the current locale is not C or POSIX (see Locale Translation). This implies the -n option; no commands will be executed.

[-+]O [shopt_option]

shopt_option is one of the shell options accepted by the shopt builtin (see The Shopt Builtin). If shopt_option is present, -O sets the value of that option; +O unsets it. If shopt_option is not supplied, the names and values of the shell options accepted by shopt are printed on the standard output. If the invocation option is +O, the output is displayed in a format that may be reused as input.

--

A -- signals the end of options and disables further option processing. Any arguments after the -- are treated as filenames and arguments.

A login shell is one whose first character of argument zero is ‘-’, or one invoked with the --login option.

An interactive shell is one started without non-option arguments, unless -s is specified, without specifying the -c option, and whose input and output are both connected to terminals (as determined by isatty(3)), or one started with the -i option. See Interactive Shells, for more information.

If arguments remain after option processing, and neither the -c nor the -s option has been supplied, the first argument is assumed to be the name of a file containing shell commands (see Shell Scripts). When Bash is invoked in this fashion, $0 is set to the name of the file, and the positional parameters are set to the remaining arguments. Bash reads and executes commands from this file, then exits. Bash’s exit status is the exit status of the last command executed in the script. If no commands are executed, the exit status is 0.


6.2 Bash Startup Files

This section describes how Bash executes its startup files. If any of the files exist but cannot be read, Bash reports an error. Tildes are expanded in filenames as described above under Tilde Expansion (see Tilde Expansion).

Interactive shells are described in Interactive Shells.

Invoked as an interactive login shell, or with --login

When Bash is invoked as an interactive login shell, or as a non-interactive shell with the --login option, it first reads and executes commands from the file /etc/profile, if that file exists. After reading that file, it looks for ~/.bash_profile, ~/.bash_login, and ~/.profile, in that order, and reads and executes commands from the first one that exists and is readable. The --noprofile option may be used when the shell is started to inhibit this behavior.

When an interactive login shell exits, or a non-interactive login shell executes the exit builtin command, Bash reads and executes commands from the file ~/.bash_logout, if it exists.

Invoked as an interactive non-login shell

When an interactive shell that is not a login shell is started, Bash reads and executes commands from ~/.bashrc, if that file exists. This may be inhibited by using the --norc option. The --rcfile file option will force Bash to read and execute commands from file instead of ~/.bashrc.

So, typically, your ~/.bash_profile contains the line

if [ -f ~/.bashrc ]; then . ~/.bashrc; fi

after (or before) any login-specific initializations.

Invoked non-interactively

When Bash is started non-interactively, to run a shell script, for example, it looks for the variable BASH_ENV in the environment, expands its value if it appears there, and uses the expanded value as the name of a file to read and execute. Bash behaves as if the following command were executed:

if [ -n "$BASH_ENV" ]; then . "$BASH_ENV"; fi

but the value of the PATH variable is not used to search for the filename.

As noted above, if a non-interactive shell is invoked with the --login option, Bash attempts to read and execute commands from the login shell startup files.

Invoked with name sh

If Bash is invoked with the name sh, it tries to mimic the startup behavior of historical versions of sh as closely as possible, while conforming to the POSIX standard as well.

When invoked as an interactive login shell, or as a non-interactive shell with the --login option, it first attempts to read and execute commands from /etc/profile and ~/.profile, in that order. The --noprofile option may be used to inhibit this behavior. When invoked as an interactive shell with the name sh, Bash looks for the variable ENV, expands its value if it is defined, and uses the expanded value as the name of a file to read and execute. Since a shell invoked as sh does not attempt to read and execute commands from any other startup files, the --rcfile option has no effect. A non-interactive shell invoked with the name sh does not attempt to read any other startup files.

When invoked as sh, Bash enters POSIX mode after the startup files are read.

Invoked in POSIX mode

When Bash is started in POSIX mode, as with the --posix command line option, it follows the POSIX standard for startup files. In this mode, interactive shells expand the ENV variable and commands are read and executed from the file whose name is the expanded value. No other startup files are read.

Invoked by remote shell daemon

Bash attempts to determine when it is being run with its standard input connected to a network connection, as when executed by the remote shell daemon, usually rshd, or the secure shell daemon sshd. If Bash determines it is being run in this fashion, it reads and executes commands from ~/.bashrc, if that file exists and is readable. It will not do this if invoked as sh. The --norc option may be used to inhibit this behavior, and the --rcfile option may be used to force another file to be read, but neither rshd nor sshd generally invoke the shell with those options or allow them to be specified.

Invoked with unequal effective and real UID/GIDs

If Bash is started with the effective user (group) id not equal to the real user (group) id, and the -p option is not supplied, no startup files are read, shell functions are not inherited from the environment, the SHELLOPTS, BASHOPTS, CDPATH, and GLOBIGNORE variables, if they appear in the environment, are ignored, and the effective user id is set to the real user id. If the -p option is supplied at invocation, the startup behavior is the same, but the effective user id is not reset.


6.3 Interactive Shells


6.3.1 What is an Interactive Shell?

An interactive shell is one started without non-option arguments, unless -s is specified, without specifying the -c option, and whose input and error output are both connected to terminals (as determined by isatty(3)), or one started with the -i option.

An interactive shell generally reads from and writes to a user’s terminal.

The -s invocation option may be used to set the positional parameters when an interactive shell is started.


6.3.2 Is this Shell Interactive?

To determine within a startup script whether or not Bash is running interactively, test the value of the ‘-’ special parameter. It contains i when the shell is interactive. For example:

case "$-" in
*i*)	echo This shell is interactive ;;
*)	echo This shell is not interactive ;;
esac

Alternatively, startup scripts may examine the variable PS1; it is unset in non-interactive shells, and set in interactive shells. Thus:

if [ -z "$PS1" ]; then
        echo This shell is not interactive
else
        echo This shell is interactive
fi

6.3.3 Interactive Shell Behavior

When the shell is running interactively, it changes its behavior in several ways.

  1. Startup files are read and executed as described in Bash Startup Files.
  2. Job Control (see Job Control) is enabled by default. When job control is in effect, Bash ignores the keyboard-generated job control signals SIGTTIN, SIGTTOU, and SIGTSTP.
  3. Bash expands and displays PS1 before reading the first line of a command, and expands and displays PS2 before reading the second and subsequent lines of a multi-line command. Bash displays PS0 after it reads a command but before executing it.
  4. Bash executes the value of the PROMPT_COMMAND variable as a command before printing the primary prompt, $PS1 (see Bash Variables).
  5. Readline (see Command Line Editing) is used to read commands from the user’s terminal.
  6. Bash inspects the value of the ignoreeof option to set -o instead of exiting immediately when it receives an EOF on its standard input when reading a command (see The Set Builtin).
  7. Command history (see Bash History Facilities) and history expansion (see History Interaction) are enabled by default. Bash will save the command history to the file named by $HISTFILE when a shell with history enabled exits.
  8. Alias expansion (see Aliases) is performed by default.
  9. In the absence of any traps, Bash ignores SIGTERM (see Signals).
  10. In the absence of any traps, SIGINT is caught and handled ((see Signals). SIGINT will interrupt some shell builtins.
  11. An interactive login shell sends a SIGHUP to all jobs on exit if the huponexit shell option has been enabled (see Signals).
  12. The -n invocation option is ignored, and ‘set -n’ has no effect (see The Set Builtin).
  13. Bash will check for mail periodically, depending on the values of the MAIL, MAILPATH, and MAILCHECK shell variables (see Bash Variables).
  14. Expansion errors due to references to unbound shell variables after ‘set -u’ has been enabled will not cause the shell to exit (see The Set Builtin).
  15. The shell will not exit on expansion errors caused by var being unset or null in ${var:?word} expansions (see Shell Parameter Expansion).
  16. Redirection errors encountered by shell builtins will not cause the shell to exit.
  17. When running in POSIX mode, a special builtin returning an error status will not cause the shell to exit (see Bash POSIX Mode).
  18. A failed exec will not cause the shell to exit (see Bourne Shell Builtins).
  19. Parser syntax errors will not cause the shell to exit.
  20. Simple spelling correction for directory arguments to the cd builtin is enabled by default (see the description of the cdspell option to the shopt builtin in The Shopt Builtin).
  21. The shell will check the value of the TMOUT variable and exit if a command is not read within the specified number of seconds after printing $PS1 (see Bash Variables).

6.4 Bash Conditional Expressions

Conditional expressions are used by the [[ compound command and the test and [ builtin commands.

Expressions may be unary or binary. Unary expressions are often used to examine the status of a file. There are string operators and numeric comparison operators as well. Bash handles several filenames specially when they are used in expressions. If the operating system on which Bash is running provides these special files, Bash will use them; otherwise it will emulate them internally with this behavior: If the file argument to one of the primaries is of the form /dev/fd/N, then file descriptor N is checked. If the file argument to one of the primaries is one of /dev/stdin, /dev/stdout, or /dev/stderr, file descriptor 0, 1, or 2, respectively, is checked.

When used with [[, the ‘<’ and ‘>’ operators sort lexicographically using the current locale. The test command uses ASCII ordering.

Unless otherwise specified, primaries that operate on files follow symbolic links and operate on the target of the link, rather than the link itself.

-a file

True if file exists.

-b file

True if file exists and is a block special file.

-c file

True if file exists and is a character special file.

-d file

True if file exists and is a directory.

-e file

True if file exists.

-f file

True if file exists and is a regular file.

-g file

True if file exists and its set-group-id bit is set.

-h file

True if file exists and is a symbolic link.

-k file

True if file exists and its "sticky" bit is set.

-p file

True if file exists and is a named pipe (FIFO).

-r file

True if file exists and is readable.

-s file

True if file exists and has a size greater than zero.

-t fd

True if file descriptor fd is open and refers to a terminal.

-u file

True if file exists and its set-user-id bit is set.

-w file

True if file exists and is writable.

-x file

True if file exists and is executable.

-G file

True if file exists and is owned by the effective group id.

-L file

True if file exists and is a symbolic link.

-N file

True if file exists and has been modified since it was last read.

-O file

True if file exists and is owned by the effective user id.

-S file

True if file exists and is a socket.

file1 -ef file2

True if file1 and file2 refer to the same device and inode numbers.

file1 -nt file2

True if file1 is newer (according to modification date) than file2, or if file1 exists and file2 does not.

file1 -ot file2

True if file1 is older than file2, or if file2 exists and file1 does not.

-o optname

True if the shell option optname is enabled. The list of options appears in the description of the -o option to the set builtin (see The Set Builtin).

-v varname

True if the shell variable varname is set (has been assigned a value).

-R varname

True if the shell variable varname is set and is a name reference.

-z string

True if the length of string is zero.

-n string
string

True if the length of string is non-zero.

string1 == string2
string1 = string2

True if the strings are equal. When used with the [[ command, this performs pattern matching as described above (see Conditional Constructs).

=’ should be used with the test command for POSIX conformance.

string1 != string2

True if the strings are not equal.

string1 < string2

True if string1 sorts before string2 lexicographically.

string1 > string2

True if string1 sorts after string2 lexicographically.

arg1 OP arg2

OP is one of ‘-eq’, ‘-ne’, ‘-lt’, ‘-le’, ‘-gt’, or ‘-ge’. These arithmetic binary operators return true if arg1 is equal to, not equal to, less than, less than or equal to, greater than, or greater than or equal to arg2, respectively. Arg1 and arg2 may be positive or negative integers.


6.5 Shell Arithmetic

The shell allows arithmetic expressions to be evaluated, as one of the shell expansions or by using the (( compound command, the let builtin, or the -i option to the declare builtin.

Evaluation is done in fixed-width integers with no check for overflow, though division by 0 is trapped and flagged as an error. The operators and their precedence, associativity, and values are the same as in the C language. The following list of operators is grouped into levels of equal-precedence operators. The levels are listed in order of decreasing precedence.

id++ id--

variable post-increment and post-decrement

++id --id

variable pre-increment and pre-decrement

- +

unary minus and plus

! ~

logical and bitwise negation

**

exponentiation

* / %

multiplication, division, remainder

+ -

addition, subtraction

<< >>

left and right bitwise shifts

<= >= < >

comparison

== !=

equality and inequality

&

bitwise AND

^

bitwise exclusive OR

|

bitwise OR

&&

logical AND

||

logical OR

expr ? expr : expr

conditional operator

= *= /= %= += -= <<= >>= &= ^= |=

assignment

expr1 , expr2

comma

Shell variables are allowed as operands; parameter expansion is performed before the expression is evaluated. Within an expression, shell variables may also be referenced by name without using the parameter expansion syntax. A shell variable that is null or unset evaluates to 0 when referenced by name without using the parameter expansion syntax. The value of a variable is evaluated as an arithmetic expression when it is referenced, or when a variable which has been given the integer attribute using ‘declare -i’ is assigned a value. A null value evaluates to 0. A shell variable need not have its integer attribute turned on to be used in an expression.

Constants with a leading 0 are interpreted as octal numbers. A leading ‘0x’ or ‘0X’ denotes hexadecimal. Otherwise, numbers take the form [base#]n, where the optional base is a decimal number between 2 and 64 representing the arithmetic base, and n is a number in that base. If base# is omitted, then base 10 is used. When specifying n, the digits greater than 9 are represented by the lowercase letters, the uppercase letters, ‘@’, and ‘_’, in that order. If base is less than or equal to 36, lowercase and uppercase letters may be used interchangeably to represent numbers between 10 and 35.

Operators are evaluated in order of precedence. Sub-expressions in parentheses are evaluated first and may override the precedence rules above.


Next: , Previous: , Up: Bash Features   [Contents][Index]

6.6 Aliases

Aliases allow a string to be substituted for a word when it is used as the first word of a simple command. The shell maintains a list of aliases that may be set and unset with the alias and unalias builtin commands.

The first word of each simple command, if unquoted, is checked to see if it has an alias. If so, that word is replaced by the text of the alias. The characters ‘/’, ‘$’, ‘`’, ‘=’ and any of the shell metacharacters or quoting characters listed above may not appear in an alias name. The replacement text may contain any valid shell input, including shell metacharacters. The first word of the replacement text is tested for aliases, but a word that is identical to an alias being expanded is not expanded a second time. This means that one may alias ls to "ls -F", for instance, and Bash does not try to recursively expand the replacement text. If the last character of the alias value is a blank, then the next command word following the alias is also checked for alias expansion.

Aliases are created and listed with the alias command, and removed with the unalias command.

There is no mechanism for using arguments in the replacement text, as in csh. If arguments are needed, a shell function should be used (see Shell Functions).

Aliases are not expanded when the shell is not interactive, unless the expand_aliases shell option is set using shopt (see The Shopt Builtin).

The rules concerning the definition and use of aliases are somewhat confusing. Bash always reads at least one complete line of input before executing any of the commands on that line. Aliases are expanded when a command is read, not when it is executed. Therefore, an alias definition appearing on the same line as another command does not take effect until the next line of input is read. The commands following the alias definition on that line are not affected by the new alias. This behavior is also an issue when functions are executed. Aliases are expanded when a function definition is read, not when the function is executed, because a function definition is itself a command. As a consequence, aliases defined in a function are not available until after that function is executed. To be safe, always put alias definitions on a separate line, and do not use alias in compound commands.

For almost every purpose, shell functions are preferred over aliases.


6.7 Arrays

Bash provides one-dimensional indexed and associative array variables. Any variable may be used as an indexed array; the declare builtin will explicitly declare an array. There is no maximum limit on the size of an array, nor any requirement that members be indexed or assigned contiguously. Indexed arrays are referenced using integers (including arithmetic expressions (see Shell Arithmetic)) and are zero-based; associative arrays use arbitrary strings. Unless otherwise noted, indexed array indices must be non-negative integers.

An indexed array is created automatically if any variable is assigned to using the syntax

name[subscript]=value

The subscript is treated as an arithmetic expression that must evaluate to a number. To explicitly declare an array, use

declare -a name

The syntax

declare -a name[subscript]

is also accepted; the subscript is ignored.

Associative arrays are created using

declare -A name.

Attributes may be specified for an array variable using the declare and readonly builtins. Each attribute applies to all members of an array.

Arrays are assigned to using compound assignments of the form

name=(value1 value2 … )

where each value is of the form [subscript]=string. Indexed array assignments do not require anything but string. When assigning to indexed arrays, if the optional subscript is supplied, that index is assigned to; otherwise the index of the element assigned is the last index assigned to by the statement plus one. Indexing starts at zero.

When assigning to an associative array, the subscript is required.

This syntax is also accepted by the declare builtin. Individual array elements may be assigned to using the name[subscript]=value syntax introduced above.

When assigning to an indexed array, if name is subscripted by a negative number, that number is interpreted as relative to one greater than the maximum index of name, so negative indices count back from the end of the array, and an index of -1 references the last element.

Any element of an array may be referenced using ${name[subscript]}. The braces are required to avoid conflicts with the shell’s filename expansion operators. If the subscript is ‘@’ or ‘*’, the word expands to all members of the array name. These subscripts differ only when the word appears within double quotes. If the word is double-quoted, ${name[*]} expands to a single word with the value of each array member separated by the first character of the IFS variable, and ${name[@]} expands each element of name to a separate word. When there are no array members, ${name[@]} expands to nothing. If the double-quoted expansion occurs within a word, the expansion of the first parameter is joined with the beginning part of the original word, and the expansion of the last parameter is joined with the last part of the original word. This is analogous to the expansion of the special parameters ‘@’ and ‘*’. ${#name[subscript]} expands to the length of ${name[subscript]}. If subscript is ‘@’ or ‘*’, the expansion is the number of elements in the array. If the subscript used to reference an element of an indexed array evaluates to a number less than zero, it is interpreted as relative to one greater than the maximum index of the array, so negative indices count back from the end of the array, and an index of -1 refers to the last element.

Referencing an array variable without a subscript is equivalent to referencing with a subscript of 0. Any reference to a variable using a valid subscript is legal, and bash will create an array if necessary.

An array variable is considered set if a subscript has been assigned a value. The null string is a valid value.

It is possible to obtain the keys (indices) of an array as well as the values. ${!name[@]} and ${!name[*]} expand to the indices assigned in array variable name. The treatment when in double quotes is similar to the expansion of the special parameters ‘@’ and ‘*’ within double quotes.

The unset builtin is used to destroy arrays. unset name[subscript] destroys the array element at index subscript. Negative subscripts to indexed arrays are interpreted as described above. Care must be taken to avoid unwanted side effects caused by filename expansion. unset name, where name is an array, removes the entire array. A subscript of ‘*’ or ‘@’ also removes the entire array.

The declare, local, and readonly builtins each accept a -a option to specify an indexed array and a -A option to specify an associative array. If both options are supplied, -A takes precedence. The read builtin accepts a -a option to assign a list of words read from the standard input to an array, and can read values from the standard input into individual array elements. The set and declare builtins display array values in a way that allows them to be reused as input.


6.8 The Directory Stack

The directory stack is a list of recently-visited directories. The pushd builtin adds directories to the stack as it changes the current directory, and the popd builtin removes specified directories from the stack and changes the current directory to the directory removed. The dirs builtin displays the contents of the directory stack. The current directory is always the "top" of the directory stack.

The contents of the directory stack are also visible as the value of the DIRSTACK shell variable.


6.8.1 Directory Stack Builtins

dirs
dirs [-clpv] [+N | -N]

Display the list of currently remembered directories. Directories are added to the list with the pushd command; the popd command removes directories from the list. The current directory is always the first directory in the stack.

-c

Clears the directory stack by deleting all of the elements.

-l

Produces a listing using full pathnames; the default listing format uses a tilde to denote the home directory.

-p

Causes dirs to print the directory stack with one entry per line.

-v

Causes dirs to print the directory stack with one entry per line, prefixing each entry with its index in the stack.

+N

Displays the Nth directory (counting from the left of the list printed by dirs when invoked without options), starting with zero.

-N

Displays the Nth directory (counting from the right of the list printed by dirs when invoked without options), starting with zero.

popd
popd [-n] [+N | -N]

When no arguments are given, popd removes the top directory from the stack and performs a cd to the new top directory. The elements are numbered from 0 starting at the first directory listed with dirs; that is, popd is equivalent to popd +0.

-n

Suppresses the normal change of directory when removing directories from the stack, so that only the stack is manipulated.

+N

Removes the Nth directory (counting from the left of the list printed by dirs), starting with zero.

-N

Removes the Nth directory (counting from the right of the list printed by dirs), starting with zero.

pushd
pushd [-n] [+N | -N | dir]

Save the current directory on the top of the directory stack and then cd to dir. With no arguments, pushd exchanges the top two directories and makes the new top the current directory.

-n

Suppresses the normal change of directory when rotating or adding directories to the stack, so that only the stack is manipulated.

+N

Brings the Nth directory (counting from the left of the list printed by dirs, starting with zero) to the top of the list by rotating the stack.

-N

Brings the Nth directory (counting from the right of the list printed by dirs, starting with zero) to the top of the list by rotating the stack.

dir

Makes dir be the top of the stack, making it the new current directory as if it had been supplied as an argument to the cd builtin.


6.9 Controlling the Prompt

The value of the variable PROMPT_COMMAND is examined just before Bash prints each primary prompt. If PROMPT_COMMAND is set and has a non-null value, then the value is executed just as if it had been typed on the command line.

In addition, the following table describes the special characters which can appear in the prompt variables PS1 to PS4:

\a

A bell character.

\d

The date, in "Weekday Month Date" format (e.g., "Tue May 26").

\D{format}

The format is passed to strftime(3) and the result is inserted into the prompt string; an empty format results in a locale-specific time representation. The braces are required.

\e

An escape character.

\h

The hostname, up to the first ‘.’.

\H

The hostname.

\j

The number of jobs currently managed by the shell.

\l

The basename of the shell’s terminal device name.

\n

A newline.

\r

A carriage return.

\s

The name of the shell, the basename of $0 (the portion following the final slash).

\t

The time, in 24-hour HH:MM:SS format.

\T

The time, in 12-hour HH:MM:SS format.

\@

The time, in 12-hour am/pm format.

\A

The time, in 24-hour HH:MM format.

\u

The username of the current user.

\v

The version of Bash (e.g., 2.00)

\V

The release of Bash, version + patchlevel (e.g., 2.00.0)

\w

The current working directory, with $HOME abbreviated with a tilde (uses the $PROMPT_DIRTRIM variable).

\W

The basename of $PWD, with $HOME abbreviated with a tilde.

\!

The history number of this command.

\#

The command number of this command.

\$

If the effective uid is 0, #, otherwise $.

\nnn

The character whose ASCII code is the octal value nnn.

\\

A backslash.

\[

Begin a sequence of non-printing characters. This could be used to embed a terminal control sequence into the prompt.

\]

End a sequence of non-printing characters.

The command number and the history number are usually different: the history number of a command is its position in the history list, which may include commands restored from the history file (see Bash History Facilities), while the command number is the position in the sequence of commands executed during the current shell session.

After the string is decoded, it is expanded via parameter expansion, command substitution, arithmetic expansion, and quote removal, subject to the value of the promptvars shell option (see Bash Builtins).


6.10 The Restricted Shell

If Bash is started with the name rbash, or the --restricted or -r option is supplied at invocation, the shell becomes restricted. A restricted shell is used to set up an environment more controlled than the standard shell. A restricted shell behaves identically to bash with the exception that the following are disallowed or not performed:

  • Changing directories with the cd builtin.
  • Setting or unsetting the values of the SHELL, PATH, ENV, or BASH_ENV variables.
  • Specifying command names containing slashes.
  • Specifying a filename containing a slash as an argument to the . builtin command.
  • Specifying a filename containing a slash as an argument to the -p option to the hash builtin command.
  • Importing function definitions from the shell environment at startup.
  • Parsing the value of SHELLOPTS from the shell environment at startup.
  • Redirecting output using the ‘>’, ‘>|’, ‘<>’, ‘>&’, ‘&>’, and ‘>>’ redirection operators.
  • Using the exec builtin to replace the shell with another command.
  • Adding or deleting builtin commands with the -f and -d options to the enable builtin.
  • Using the enable builtin command to enable disabled shell builtins.
  • Specifying the -p option to the command builtin.
  • Turning off restricted mode with ‘set +r’ or ‘set +o restricted’.

These restrictions are enforced after any startup files are read.

When a command that is found to be a shell script is executed (see Shell Scripts), rbash turns off any restrictions in the shell spawned to execute the script.


6.11 Bash POSIX Mode

Starting Bash with the --posix command-line option or executing ‘set -o posix’ while Bash is running will cause Bash to conform more closely to the POSIX standard by changing the behavior to match that specified by POSIX in areas where the Bash default differs.

When invoked as sh, Bash enters POSIX mode after reading the startup files.

The following list is what’s changed when ‘POSIX mode’ is in effect:

  1. When a command in the hash table no longer exists, Bash will re-search $PATH to find the new location. This is also available with ‘shopt -s checkhash’.
  2. The message printed by the job control code and builtins when a job exits with a non-zero status is ‘Done(status)’.
  3. The message printed by the job control code and builtins when a job is stopped is ‘Stopped(signame)’, where signame is, for example, SIGTSTP.
  4. Alias expansion is always enabled, even in non-interactive shells.
  5. Reserved words appearing in a context where reserved words are recognized do not undergo alias expansion.
  6. The POSIX PS1 and PS2 expansions of ‘!’ to the history number and ‘!!’ to ‘!’ are enabled, and parameter expansion is performed on the values of PS1 and PS2 regardless of the setting of the promptvars option.
  7. The POSIX startup files are executed ($ENV) rather than the normal Bash files.
  8. Tilde expansion is only performed on assignments preceding a command name, rather than on all assignment statements on the line.
  9. The default history file is ~/.sh_history (this is the default value of $HISTFILE).
  10. Redirection operators do not perform filename expansion on the word in the redirection unless the shell is interactive.
  11. Redirection operators do not perform word splitting on the word in the redirection.
  12. Function names must be valid shell names. That is, they may not contain characters other than letters, digits, and underscores, and may not start with a digit. Declaring a function with an invalid name causes a fatal syntax error in non-interactive shells.
  13. Function names may not be the same as one of the POSIX special builtins.
  14. POSIX special builtins are found before shell functions during command lookup.
  15. When printing shell function definitions (e.g., by type), Bash does not print the function keyword.
  16. Literal tildes that appear as the first character in elements of the PATH variable are not expanded as described above under Tilde Expansion.
  17. The time reserved word may be used by itself as a command. When used in this way, it displays timing statistics for the shell and its completed children. The TIMEFORMAT variable controls the format of the timing information.
  18. When parsing and expanding a ${…} expansion that appears within double quotes, single quotes are no longer special and cannot be used to quote a closing brace or other special character, unless the operator is one of those defined to perform pattern removal. In this case, they do not have to appear as matched pairs.
  19. The parser does not recognize time as a reserved word if the next token begins with a ‘-’.
  20. The ‘!’ character does not introduce history expansion within a double-quoted string, even if the histexpand option is enabled.
  21. If a POSIX special builtin returns an error status, a non-interactive shell exits. The fatal errors are those listed in the POSIX standard, and include things like passing incorrect options, redirection errors, variable assignment errors for assignments preceding the command name, and so on.
  22. A non-interactive shell exits with an error status if a variable assignment error occurs when no command name follows the assignment statements. A variable assignment error occurs, for example, when trying to assign a value to a readonly variable.
  23. A non-interactive shell exits with an error status if a variable assignment error occurs in an assignment statement preceding a special builtin, but not with any other simple command.
  24. A non-interactive shell exits with an error status if the iteration variable in a for statement or the selection variable in a select statement is a readonly variable.
  25. Non-interactive shells exit if filename in . filename is not found.
  26. Non-interactive shells exit if a syntax error in an arithmetic expansion results in an invalid expression.
  27. Non-interactive shells exit if a parameter expansion error occurs.
  28. Non-interactive shells exit if there is a syntax error in a script read with the . or source builtins, or in a string processed by the eval builtin.
  29. Process substitution is not available.
  30. While variable indirection is available, it may not be applied to the ‘#’ and ‘?’ special parameters.
  31. When expanding the ‘*’ special parameter in a pattern context where the expansion is double-quoted does not treat the $* as if it were double-quoted.
  32. Assignment statements preceding POSIX special builtins persist in the shell environment after the builtin completes.
  33. Assignment statements preceding shell function calls persist in the shell environment after the function returns, as if a POSIX special builtin command had been executed.
  34. The command builtin does not prevent builtins that take assignment statements as arguments from expanding them as assignment statements; when not in POSIX mode, assignment builtins lose their assignment statement expansion properties when preceded by command.
  35. The bg builtin uses the required format to describe each job placed in the background, which does not include an indication of whether the job is the current or previous job.
  36. The output of ‘kill -l’ prints all the signal names on a single line, separated by spaces, without the ‘SIG’ prefix.
  37. The kill builtin does not accept signal names with a ‘SIG’ prefix.
  38. The export and readonly builtin commands display their output in the format required by POSIX.
  39. The trap builtin displays signal names without the leading SIG.
  40. The trap builtin doesn’t check the first argument for a possible signal specification and revert the signal handling to the original disposition if it is, unless that argument consists solely of digits and is a valid signal number. If users want to reset the handler for a given signal to the original disposition, they should use ‘-’ as the first argument.
  41. The . and source builtins do not search the current directory for the filename argument if it is not found by searching PATH.
  42. Enabling POSIX mode has the effect of setting the inherit_errexit option, so subshells spawned to execute command substitutions inherit the value of the -e option from the parent shell. When the inherit_errexit option is not enabled, Bash clears the -e option in such subshells.
  43. When the alias builtin displays alias definitions, it does not display them with a leading ‘alias ’ unless the -p option is supplied.
  44. When the set builtin is invoked without options, it does not display shell function names and definitions.
  45. When the set builtin is invoked without options, it displays variable values without quotes, unless they contain shell metacharacters, even if the result contains nonprinting characters.
  46. When the cd builtin is invoked in logical mode, and the pathname constructed from $PWD and the directory name supplied as an argument does not refer to an existing directory, cd will fail instead of falling back to physical mode.
  47. The pwd builtin verifies that the value it prints is the same as the current directory, even if it is not asked to check the file system with the -P option.
  48. When listing the history, the fc builtin does not include an indication of whether or not a history entry has been modified.
  49. The default editor used by fc is ed.
  50. The type and command builtins will not report a non-executable file as having been found, though the shell will attempt to execute such a file if it is the only so-named file found in $PATH.
  51. The vi editing mode will invoke the vi editor directly when the ‘v’ command is run, instead of checking $VISUAL and $EDITOR.
  52. When the xpg_echo option is enabled, Bash does not attempt to interpret any arguments to echo as options. Each argument is displayed, after escape characters are converted.
  53. The ulimit builtin uses a block size of 512 bytes for the -c and -f options.
  54. The arrival of SIGCHLD when a trap is set on SIGCHLD does not interrupt the wait builtin and cause it to return immediately. The trap command is run once for each child that exits.
  55. The read builtin may be interrupted by a signal for which a trap has been set. If Bash receives a trapped signal while executing read, the trap handler executes and read returns an exit status greater than 128.
  56. Bash removes an exited background process’s status from the list of such statuses after the wait builtin is used to obtain it.

There is other POSIX behavior that Bash does not implement by default even when in POSIX mode. Specifically:

  1. The fc builtin checks $EDITOR as a program to edit history entries if FCEDIT is unset, rather than defaulting directly to ed. fc uses ed if EDITOR is unset.
  2. As noted above, Bash requires the xpg_echo option to be enabled for the echo builtin to be fully conformant.

Bash can be configured to be POSIX-conformant by default, by specifying the --enable-strict-posix-default to configure when building (see Optional Features).


Next: , Previous: , Up: Top   [Contents][Index]

7 Job Control

This chapter discusses what job control is, how it works, and how Bash allows you to access its facilities.


7.1 Job Control Basics

Job control refers to the ability to selectively stop (suspend) the execution of processes and continue (resume) their execution at a later point. A user typically employs this facility via an interactive interface supplied jointly by the operating system kernel’s terminal driver and Bash.

The shell associates a job with each pipeline. It keeps a table of currently executing jobs, which may be listed with the jobs command. When Bash starts a job asynchronously, it prints a line that looks like:

[1] 25647

indicating that this job is job number 1 and that the process ID of the last process in the pipeline associated with this job is 25647. All of the processes in a single pipeline are members of the same job. Bash uses the job abstraction as the basis for job control.

To facilitate the implementation of the user interface to job control, the operating system maintains the notion of a current terminal process group ID. Members of this process group (processes whose process group ID is equal to the current terminal process group ID) receive keyboard-generated signals such as SIGINT. These processes are said to be in the foreground. Background processes are those whose process group ID differs from the terminal’s; such processes are immune to keyboard-generated signals. Only foreground processes are allowed to read from or, if the user so specifies with stty tostop, write to the terminal. Background processes which attempt to read from (write to when stty tostop is in effect) the terminal are sent a SIGTTIN (SIGTTOU) signal by the kernel’s terminal driver, which, unless caught, suspends the process.

If the operating system on which Bash is running supports job control, Bash contains facilities to use it. Typing the suspend character (typically ‘^Z’, Control-Z) while a process is running causes that process to be stopped and returns control to Bash. Typing the delayed suspend character (typically ‘^Y’, Control-Y) causes the process to be stopped when it attempts to read input from the terminal, and control to be returned to Bash. The user then manipulates the state of this job, using the bg command to continue it in the background, the fg command to continue it in the foreground, or the kill command to kill it. A ‘^Z’ takes effect immediately, and has the additional side effect of causing pending output and typeahead to be discarded.

There are a number of ways to refer to a job in the shell. The character ‘%’ introduces a job specification (jobspec).

Job number n may be referred to as ‘%n’. The symbols ‘%%’ and ‘%+’ refer to the shell’s notion of the current job, which is the last job stopped while it was in the foreground or started in the background. A single ‘%’ (with no accompanying job specification) also refers to the current job. The previous job may be referenced using ‘%-’. If there is only a single job, ‘%+’ and ‘%-’ can both be used to refer to that job. In output pertaining to jobs (e.g., the output of the jobs command), the current job is always flagged with a ‘+’, and the previous job with a ‘-’.

A job may also be referred to using a prefix of the name used to start it, or using a substring that appears in its command line. For example, ‘%ce’ refers to a stopped ce job. Using ‘%?ce’, on the other hand, refers to any job containing the string ‘ce’ in its command line. If the prefix or substring matches more than one job, Bash reports an error.

Simply naming a job can be used to bring it into the foreground: ‘%1’ is a synonym for ‘fg %1’, bringing job 1 from the background into the foreground. Similarly, ‘%1 &’ resumes job 1 in the background, equivalent to ‘bg %1

The shell learns immediately whenever a job changes state. Normally, Bash waits until it is about to print a prompt before reporting changes in a job’s status so as to not interrupt any other output. If the -b option to the set builtin is enabled, Bash reports such changes immediately (see The Set Builtin). Any trap on SIGCHLD is executed for each child process that exits.

If an attempt to exit Bash is made while jobs are stopped, (or running, if the checkjobs option is enabled – see The Shopt Builtin), the shell prints a warning message, and if the checkjobs option is enabled, lists the jobs and their statuses. The jobs command may then be used to inspect their status. If a second attempt to exit is made without an intervening command, Bash does not print another warning, and any stopped jobs are terminated.


7.2 Job Control Builtins

bg
bg [jobspec …]

Resume each suspended job jobspec in the background, as if it had been started with ‘&’. If jobspec is not supplied, the current job is used. The return status is zero unless it is run when job control is not enabled, or, when run with job control enabled, any jobspec was not found or specifies a job that was started without job control.

fg
fg [jobspec]

Resume the job jobspec in the foreground and make it the current job. If jobspec is not supplied, the current job is used. The return status is that of the command placed into the foreground, or non-zero if run when job control is disabled or, when run with job control enabled, jobspec does not specify a valid job or jobspec specifies a job that was started without job control.

jobs
jobs [-lnprs] [jobspec]
jobs -x command [arguments]

The first form lists the active jobs. The options have the following meanings:

-l

List process IDs in addition to the normal information.

-n

Display information only about jobs that have changed status since the user was last notified of their status.

-p

List only the process ID of the job’s process group leader.

-r

Display only running jobs.

-s

Display only stopped jobs.

If jobspec is given, output is restricted to information about that job. If jobspec is not supplied, the status of all jobs is listed.

If the -x option is supplied, jobs replaces any jobspec found in command or arguments with the corresponding process group ID, and executes command, passing it arguments, returning its exit status.

kill
kill [-s sigspec] [-n signum] [-sigspec] jobspec or pid
kill -l|-L [exit_status]

Send a signal specified by sigspec or signum to the process named by job specification jobspec or process ID pid. sigspec is either a case-insensitive signal name such as SIGINT (with or without the SIG prefix) or a signal number; signum is a signal number. If sigspec and signum are not present, SIGTERM is used. The -l option lists the signal names. If any arguments are supplied when -l is given, the names of the signals corresponding to the arguments are listed, and the return status is zero. exit_status is a number specifying a signal number or the exit status of a process terminated by a signal. The -L option is equivalent to -l. The return status is zero if at least one signal was successfully sent, or non-zero if an error occurs or an invalid option is encountered.

wait
wait [-n] [jobspec or pid …]

Wait until the child process specified by each process ID pid or job specification jobspec exits and return the exit status of the last command waited for. If a job spec is given, all processes in the job are waited for. If no arguments are given, all currently active child processes are waited for, and the return status is zero. If the -n option is supplied, wait waits for any job to terminate and returns its exit status. If neither jobspec nor pid specifies an active child process of the shell, the return status is 127.

disown
disown [-ar] [-h] [jobspec … | pid … ]

Without options, remove each jobspec from the table of active jobs. If the -h option is given, the job is not removed from the table, but is marked so that SIGHUP is not sent to the job if the shell receives a SIGHUP. If jobspec is not present, and neither the -a nor the -r option is supplied, the current job is used. If no jobspec is supplied, the -a option means to remove or mark all jobs; the -r option without a jobspec argument restricts operation to running jobs.

suspend
suspend [-f]

Suspend the execution of this shell until it receives a SIGCONT signal. A login shell cannot be suspended; the -f option can be used to override this and force the suspension.

When job control is not active, the kill and wait builtins do not accept jobspec arguments. They must be supplied process IDs.


7.3 Job Control Variables

auto_resume

This variable controls how the shell interacts with the user and job control. If this variable exists then single word simple commands without redirections are treated as candidates for resumption of an existing job. There is no ambiguity allowed; if there is more than one job beginning with the string typed, then the most recently accessed job will be selected. The name of a stopped job, in this context, is the command line used to start it. If this variable is set to the value ‘exact’, the string supplied must match the name of a stopped job exactly; if set to ‘substring’, the string supplied needs to match a substring of the name of a stopped job. The ‘substring’ value provides functionality analogous to the ‘%?’ job ID (see Job Control Basics). If set to any other value, the supplied string must be a prefix of a stopped job’s name; this provides functionality analogous to the ‘%’ job ID.


8 Command Line Editing

This chapter describes the basic features of the GNU command line editing interface. Command line editing is provided by the Readline library, which is used by several different programs, including Bash. Command line editing is enabled by default when using an interactive shell, unless the --noediting option is supplied at shell invocation. Line editing is also used when using the -e option to the read builtin command (see Bash Builtins). By default, the line editing commands are similar to those of Emacs. A vi-style line editing interface is also available. Line editing can be enabled at any time using the -o emacs or -o vi options to the set builtin command (see The Set Builtin), or disabled using the +o emacs or +o vi options to set.


8.1 Introduction to Line Editing

The following paragraphs describe the notation used to represent keystrokes.

The text C-k is read as ‘Control-K’ and describes the character produced when the k key is pressed while the Control key is depressed.

The text M-k is read as ‘Meta-K’ and describes the character produced when the Meta key (if you have one) is depressed, and the k key is pressed. The Meta key is labeled ALT on many keyboards. On keyboards with two keys labeled ALT (usually to either side of the space bar), the ALT on the left side is generally set to work as a Meta key. The ALT key on the right may also be configured to work as a Meta key or may be configured as some other modifier, such as a Compose key for typing accented characters.

If you do not have a Meta or ALT key, or another key working as a Meta key, the identical keystroke can be generated by typing ESC first, and then typing k. Either process is known as metafying the k key.

The text M-C-k is read as ‘Meta-Control-k’ and describes the character produced by metafying C-k.

In addition, several keys have their own names. Specifically, DEL, ESC, LFD, SPC, RET, and TAB all stand for themselves when seen in this text, or in an init file (see Readline Init File). If your keyboard lacks a LFD key, typing C-j will produce the desired character. The RET key may be labeled Return or Enter on some keyboards.


8.2 Readline Interaction

Often during an interactive session you type in a long line of text, only to notice that the first word on the line is misspelled. The Readline library gives you a set of commands for manipulating the text as you type it in, allowing you to just fix your typo, and not forcing you to retype the majority of the line. Using these editing commands, you move the cursor to the place that needs correction, and delete or insert the text of the corrections. Then, when you are satisfied with the line, you simply press RET. You do not have to be at the end of the line to press RET; the entire line is accepted regardless of the location of the cursor within the line.


8.2.1 Readline Bare Essentials

In order to enter characters into the line, simply type them. The typed character appears where the cursor was, and then the cursor moves one space to the right. If you mistype a character, you can use your erase character to back up and delete the mistyped character.

Sometimes you may mistype a character, and not notice the error until you have typed several other characters. In that case, you can type C-b to move the cursor to the left, and then correct your mistake. Afterwards, you can move the cursor to the right with C-f.

When you add text in the middle of a line, you will notice that characters to the right of the cursor are ‘pushed over’ to make room for the text that you have inserted. Likewise, when you delete text behind the cursor, characters to the right of the cursor are ‘pulled back’ to fill in the blank space created by the removal of the text. A list of the bare essentials for editing the text of an input line follows.

C-b

Move back one character.

C-f

Move forward one character.

DEL or Backspace

Delete the character to the left of the cursor.

C-d

Delete the character underneath the cursor.

Printing characters

Insert the character into the line at the cursor.

C-_ or C-x C-u

Undo the last editing command. You can undo all the way back to an empty line.

(Depending on your configuration, the Backspace key be set to delete the character to the left of the cursor and the DEL key set to delete the character underneath the cursor, like C-d, rather than the character to the left of the cursor.)


8.2.2 Readline Movement Commands

The above table describes the most basic keystrokes that you need in order to do editing of the input line. For your convenience, many other commands have been added in addition to C-b, C-f, C-d, and DEL. Here are some commands for moving more rapidly about the line.

C-a

Move to the start of the line.

C-e

Move to the end of the line.

M-f

Move forward a word, where a word is composed of letters and digits.

M-b

Move backward a word.

C-l

Clear the screen, reprinting the current line at the top.

Notice how C-f moves forward a character, while M-f moves forward a word. It is a loose convention that control keystrokes operate on characters while meta keystrokes operate on words.


8.2.3 Readline Killing Commands

Killing text means to delete the text from the line, but to save it away for later use, usually by yanking (re-inserting) it back into the line. (‘Cut’ and ‘paste’ are more recent jargon for ‘kill’ and ‘yank’.)

If the description for a command says that it ‘kills’ text, then you can be sure that you can get the text back in a different (or the same) place later.

When you use a kill command, the text is saved in a kill-ring. Any number of consecutive kills save all of the killed text together, so that when you yank it back, you get it all. The kill ring is not line specific; the text that you killed on a previously typed line is available to be yanked back later, when you are typing another line.

Here is the list of commands for killing text.

C-k

Kill the text from the current cursor position to the end of the line.

M-d

Kill from the cursor to the end of the current word, or, if between words, to the end of the next word. Word boundaries are the same as those used by M-f.

M-DEL

Kill from the cursor the start of the current word, or, if between words, to the start of the previous word. Word boundaries are the same as those used by M-b.

C-w

Kill from the cursor to the previous whitespace. This is different than M-DEL because the word boundaries differ.

Here is how to yank the text back into the line. Yanking means to copy the most-recently-killed text from the kill buffer.

C-y

Yank the most recently killed text back into the buffer at the cursor.

M-y

Rotate the kill-ring, and yank the new top. You can only do this if the prior command is C-y or M-y.


8.2.4 Readline Arguments

You can pass numeric arguments to Readline commands. Sometimes the argument acts as a repeat count, other times it is the sign of the argument that is significant. If you pass a negative argument to a command which normally acts in a forward direction, that command will act in a backward direction. For example, to kill text back to the start of the line, you might type ‘M-- C-k’.

The general way to pass numeric arguments to a command is to type meta digits before the command. If the first ‘digit’ typed is a minus sign (‘-’), then the sign of the argument will be negative. Once you have typed one meta digit to get the argument started, you can type the remainder of the digits, and then the command. For example, to give the C-d command an argument of 10, you could type ‘M-1 0 C-d’, which will delete the next ten characters on the input line.


8.2.5 Searching for Commands in the History

Readline provides commands for searching through the command history (see Bash History Facilities) for lines containing a specified string. There are two search modes: incremental and non-incremental.

Incremental searches begin before the user has finished typing the search string. As each character of the search string is typed, Readline displays the next entry from the history matching the string typed so far. An incremental search requires only as many characters as needed to find the desired history entry. To search backward in the history for a particular string, type C-r. Typing C-s searches forward through the history. The characters present in the value of the isearch-terminators variable are used to terminate an incremental search. If that variable has not been assigned a value, the ESC and C-J characters will terminate an incremental search. C-g will abort an incremental search and restore the original line. When the search is terminated, the history entry containing the search string becomes the current line.

To find other matching entries in the history list, type C-r or C-s as appropriate. This will search backward or forward in the history for the next entry matching the search string typed so far. Any other key sequence bound to a Readline command will terminate the search and execute that command. For instance, a RET will terminate the search and accept the line, thereby executing the command from the history list. A movement command will terminate the search, make the last line found the current line, and begin editing.

Readline remembers the last incremental search string. If two C-rs are typed without any intervening characters defining a new search string, any remembered search string is used.

Non-incremental searches read the entire search string before starting to search for matching history lines. The search string may be typed by the user or be part of the contents of the current line.


8.3 Readline Init File

Although the Readline library comes with a set of Emacs-like keybindings installed by default, it is possible to use a different set of keybindings. Any user can customize programs that use Readline by putting commands in an inputrc file, conventionally in his home directory. The name of this file is taken from the value of the shell variable INPUTRC. If that variable is unset, the default is ~/.inputrc. If that file does not exist or cannot be read, the ultimate default is /etc/inputrc.

When a program which uses the Readline library starts up, the init file is read, and the key bindings are set.

In addition, the C-x C-r command re-reads this init file, thus incorporating any changes that you might have made to it.


8.3.1 Readline Init File Syntax

There are only a few basic constructs allowed in the Readline init file. Blank lines are ignored. Lines beginning with a ‘#’ are comments. Lines beginning with a ‘$’ indicate conditional constructs (see Conditional Init Constructs). Other lines denote variable settings and key bindings.

Variable Settings

You can modify the run-time behavior of Readline by altering the values of variables in Readline using the set command within the init file. The syntax is simple:

set variable value

Here, for example, is how to change from the default Emacs-like key binding to use vi line editing commands:

set editing-mode vi

Variable names and values, where appropriate, are recognized without regard to case. Unrecognized variable names are ignored.

Boolean variables (those that can be set to on or off) are set to on if the value is null or empty, on (case-insensitive), or 1. Any other value results in the variable being set to off.

The bind -V command lists the current Readline variable names and values. See Bash Builtins.

A great deal of run-time behavior is changeable with the following variables.

bell-style

Controls what happens when Readline wants to ring the terminal bell. If set to ‘none’, Readline never rings the bell. If set to ‘visible’, Readline uses a visible bell if one is available. If set to ‘audible’ (the default), Readline attempts to ring the terminal’s bell.

bind-tty-special-chars

If set to ‘on’ (the default), Readline attempts to bind the control characters treated specially by the kernel’s terminal driver to their Readline equivalents.

blink-matching-paren

If set to ‘on’, Readline attempts to briefly move the cursor to an opening parenthesis when a closing parenthesis is inserted. The default is ‘off’.

colored-completion-prefix

If set to ‘on’, when listing completions, Readline displays the common prefix of the set of possible completions using a different color. The color definitions are taken from the value of the LS_COLORS environment variable. The default is ‘off’.

colored-stats

If set to ‘on’, Readline displays possible completions using different colors to indicate their file type. The color definitions are taken from the value of the LS_COLORS environment variable. The default is ‘off’.

comment-begin

The string to insert at the beginning of the line when the insert-comment command is executed. The default value is "#".

completion-display-width

The number of screen columns used to display possible matches when performing completion. The value is ignored if it is less than 0 or greater than the terminal screen width. A value of 0 will cause matches to be displayed one per line. The default value is -1.

completion-ignore-case

If set to ‘on’, Readline performs filename matching and completion in a case-insensitive fashion. The default value is ‘off’.

completion-map-case

If set to ‘on’, and completion-ignore-case is enabled, Readline treats hyphens (‘-’) and underscores (‘_’) as equivalent when performing case-insensitive filename matching and completion.

completion-prefix-display-length

The length in characters of the common prefix of a list of possible completions that is displayed without modification. When set to a value greater than zero, common prefixes longer than this value are replaced with an ellipsis when displaying possible completions.

completion-query-items

The number of possible completions that determines when the user is asked whether the list of possibilities should be displayed. If the number of possible completions is greater than this value, Readline will ask the user whether or not he wishes to view them; otherwise, they are simply listed. This variable must be set to an integer value greater than or equal to 0. A negative value means Readline should never ask. The default limit is 100.

convert-meta

If set to ‘on’, Readline will convert characters with the eighth bit set to an ASCII key sequence by stripping the eighth bit and prefixing an ESC character, converting them to a meta-prefixed key sequence. The default value is ‘on’, but will be set to ‘off’ if the locale is one that contains eight-bit characters.

disable-completion

If set to ‘On’, Readline will inhibit word completion. Completion characters will be inserted into the line as if they had been mapped to self-insert. The default is ‘off’.

echo-control-characters

When set to ‘on’, on operating systems that indicate they support it, readline echoes a character corresponding to a signal generated from the keyboard. The default is ‘on’.

editing-mode

The editing-mode variable controls which default set of key bindings is used. By default, Readline starts up in Emacs editing mode, where the keystrokes are most similar to Emacs. This variable can be set to either ‘emacs’ or ‘vi’.

emacs-mode-string

This string is displayed immediately before the last line of the primary prompt when emacs editing mode is active. The value is expanded like a key binding, so the standard set of meta- and control prefixes and backslash escape sequences is available. Use the ‘\1’ and ‘\2’ escapes to begin and end sequences of non-printing characters, which can be used to embed a terminal control sequence into the mode string. The default is ‘@’.

enable-bracketed-paste

When set to ‘On’, Readline will configure the terminal in a way that will enable it to insert each paste into the editing buffer as a single string of characters, instead of treating each character as if it had been read from the keyboard. This can prevent pasted characters from being interpreted as editing commands. The default is ‘off’.

enable-keypad

When set to ‘on’, Readline will try to enable the application keypad when it is called. Some systems need this to enable the arrow keys. The default is ‘off’.

enable-meta-key

When set to ‘on’, Readline will try to enable any meta modifier key the terminal claims to support when it is called. On many terminals, the meta key is used to send eight-bit characters. The default is ‘on’.

expand-tilde

If set to ‘on’, tilde expansion is performed when Readline attempts word completion. The default is ‘off’.

history-preserve-point

If set to ‘on’, the history code attempts to place the point (the current cursor position) at the same location on each history line retrieved with previous-history or next-history. The default is ‘off’.

history-size

Set the maximum number of history entries saved in the history list. If set to zero, any existing history entries are deleted and no new entries are saved. If set to a value less than zero, the number of history entries is not limited. By default, the number of history entries is not limited. If an attempt is made to set history-size to a non-numeric value, the maximum number of history entries will be set to 500.

horizontal-scroll-mode

This variable can be set to either ‘on’ or ‘off’. Setting it to ‘on’ means that the text of the lines being edited will scroll horizontally on a single screen line when they are longer than the width of the screen, instead of wrapping onto a new screen line. By default, this variable is set to ‘off’.

input-meta

If set to ‘on’, Readline will enable eight-bit input (it will not clear the eighth bit in the characters it reads), regardless of what the terminal claims it can support. The default value is ‘off’, but Readline will set it to ‘on’ if the locale contains eight-bit characters. The name meta-flag is a synonym for this variable.

isearch-terminators

The string of characters that should terminate an incremental search without subsequently executing the character as a command (see Searching). If this variable has not been given a value, the characters ESC and C-J will terminate an incremental search.

keymap

Sets Readline’s idea of the current keymap for key binding commands. Acceptable keymap names are emacs, emacs-standard, emacs-meta, emacs-ctlx, vi, vi-move, vi-command, and vi-insert. vi is equivalent to vi-command (vi-move is also a synonym); emacs is equivalent to emacs-standard. The default value is emacs. The value of the editing-mode variable also affects the default keymap.

keyseq-timeout

Specifies the duration Readline will wait for a character when reading an ambiguous key sequence (one that can form a complete key sequence using the input read so far, or can take additional input to complete a longer key sequence). If no input is received within the timeout, Readline will use the shorter but complete key sequence. Readline uses this value to determine whether or not input is available on the current input source (rl_instream by default). The value is specified in milliseconds, so a value of 1000 means that Readline will wait one second for additional input. If this variable is set to a value less than or equal to zero, or to a non-numeric value, Readline will wait until another key is pressed to decide which key sequence to complete. The default value is 500.

mark-directories

If set to ‘on’, completed directory names have a slash appended. The default is ‘on’.

mark-modified-lines

This variable, when set to ‘on’, causes Readline to display an asterisk (‘*’) at the start of history lines which have been modified. This variable is ‘off’ by default.

mark-symlinked-directories

If set to ‘on’, completed names which are symbolic links to directories have a slash appended (subject to the value of mark-directories). The default is ‘off’.

match-hidden-files

This variable, when set to ‘on’, causes Readline to match files whose names begin with a ‘.’ (hidden files) when performing filename completion. If set to ‘off’, the leading ‘.’ must be supplied by the user in the filename to be completed. This variable is ‘on’ by default.

menu-complete-display-prefix

If set to ‘on’, menu completion displays the common prefix of the list of possible completions (which may be empty) before cycling through the list. The default is ‘off’.

output-meta

If set to ‘on’, Readline will display characters with the eighth bit set directly rather than as a meta-prefixed escape sequence. The default is ‘off’, but Readline will set it to ‘on’ if the locale contains eight-bit characters.

page-completions

If set to ‘on’, Readline uses an internal more-like pager to display a screenful of possible completions at a time. This variable is ‘on’ by default.

print-completions-horizontally

If set to ‘on’, Readline will display completions with matches sorted horizontally in alphabetical order, rather than down the screen. The default is ‘off’.

revert-all-at-newline

If set to ‘on’, Readline will undo all changes to history lines before returning when accept-line is executed. By default, history lines may be modified and retain individual undo lists across calls to readline. The default is ‘off’.

show-all-if-ambiguous

This alters the default behavior of the completion functions. If set to ‘on’, words which have more than one possible completion cause the matches to be listed immediately instead of ringing the bell. The default value is ‘off’.

show-all-if-unmodified

This alters the default behavior of the completion functions in a fashion similar to show-all-if-ambiguous. If set to ‘on’, words which have more than one possible completion without any possible partial completion (the possible completions don’t share a common prefix) cause the matches to be listed immediately instead of ringing the bell. The default value is ‘off’.

show-mode-in-prompt

If set to ‘on’, add a character to the beginning of the prompt indicating the editing mode: emacs, vi command, or vi insertion. The mode strings are user-settable. The default value is ‘off’.

skip-completed-text

If set to ‘on’, this alters the default completion behavior when inserting a single match into the line. It’s only active when performing completion in the middle of a word. If enabled, readline does not insert characters from the completion that match characters after point in the word being completed, so portions of the word following the cursor are not duplicated. For instance, if this is enabled, attempting completion when the cursor is after the ‘e’ in ‘Makefile’ will result in ‘Makefile’ rather than ‘Makefilefile’, assuming there is a single possible completion. The default value is ‘off’.

vi-cmd-mode-string

This string is displayed immediately before the last line of the primary prompt when vi editing mode is active and in command mode. The value is expanded like a key binding, so the standard set of meta- and control prefixes and backslash escape sequences is available. Use the ‘\1’ and ‘\2’ escapes to begin and end sequences of non-printing characters, which can be used to embed a terminal control sequence into the mode string. The default is ‘(cmd)’.

vi-ins-mode-string

This string is displayed immediately before the last line of the primary prompt when vi editing mode is active and in insertion mode. The value is expanded like a key binding, so the standard set of meta- and control prefixes and backslash escape sequences is available. Use the ‘\1’ and ‘\2’ escapes to begin and end sequences of non-printing characters, which can be used to embed a terminal control sequence into the mode string. The default is ‘(ins)’.

visible-stats

If set to ‘on’, a character denoting a file’s type is appended to the filename when listing possible completions. The default is ‘off’.

Key Bindings

The syntax for controlling key bindings in the init file is simple. First you need to find the name of the command that you want to change. The following sections contain tables of the command name, the default keybinding, if any, and a short description of what the command does.

Once you know the name of the command, simply place on a line in the init file the name of the key you wish to bind the command to, a colon, and then the name of the command. There can be no space between the key name and the colon – that will be interpreted as part of the key name. The name of the key can be expressed in different ways, depending on what you find most comfortable.

In addition to command names, readline allows keys to be bound to a string that is inserted when the key is pressed (a macro).

The bind -p command displays Readline function names and bindings in a format that can put directly into an initialization file. See Bash Builtins.

keynamefunction-name or macro

keyname is the name of a key spelled out in English. For example:

Control-u: universal-argument
Meta-Rubout: backward-kill-word
Control-o: "> output"

In the above example, C-u is bound to the function universal-argument, M-DEL is bound to the function backward-kill-word, and C-o is bound to run the macro expressed on the right hand side (that is, to insert the text ‘> output’ into the line).

A number of symbolic character names are recognized while processing this key binding syntax: DEL, ESC, ESCAPE, LFD, NEWLINE, RET, RETURN, RUBOUT, SPACE, SPC, and TAB.

"keyseq": function-name or macro

keyseq differs from keyname above in that strings denoting an entire key sequence can be specified, by placing the key sequence in double quotes. Some GNU Emacs style key escapes can be used, as in the following example, but the special character names are not recognized.

"\C-u": universal-argument
"\C-x\C-r": re-read-init-file
"\e[11~": "Function Key 1"

In the above example, C-u is again bound to the function universal-argument (just as it was in the first example), ‘C-x C-r’ is bound to the function re-read-init-file, and ‘ESC [ 1 1 ~’ is bound to insert the text ‘Function Key 1’.

The following GNU Emacs style escape sequences are available when specifying key sequences:

\C-

control prefix

\M-

meta prefix

\e

an escape character

\\

backslash

\"

", a double quotation mark

\'

', a single quote or apostrophe

In addition to the GNU Emacs style escape sequences, a second set of backslash escapes is available:

\a

alert (bell)

\b

backspace

\d

delete

\f

form feed

\n

newline

\r

carriage return

\t

horizontal tab

\v

vertical tab

\nnn

the eight-bit character whose value is the octal value nnn (one to three digits)

\xHH

the eight-bit character whose value is the hexadecimal value HH (one or two hex digits)

When entering the text of a macro, single or double quotes must be used to indicate a macro definition. Unquoted text is assumed to be a function name. In the macro body, the backslash escapes described above are expanded. Backslash will quote any other character in the macro text, including ‘"’ and ‘'’. For example, the following binding will make ‘C-x \’ insert a single ‘\’ into the line:

"\C-x\\": "\\"

8.3.2 Conditional Init Constructs

Readline implements a facility similar in spirit to the conditional compilation features of the C preprocessor which allows key bindings and variable settings to be performed as the result of tests. There are four parser directives used.

$if

The $if construct allows bindings to be made based on the editing mode, the terminal being used, or the application using Readline. The text of the test extends to the end of the line; no characters are required to isolate it.

mode

The mode= form of the $if directive is used to test whether Readline is in emacs or vi mode. This may be used in conjunction with the ‘set keymap’ command, for instance, to set bindings in the emacs-standard and emacs-ctlx keymaps only if Readline is starting out in emacs mode.

term

The term= form may be used to include terminal-specific key bindings, perhaps to bind the key sequences output by the terminal’s function keys. The word on the right side of the ‘=’ is tested against both the full name of the terminal and the portion of the terminal name before the first ‘-’. This allows sun to match both sun and sun-cmd, for instance.

application

The application construct is used to include application-specific settings. Each program using the Readline library sets the application name, and you can test for a particular value. This could be used to bind key sequences to functions useful for a specific program. For instance, the following command adds a key sequence that quotes the current or previous word in Bash:

$if Bash
# Quote the current or previous word
"\C-xq": "\eb\"\ef\""
$endif
$endif

This command, as seen in the previous example, terminates an $if command.

$else

Commands in this branch of the $if directive are executed if the test fails.

$include

This directive takes a single filename as an argument and reads commands and bindings from that file. For example, the following directive reads from /etc/inputrc:

$include /etc/inputrc

8.3.3 Sample Init File

Here is an example of an inputrc file. This illustrates key binding, variable assignment, and conditional syntax.

# This file controls the behaviour of line input editing for
# programs that use the GNU Readline library.  Existing
# programs include FTP, Bash, and GDB.
#
# You can re-read the inputrc file with C-x C-r.
# Lines beginning with '#' are comments.
#
# First, include any system-wide bindings and variable
# assignments from /etc/Inputrc
$include /etc/Inputrc

#
# Set various bindings for emacs mode.

set editing-mode emacs 

$if mode=emacs

Meta-Control-h:	backward-kill-word	Text after the function name is ignored

#
# Arrow keys in keypad mode
#
#"\M-OD":        backward-char
#"\M-OC":        forward-char
#"\M-OA":        previous-history
#"\M-OB":        next-history
#
# Arrow keys in ANSI mode
#
"\M-[D":        backward-char
"\M-[C":        forward-char
"\M-[A":        previous-history
"\M-[B":        next-history
#
# Arrow keys in 8 bit keypad mode
#
#"\M-\C-OD":       backward-char
#"\M-\C-OC":       forward-char
#"\M-\C-OA":       previous-history
#"\M-\C-OB":       next-history
#
# Arrow keys in 8 bit ANSI mode
#
#"\M-\C-[D":       backward-char
#"\M-\C-[C":       forward-char
#"\M-\C-[A":       previous-history
#"\M-\C-[B":       next-history

C-q: quoted-insert

$endif

# An old-style binding.  This happens to be the default.
TAB: complete

# Macros that are convenient for shell interaction
$if Bash
# edit the path
"\C-xp": "PATH=${PATH}\e\C-e\C-a\ef\C-f"
# prepare to type a quoted word --
# insert open and close double quotes
# and move to just after the open quote
"\C-x\"": "\"\"\C-b"
# insert a backslash (testing backslash escapes
# in sequences and macros)
"\C-x\\": "\\"
# Quote the current or previous word
"\C-xq": "\eb\"\ef\""
# Add a binding to refresh the line, which is unbound
"\C-xr": redraw-current-line
# Edit variable on current line.
"\M-\C-v": "\C-a\C-k$\C-y\M-\C-e\C-a\C-y="
$endif

# use a visible bell if one is available
set bell-style visible

# don't strip characters to 7 bits when reading
set input-meta on

# allow iso-latin1 characters to be inserted rather
# than converted to prefix-meta sequences
set convert-meta off

# display characters with the eighth bit set directly
# rather than as meta-prefixed characters
set output-meta on

# if there are more than 150 possible completions for
# a word, ask the user if he wants to see all of them
set completion-query-items 150

# For FTP
$if Ftp
"\C-xg": "get \M-?"
"\C-xt": "put \M-?"
"\M-.": yank-last-arg
$endif

8.4 Bindable Readline Commands

This section describes Readline commands that may be bound to key sequences. You can list your key bindings by executing bind -P or, for a more terse format, suitable for an inputrc file, bind -p. (See Bash Builtins.) Command names without an accompanying key sequence are unbound by default.

In the following descriptions, point refers to the current cursor position, and mark refers to a cursor position saved by the set-mark command. The text between the point and mark is referred to as the region.


8.4.1 Commands For Moving

beginning-of-line (C-a)

Move to the start of the current line.

end-of-line (C-e)

Move to the end of the line.

forward-char (C-f)

Move forward a character.

backward-char (C-b)

Move back a character.

forward-word (M-f)

Move forward to the end of the next word. Words are composed of letters and digits.

backward-word (M-b)

Move back to the start of the current or previous word. Words are composed of letters and digits.

shell-forward-word ()

Move forward to the end of the next word. Words are delimited by non-quoted shell metacharacters.

shell-backward-word ()

Move back to the start of the current or previous word. Words are delimited by non-quoted shell metacharacters.

clear-screen (C-l)

Clear the screen and redraw the current line, leaving the current line at the top of the screen.

redraw-current-line ()

Refresh the current line. By default, this is unbound.


8.4.2 Commands For Manipulating The History

accept-line (Newline or Return)

Accept the line regardless of where the cursor is. If this line is non-empty, add it to the history list according to the setting of the HISTCONTROL and HISTIGNORE variables. If this line is a modified history line, then restore the history line to its original state.

previous-history (C-p)

Move ‘back’ through the history list, fetching the previous command.

next-history (C-n)

Move ‘forward’ through the history list, fetching the next command.

beginning-of-history (M-<)

Move to the first line in the history.

end-of-history (M->)

Move to the end of the input history, i.e., the line currently being entered.

reverse-search-history (C-r)

Search backward starting at the current line and moving ‘up’ through the history as necessary. This is an incremental search.

forward-search-history (C-s)

Search forward starting at the current line and moving ‘down’ through the history as necessary. This is an incremental search.

non-incremental-reverse-search-history (M-p)

Search backward starting at the current line and moving ‘up’ through the history as necessary using a non-incremental search for a string supplied by the user. The search string may match anywhere in a history line.

non-incremental-forward-search-history (M-n)

Search forward starting at the current line and moving ‘down’ through the history as necessary using a non-incremental search for a string supplied by the user. The search string may match anywhere in a history line.

history-search-forward ()

Search forward through the history for the string of characters between the start of the current line and the point. The search string must match at the beginning of a history line. This is a non-incremental search. By default, this command is unbound.

history-search-backward ()

Search backward through the history for the string of characters between the start of the current line and the point. The search string must match at the beginning of a history line. This is a non-incremental search. By default, this command is unbound.

history-substr-search-forward ()

Search forward through the history for the string of characters between the start of the current line and the point. The search string may match anywhere in a history line. This is a non-incremental search. By default, this command is unbound.

history-substr-search-backward ()

Search backward through the history for the string of characters between the start of the current line and the point. The search string may match anywhere in a history line. This is a non-incremental search. By default, this command is unbound.

yank-nth-arg (M-C-y)

Insert the first argument to the previous command (usually the second word on the previous line) at point. With an argument n, insert the nth word from the previous command (the words in the previous command begin with word 0). A negative argument inserts the nth word from the end of the previous command. Once the argument n is computed, the argument is extracted as if the ‘!n’ history expansion had been specified.

yank-last-arg (M-. or M-_)

Insert last argument to the previous command (the last word of the previous history entry). With a numeric argument, behave exactly like yank-nth-arg. Successive calls to yank-last-arg move back through the history list, inserting the last word (or the word specified by the argument to the first call) of each line in turn. Any numeric argument supplied to these successive calls determines the direction to move through the history. A negative argument switches the direction through the history (back or forward). The history expansion facilities are used to extract the last argument, as if the ‘!$’ history expansion had been specified.


8.4.3 Commands For Changing Text

end-of-file (usually C-d)

The character indicating end-of-file as set, for example, by stty. If this character is read when there are no characters on the line, and point is at the beginning of the line, Readline interprets it as the end of input and returns EOF.

delete-char (C-d)

Delete the character at point. If this function is bound to the same character as the tty EOF character, as C-d commonly is, see above for the effects.

backward-delete-char (Rubout)

Delete the character behind the cursor. A numeric argument means to kill the characters instead of deleting them.

forward-backward-delete-char ()

Delete the character under the cursor, unless the cursor is at the end of the line, in which case the character behind the cursor is deleted. By default, this is not bound to a key.

quoted-insert (C-q or C-v)

Add the next character typed to the line verbatim. This is how to insert key sequences like C-q, for example.

self-insert (a, b, A, 1, !, …)

Insert yourself.

bracketed-paste-begin ()

This function is intended to be bound to the "bracketed paste" escape sequence sent by some terminals, and such a binding is assigned by default. It allows Readline to insert the pasted text as a single unit without treating each character as if it had been read from the keyboard. The characters are inserted as if each one was bound to self-insert) instead of executing any editing commands.

transpose-chars (C-t)

Drag the character before the cursor forward over the character at the cursor, moving the cursor forward as well. If the insertion point is at the end of the line, then this transposes the last two characters of the line. Negative arguments have no effect.

transpose-words (M-t)

Drag the word before point past the word after point, moving point past that word as well. If the insertion point is at the end of the line, this transposes the last two words on the line.

upcase-word (M-u)

Uppercase the current (or following) word. With a negative argument, uppercase the previous word, but do not move the cursor.

downcase-word (M-l)

Lowercase the current (or following) word. With a negative argument, lowercase the previous word, but do not move the cursor.

capitalize-word (M-c)

Capitalize the current (or following) word. With a negative argument, capitalize the previous word, but do not move the cursor.

overwrite-mode ()

Toggle overwrite mode. With an explicit positive numeric argument, switches to overwrite mode. With an explicit non-positive numeric argument, switches to insert mode. This command affects only emacs mode; vi mode does overwrite differently. Each call to readline() starts in insert mode.

In overwrite mode, characters bound to self-insert replace the text at point rather than pushing the text to the right. Characters bound to backward-delete-char replace the character before point with a space.

By default, this command is unbound.


8.4.4 Killing And Yanking

kill-line (C-k)

Kill the text from point to the end of the line.

backward-kill-line (C-x Rubout)

Kill backward from the cursor to the beginning of the current line.

unix-line-discard (C-u)

Kill backward from the cursor to the beginning of the current line.

kill-whole-line ()

Kill all characters on the current line, no matter where point is. By default, this is unbound.

kill-word (M-d)

Kill from point to the end of the current word, or if between words, to the end of the next word. Word boundaries are the same as forward-word.

backward-kill-word (M-DEL)

Kill the word behind point. Word boundaries are the same as backward-word.

shell-kill-word ()

Kill from point to the end of the current word, or if between words, to the end of the next word. Word boundaries are the same as shell-forward-word.

shell-backward-kill-word ()

Kill the word behind point. Word boundaries are the same as shell-backward-word.

unix-word-rubout (C-w)

Kill the word behind point, using white space as a word boundary. The killed text is saved on the kill-ring.

unix-filename-rubout ()

Kill the word behind point, using white space and the slash character as the word boundaries. The killed text is saved on the kill-ring.

delete-horizontal-space ()

Delete all spaces and tabs around point. By default, this is unbound.

kill-region ()

Kill the text in the current region. By default, this command is unbound.

copy-region-as-kill ()

Copy the text in the region to the kill buffer, so it can be yanked right away. By default, this command is unbound.

copy-backward-word ()

Copy the word before point to the kill buffer. The word boundaries are the same as backward-word. By default, this command is unbound.

copy-forward-word ()

Copy the word following point to the kill buffer. The word boundaries are the same as forward-word. By default, this command is unbound.

yank (C-y)

Yank the top of the kill ring into the buffer at point.

yank-pop (M-y)

Rotate the kill-ring, and yank the new top. You can only do this if the prior command is yank or yank-pop.


8.4.5 Specifying Numeric Arguments

digit-argument (M-0, M-1, … M--)

Add this digit to the argument already accumulating, or start a new argument. M-- starts a negative argument.

universal-argument ()

This is another way to specify an argument. If this command is followed by one or more digits, optionally with a leading minus sign, those digits define the argument. If the command is followed by digits, executing universal-argument again ends the numeric argument, but is otherwise ignored. As a special case, if this command is immediately followed by a character that is neither a digit nor minus sign, the argument count for the next command is multiplied by four. The argument count is initially one, so executing this function the first time makes the argument count four, a second time makes the argument count sixteen, and so on. By default, this is not bound to a key.


8.4.6 Letting Readline Type For You

complete (TAB)

Attempt to perform completion on the text before point. The actual completion performed is application-specific. Bash attempts completion treating the text as a variable (if the text begins with ‘$’), username (if the text begins with ‘~’), hostname (if the text begins with ‘@’), or command (including aliases and functions) in turn. If none of these produces a match, filename completion is attempted.

possible-completions (M-?)

List the possible completions of the text before point. When displaying completions, Readline sets the number of columns used for display to the value of completion-display-width, the value of the environment variable COLUMNS, or the screen width, in that order.

insert-completions (M-*)

Insert all completions of the text before point that would have been generated by possible-completions.

menu-complete ()

Similar to complete, but replaces the word to be completed with a single match from the list of possible completions. Repeated execution of menu-complete steps through the list of possible completions, inserting each match in turn. At the end of the list of completions, the bell is rung (subject to the setting of bell-style) and the original text is restored. An argument of n moves n positions forward in the list of matches; a negative argument may be used to move backward through the list. This command is intended to be bound to TAB, but is unbound by default.

menu-complete-backward ()

Identical to menu-complete, but moves backward through the list of possible completions, as if menu-complete had been given a negative argument.

delete-char-or-list ()

Deletes the character under the cursor if not at the beginning or end of the line (like delete-char). If at the end of the line, behaves identically to possible-completions. This command is unbound by default.

complete-filename (M-/)

Attempt filename completion on the text before point.

possible-filename-completions (C-x /)

List the possible completions of the text before point, treating it as a filename.

complete-username (M-~)

Attempt completion on the text before point, treating it as a username.

possible-username-completions (C-x ~)

List the possible completions of the text before point, treating it as a username.

complete-variable (M-$)

Attempt completion on the text before point, treating it as a shell variable.

possible-variable-completions (C-x $)

List the possible completions of the text before point, treating it as a shell variable.

complete-hostname (M-@)

Attempt completion on the text before point, treating it as a hostname.

possible-hostname-completions (C-x @)

List the possible completions of the text before point, treating it as a hostname.

complete-command (M-!)

Attempt completion on the text before point, treating it as a command name. Command completion attempts to match the text against aliases, reserved words, shell functions, shell builtins, and finally executable filenames, in that order.

possible-command-completions (C-x !)

List the possible completions of the text before point, treating it as a command name.

dynamic-complete-history (M-TAB)

Attempt completion on the text before point, comparing the text against lines from the history list for possible completion matches.

dabbrev-expand ()

Attempt menu completion on the text before point, comparing the text against lines from the history list for possible completion matches.

complete-into-braces (M-{)

Perform filename completion and insert the list of possible completions enclosed within braces so the list is available to the shell (see Brace Expansion).


8.4.7 Keyboard Macros

start-kbd-macro (C-x ()

Begin saving the characters typed into the current keyboard macro.

end-kbd-macro (C-x ))

Stop saving the characters typed into the current keyboard macro and save the definition.

call-last-kbd-macro (C-x e)

Re-execute the last keyboard macro defined, by making the characters in the macro appear as if typed at the keyboard.

print-last-kbd-macro ()

Print the last keboard macro defined in a format suitable for the inputrc file.


8.4.8 Some Miscellaneous Commands

re-read-init-file (C-x C-r)

Read in the contents of the inputrc file, and incorporate any bindings or variable assignments found there.

abort (C-g)

Abort the current editing command and ring the terminal’s bell (subject to the setting of bell-style).

do-uppercase-version (M-a, M-b, M-x, …)

If the metafied character x is lowercase, run the command that is bound to the corresponding uppercase character.

prefix-meta (ESC)

Metafy the next character typed. This is for keyboards without a meta key. Typing ‘ESC f’ is equivalent to typing M-f.

undo (C-_ or C-x C-u)

Incremental undo, separately remembered for each line.

revert-line (M-r)

Undo all changes made to this line. This is like executing the undo command enough times to get back to the beginning.

tilde-expand (M-&)

Perform tilde expansion on the current word.

set-mark (C-@)

Set the mark to the point. If a numeric argument is supplied, the mark is set to that position.

exchange-point-and-mark (C-x C-x)

Swap the point with the mark. The current cursor position is set to the saved position, and the old cursor position is saved as the mark.

character-search (C-])

A character is read and point is moved to the next occurrence of that character. A negative count searches for previous occurrences.

character-search-backward (M-C-])

A character is read and point is moved to the previous occurrence of that character. A negative count searches for subsequent occurrences.

skip-csi-sequence ()

Read enough characters to consume a multi-key sequence such as those defined for keys like Home and End. Such sequences begin with a Control Sequence Indicator (CSI), usually ESC-[. If this sequence is bound to "\e[", keys producing such sequences will have no effect unless explicitly bound to a readline command, instead of inserting stray characters into the editing buffer. This is unbound by default, but usually bound to ESC-[.

insert-comment (M-#)

Without a numeric argument, the value of the comment-begin variable is inserted at the beginning of the current line. If a numeric argument is supplied, this command acts as a toggle: if the characters at the beginning of the line do not match the value of comment-begin, the value is inserted, otherwise the characters in comment-begin are deleted from the beginning of the line. In either case, the line is accepted as if a newline had been typed. The default value of comment-begin causes this command to make the current line a shell comment. If a numeric argument causes the comment character to be removed, the line will be executed by the shell.

dump-functions ()

Print all of the functions and their key bindings to the Readline output stream. If a numeric argument is supplied, the output is formatted in such a way that it can be made part of an inputrc file. This command is unbound by default.

dump-variables ()

Print all of the settable variables and their values to the Readline output stream. If a numeric argument is supplied, the output is formatted in such a way that it can be made part of an inputrc file. This command is unbound by default.

dump-macros ()

Print all of the Readline key sequences bound to macros and the strings they output. If a numeric argument is supplied, the output is formatted in such a way that it can be made part of an inputrc file. This command is unbound by default.

glob-complete-word (M-g)

The word before point is treated as a pattern for pathname expansion, with an asterisk implicitly appended. This pattern is used to generate a list of matching file names for possible completions.

glob-expand-word (C-x *)

The word before point is treated as a pattern for pathname expansion, and the list of matching file names is inserted, replacing the word. If a numeric argument is supplied, a ‘*’ is appended before pathname expansion.

glob-list-expansions (C-x g)

The list of expansions that would have been generated by glob-expand-word is displayed, and the line is redrawn. If a numeric argument is supplied, a ‘*’ is appended before pathname expansion.

display-shell-version (C-x C-v)

Display version information about the current instance of Bash.

shell-expand-line (M-C-e)

Expand the line as the shell does. This performs alias and history expansion as well as all of the shell word expansions (see Shell Expansions).

history-expand-line (M-^)

Perform history expansion on the current line.

magic-space ()

Perform history expansion on the current line and insert a space (see History Interaction).

alias-expand-line ()

Perform alias expansion on the current line (see Aliases).

history-and-alias-expand-line ()

Perform history and alias expansion on the current line.

insert-last-argument (M-. or M-_)

A synonym for yank-last-arg.

operate-and-get-next (C-o)

Accept the current line for execution and fetch the next line relative to the current line from the history for editing. Any argument is ignored.

edit-and-execute-command (C-xC-e)

Invoke an editor on the current command line, and execute the result as shell commands. Bash attempts to invoke $VISUAL, $EDITOR, and emacs as the editor, in that order.


8.5 Readline vi Mode

While the Readline library does not have a full set of vi editing functions, it does contain enough to allow simple editing of the line. The Readline vi mode behaves as specified in the POSIX standard.

In order to switch interactively between emacs and vi editing modes, use the ‘set -o emacs’ and ‘set -o vi’ commands (see The Set Builtin). The Readline default is emacs mode.

When you enter a line in vi mode, you are already placed in ‘insertion’ mode, as if you had typed an ‘i’. Pressing ESC switches you into ‘command’ mode, where you can edit the text of the line with the standard vi movement keys, move to previous history lines with ‘k’ and subsequent lines with ‘j’, and so forth.


8.6 Programmable Completion

When word completion is attempted for an argument to a command for which a completion specification (a compspec) has been defined using the complete builtin (see Programmable Completion Builtins), the programmable completion facilities are invoked.

First, the command name is identified. If a compspec has been defined for that command, the compspec is used to generate the list of possible completions for the word. If the command word is the empty string (completion attempted at the beginning of an empty line), any compspec defined with the -E option to complete is used. If the command word is a full pathname, a compspec for the full pathname is searched for first. If no compspec is found for the full pathname, an attempt is made to find a compspec for the portion following the final slash. If those searches do not result in a compspec, any compspec defined with the -D option to complete is used as the default.

Once a compspec has been found, it is used to generate the list of matching words. If a compspec is not found, the default Bash completion described above (see Commands For Completion) is performed.

First, the actions specified by the compspec are used. Only matches which are prefixed by the word being completed are returned. When the -f or -d option is used for filename or directory name completion, the shell variable FIGNORE is used to filter the matches. See Bash Variables, for a description of FIGNORE.

Any completions specified by a filename expansion pattern to the -G option are generated next. The words generated by the pattern need not match the word being completed. The GLOBIGNORE shell variable is not used to filter the matches, but the FIGNORE shell variable is used.

Next, the string specified as the argument to the -W option is considered. The string is first split using the characters in the IFS special variable as delimiters. Shell quoting is honored. Each word is then expanded using brace expansion, tilde expansion, parameter and variable expansion, command substitution, and arithmetic expansion, as described above (see Shell Expansions). The results are split using the rules described above (see Word Splitting). The results of the expansion are prefix-matched against the word being completed, and the matching words become the possible completions.

After these matches have been generated, any shell function or command specified with the -F and -C options is invoked. When the command or function is invoked, the COMP_LINE, COMP_POINT, COMP_KEY, and COMP_TYPE variables are assigned values as described above (see Bash Variables). If a shell function is being invoked, the COMP_WORDS and COMP_CWORD variables are also set. When the function or command is invoked, the first argument ($1) is the name of the command whose arguments are being completed, the second argument ($2) is the word being completed, and the third argument ($3) is the word preceding the word being completed on the current command line. No filtering of the generated completions against the word being completed is performed; the function or command has complete freedom in generating the matches.

Any function specified with -F is invoked first. The function may use any of the shell facilities, including the compgen and compopt builtins described below (see Programmable Completion Builtins), to generate the matches. It must put the possible completions in the COMPREPLY array variable, one per array element.

Next, any command specified with the -C option is invoked in an environment equivalent to command substitution. It should print a list of completions, one per line, to the standard output. Backslash may be used to escape a newline, if necessary.

After all of the possible completions are generated, any filter specified with the -X option is applied to the list. The filter is a pattern as used for pathname expansion; a ‘&’ in the pattern is replaced with the text of the word being completed. A literal ‘&’ may be escaped with a backslash; the backslash is removed before attempting a match. Any completion that matches the pattern will be removed from the list. A leading ‘!’ negates the pattern; in this case any completion not matching the pattern will be removed. If the nocasematch shell option (see the description of shopt in The Shopt Builtin) is enabled, the match is performed without regard to the case of alphabetic characters.

Finally, any prefix and suffix specified with the -P and -S options are added to each member of the completion list, and the result is returned to the Readline completion code as the list of possible completions.

If the previously-applied actions do not generate any matches, and the -o dirnames option was supplied to complete when the compspec was defined, directory name completion is attempted.

If the -o plusdirs option was supplied to complete when the compspec was defined, directory name completion is attempted and any matches are added to the results of the other actions.

By default, if a compspec is found, whatever it generates is returned to the completion code as the full set of possible completions. The default Bash completions are not attempted, and the Readline default of filename completion is disabled. If the -o bashdefault option was supplied to complete when the compspec was defined, the default Bash completions are attempted if the compspec generates no matches. If the -o default option was supplied to complete when the compspec was defined, Readline’s default completion will be performed if the compspec (and, if attempted, the default Bash completions) generate no matches.

When a compspec indicates that directory name completion is desired, the programmable completion functions force Readline to append a slash to completed names which are symbolic links to directories, subject to the value of the mark-directories Readline variable, regardless of the setting of the mark-symlinked-directories Readline variable.

There is some support for dynamically modifying completions. This is most useful when used in combination with a default completion specified with -D. It’s possible for shell functions executed as completion handlers to indicate that completion should be retried by returning an exit status of 124. If a shell function returns 124, and changes the compspec associated with the command on which completion is being attempted (supplied as the first argument when the function is executed), programmable completion restarts from the beginning, with an attempt to find a new compspec for that command. This allows a set of completions to be built dynamically as completion is attempted, rather than being loaded all at once.

For instance, assuming that there is a library of compspecs, each kept in a file corresponding to the name of the command, the following default completion function would load completions dynamically:

_completion_loader()
{
    . "/etc/bash_completion.d/$1.sh" >/dev/null 2>&1 && return 124
}
complete -D -F _completion_loader -o bashdefault -o default

8.7 Programmable Completion Builtins

Three builtin commands are available to manipulate the programmable completion facilities: one to specify how the arguments to a particular command are to be completed, and two to modify the completion as it is happening.

compgen
compgen [option] [word]

Generate possible completion matches for word according to the options, which may be any option accepted by the complete builtin with the exception of -p and -r, and write the matches to the standard output. When using the -F or -C options, the various shell variables set by the programmable completion facilities, while available, will not have useful values.

The matches will be generated in the same way as if the programmable completion code had generated them directly from a completion specification with the same flags. If word is specified, only those completions matching word will be displayed.

The return value is true unless an invalid option is supplied, or no matches were generated.

complete
complete [-abcdefgjksuv] [-o comp-option] [-DE] [-A action] [-G globpat] [-W wordlist]
[-F function] [-C command] [-X filterpat]
[-P prefix] [-S suffix] name [name …]
complete -pr [-DE] [name …]

Specify how arguments to each name should be completed. If the -p option is supplied, or if no options are supplied, existing completion specifications are printed in a way that allows them to be reused as input. The -r option removes a completion specification for each name, or, if no names are supplied, all completion specifications. The -D option indicates that the remaining options and actions should apply to the “default” command completion; that is, completion attempted on a command for which no completion has previously been defined. The -E option indicates that the remaining options and actions should apply to “empty” command completion; that is, completion attempted on a blank line.

The process of applying these completion specifications when word completion is attempted is described above (see Programmable Completion). The -D option takes precedence over -E.

Other options, if specified, have the following meanings. The arguments to the -G, -W, and -X options (and, if necessary, the -P and -S options) should be quoted to protect them from expansion before the complete builtin is invoked.

-o comp-option

The comp-option controls several aspects of the compspec’s behavior beyond the simple generation of completions. comp-option may be one of:

bashdefault

Perform the rest of the default Bash completions if the compspec generates no matches.

default

Use Readline’s default filename completion if the compspec generates no matches.

dirnames

Perform directory name completion if the compspec generates no matches.

filenames

Tell Readline that the compspec generates filenames, so it can perform any filename-specific processing (like adding a slash to directory names quoting special characters, or suppressing trailing spaces). This option is intended to be used with shell functions specified with -F.

noquote

Tell Readline not to quote the completed words if they are filenames (quoting filenames is the default).

nosort

Tell Readline not to sort the list of possible completions alphabetically.

nospace

Tell Readline not to append a space (the default) to words completed at the end of the line.

plusdirs

After any matches defined by the compspec are generated, directory name completion is attempted and any matches are added to the results of the other actions.

-A action

The action may be one of the following to generate a list of possible completions:

alias

Alias names. May also be specified as -a.

arrayvar

Array variable names.

binding

Readline key binding names (see Bindable Readline Commands).

builtin

Names of shell builtin commands. May also be specified as -b.

command

Command names. May also be specified as -c.

directory

Directory names. May also be specified as -d.

disabled

Names of disabled shell builtins.

enabled

Names of enabled shell builtins.

export

Names of exported shell variables. May also be specified as -e.

file

File names. May also be specified as -f.

function

Names of shell functions.

group

Group names. May also be specified as -g.

helptopic

Help topics as accepted by the help builtin (see Bash Builtins).

hostname

Hostnames, as taken from the file specified by the HOSTFILE shell variable (see Bash Variables).

job

Job names, if job control is active. May also be specified as -j.

keyword

Shell reserved words. May also be specified as -k.

running

Names of running jobs, if job control is active.

service

Service names. May also be specified as -s.

setopt

Valid arguments for the -o option to the set builtin (see The Set Builtin).

shopt

Shell option names as accepted by the shopt builtin (see Bash Builtins).

signal

Signal names.

stopped

Names of stopped jobs, if job control is active.

user

User names. May also be specified as -u.

variable

Names of all shell variables. May also be specified as -v.

-C command

command is executed in a subshell environment, and its output is used as the possible completions.

-F function

The shell function function is executed in the current shell environment. When it is executed, $1 is the name of the command whose arguments are being completed, $2 is the word being completed, and $3 is the word preceding the word being completed, as described above (see Programmable Completion). When it finishes, the possible completions are retrieved from the value of the COMPREPLY array variable.

-G globpat

The filename expansion pattern globpat is expanded to generate the possible completions.

-P prefix

prefix is added at the beginning of each possible completion after all other options have been applied.

-S suffix

suffix is appended to each possible completion after all other options have been applied.

-W wordlist

The wordlist is split using the characters in the IFS special variable as delimiters, and each resultant word is expanded. The possible completions are the members of the resultant list which match the word being completed.

-X filterpat

filterpat is a pattern as used for filename expansion. It is applied to the list of possible completions generated by the preceding options and arguments, and each completion matching filterpat is removed from the list. A leading ‘!’ in filterpat negates the pattern; in this case, any completion not matching filterpat is removed.

The return value is true unless an invalid option is supplied, an option other than -p or -r is supplied without a name argument, an attempt is made to remove a completion specification for a name for which no specification exists, or an error occurs adding a completion specification.

compopt
compopt [-o option] [-DE] [+o option] [name]

Modify completion options for each name according to the options, or for the currently-executing completion if no names are supplied. If no options are given, display the completion options for each name or the current completion. The possible values of option are those valid for the complete builtin described above. The -D option indicates that the remaining options should apply to the “default” command completion; that is, completion attempted on a command for which no completion has previously been defined. The -E option indicates that the remaining options should apply to “empty” command completion; that is, completion attempted on a blank line.

The -D option takes precedence over -E.

The return value is true unless an invalid option is supplied, an attempt is made to modify the options for a name for which no completion specification exists, or an output error occurs.


8.8 A Programmable Completion Example

The most common way to obtain additional completion functionality beyond the default actions complete and compgen provide is to use a shell function and bind it to a particular command using complete -F.

The following function provides completions for the cd builtin. It is a reasonably good example of what shell functions must do when used for completion. This function uses the word passsed as $2 to determine the directory name to complete. You can also use the COMP_WORDS array variable; the current word is indexed by the COMP_CWORD variable.

The function relies on the complete and compgen builtins to do much of the work, adding only the things that the Bash cd does beyond accepting basic directory names: tilde expansion (see Tilde Expansion), searching directories in $CDPATH, which is described above (see Bourne Shell Builtins), and basic support for the cdable_vars shell option (see The Shopt Builtin). _comp_cd modifies the value of IFS so that it contains only a newline to accommodate file names containing spaces and tabs – compgen prints the possible completions it generates one per line.

Possible completions go into the COMPREPLY array variable, one completion per array element. The programmable completion system retrieves the completions from there when the function returns.

# A completion function for the cd builtin
# based on the cd completion function from the bash_completion package
_comp_cd()
{
    local IFS=$' \t\n'    # normalize IFS
    local cur _skipdot _cdpath
    local i j k

    # Tilde expansion, with side effect of expanding tilde to full pathname
    case "$2" in
    \~*)    eval cur="$2" ;;
    *)      cur=$2 ;;
    esac

    # no cdpath or absolute pathname -- straight directory completion
    if [[ -z "${CDPATH:-}" ]] || [[ "$cur" == @(./*|../*|/*) ]]; then
        # compgen prints paths one per line; could also use while loop
        IFS=$'\n'
        COMPREPLY=( $(compgen -d -- "$cur") )
        IFS=$' \t\n'
    # CDPATH+directories in the current directory if not in CDPATH
    else
        IFS=$'\n'
        _skipdot=false
        # preprocess CDPATH to convert null directory names to .
        _cdpath=${CDPATH/#:/.:}
        _cdpath=${_cdpath//::/:.:}
        _cdpath=${_cdpath/%:/:.}
        for i in ${_cdpath//:/$'\n'}; do
            if [[ $i -ef . ]]; then _skipdot=true; fi
            k="${#COMPREPLY[@]}"
            for j in $( compgen -d -- "$i/$cur" ); do
                COMPREPLY[k++]=${j#$i/}        # cut off directory
            done
        done
        $_skipdot || COMPREPLY+=( $(compgen -d -- "$cur") )
        IFS=$' \t\n'
    fi

    # variable names if appropriate shell option set and no completions
    if shopt -q cdable_vars && [[ ${#COMPREPLY[@]} -eq 0 ]]; then
        COMPREPLY=( $(compgen -v -- "$cur") )
    fi

    return 0
}

We install the completion function using the -F option to complete:

# Tell readline to quote appropriate and append slashes to directories;
# use the bash default completion for other arguments
complete -o filenames -o nospace -o bashdefault -F _comp_cd cd

Since we’d like Bash and Readline to take care of some of the other details for us, we use several other options to tell Bash and Readline what to do. The -o filenames option tells Readline that the possible completions should be treated as filenames, and quoted appropriately. That option will also cause Readline to append a slash to filenames it can determine are directories (which is why we might want to extend _comp_cd to append a slash if we’re using directories found via CDPATH: Readline can’t tell those completions are directories). The -o nospace option tells Readline to not append a space character to the directory name, in case we want to append to it. The -o bashdefault option brings in the rest of the "Bash default" completions – possible completion that Bash adds to the default Readline set. These include things like command name completion, variable completion for words beginning with ‘{’, completions containing pathname expansion patterns (see Filename Expansion), and so on.

Once installed using complete, _comp_cd will be called every time we attempt word completion for a cd command.

Many more examples – an extensive collection of completions for most of the common GNU, Unix, and Linux commands – are available as part of the bash_completion project. This is installed by default on many GNU/Linux distributions. Originally written by Ian Macdonald, the project now lives at http://bash-completion.alioth.debian.org/. There are ports for other systems such as Solaris and Mac OS X.

An older version of the bash_completion package is distributed with bash in the examples/complete subdirectory.


Next: , Previous: , Up: Top   [Contents][Index]

9 Using History Interactively

This chapter describes how to use the GNU History Library interactively, from a user’s standpoint. It should be considered a user’s guide. For information on using the GNU History Library in other programs, see the GNU Readline Library Manual.


9.1 Bash History Facilities

When the -o history option to the set builtin is enabled (see The Set Builtin), the shell provides access to the command history, the list of commands previously typed. The value of the HISTSIZE shell variable is used as the number of commands to save in a history list. The text of the last $HISTSIZE commands (default 500) is saved. The shell stores each command in the history list prior to parameter and variable expansion but after history expansion is performed, subject to the values of the shell variables HISTIGNORE and HISTCONTROL.

When the shell starts up, the history is initialized from the file named by the HISTFILE variable (default ~/.bash_history). The file named by the value of HISTFILE is truncated, if necessary, to contain no more than the number of lines specified by the value of the HISTFILESIZE variable. When a shell with history enabled exits, the last $HISTSIZE lines are copied from the history list to the file named by $HISTFILE. If the histappend shell option is set (see Bash Builtins), the lines are appended to the history file, otherwise the history file is overwritten. If HISTFILE is unset, or if the history file is unwritable, the history is not saved. After saving the history, the history file is truncated to contain no more than $HISTFILESIZE lines. If HISTFILESIZE is unset, or set to null, a non-numeric value, or a numeric value less than zero, the history file is not truncated.

If the HISTTIMEFORMAT is set, the time stamp information associated with each history entry is written to the history file, marked with the history comment character. When the history file is read, lines beginning with the history comment character followed immediately by a digit are interpreted as timestamps for the following history entry.

The builtin command fc may be used to list or edit and re-execute a portion of the history list. The history builtin may be used to display or modify the history list and manipulate the history file. When using command-line editing, search commands are available in each editing mode that provide access to the history list (see Commands For History).

The shell allows control over which commands are saved on the history list. The HISTCONTROL and HISTIGNORE variables may be set to cause the shell to save only a subset of the commands entered. The cmdhist shell option, if enabled, causes the shell to attempt to save each line of a multi-line command in the same history entry, adding semicolons where necessary to preserve syntactic correctness. The lithist shell option causes the shell to save the command with embedded newlines instead of semicolons. The shopt builtin is used to set these options. See Bash Builtins, for a description of shopt.


9.2 Bash History Builtins

Bash provides two builtin commands which manipulate the history list and history file.

fc
fc [-e ename] [-lnr] [first] [last]
fc -s [pat=rep] [command]

The first form selects a range of commands from first to last from the history list and displays or edits and re-executes them. Both first and last may be specified as a string (to locate the most recent command beginning with that string) or as a number (an index into the history list, where a negative number is used as an offset from the current command number). If last is not specified it is set to first. If first is not specified it is set to the previous command for editing and -16 for listing. If the -l flag is given, the commands are listed on standard output. The -n flag suppresses the command numbers when listing. The -r flag reverses the order of the listing. Otherwise, the editor given by ename is invoked on a file containing those commands. If ename is not given, the value of the following variable expansion is used: ${FCEDIT:-${EDITOR:-vi}}. This says to use the value of the FCEDIT variable if set, or the value of the EDITOR variable if that is set, or vi if neither is set. When editing is complete, the edited commands are echoed and executed.

In the second form, command is re-executed after each instance of pat in the selected command is replaced by rep. command is intepreted the same as first above.

A useful alias to use with the fc command is r='fc -s', so that typing ‘r cc’ runs the last command beginning with cc and typing ‘r’ re-executes the last command (see Aliases).

history
history [n]
history -c
history -d offset
history [-anrw] [filename]
history -ps arg

With no options, display the history list with line numbers. Lines prefixed with a ‘*’ have been modified. An argument of n lists only the last n lines. If the shell variable HISTTIMEFORMAT is set and not null, it is used as a format string for strftime to display the time stamp associated with each displayed history entry. No intervening blank is printed between the formatted time stamp and the history line.

Options, if supplied, have the following meanings:

-c

Clear the history list. This may be combined with the other options to replace the history list completely.

-d offset

Delete the history entry at position offset. offset should be specified as it appears when the history is displayed.

-a

Append the new history lines to the history file. These are history lines entered since the beginning of the current Bash session, but not already appended to the history file.

-n

Append the history lines not already read from the history file to the current history list. These are lines appended to the history file since the beginning of the current Bash session.

-r

Read the history file and append its contents to the history list.

-w

Write out the current history list to the history file.

-p

Perform history substitution on the args and display the result on the standard output, without storing the results in the history list.

-s

The args are added to the end of the history list as a single entry.

When any of the -w, -r, -a, or -n options is used, if filename is given, then it is used as the history file. If not, then the value of the HISTFILE variable is used.


9.3 History Expansion

The History library provides a history expansion feature that is similar to the history expansion provided by csh. This section describes the syntax used to manipulate the history information.

History expansions introduce words from the history list into the input stream, making it easy to repeat commands, insert the arguments to a previous command into the current input line, or fix errors in previous commands quickly.

History expansion is performed immediately after a complete line is read, before the shell breaks it into words.

History expansion takes place in two parts. The first is to determine which line from the history list should be used during substitution. The second is to select portions of that line for inclusion into the current one. The line selected from the history is called the event, and the portions of that line that are acted upon are called words. Various modifiers are available to manipulate the selected words. The line is broken into words in the same fashion that Bash does, so that several words surrounded by quotes are considered one word. History expansions are introduced by the appearance of the history expansion character, which is ‘!’ by default. Only ‘\’ and ‘'’ may be used to escape the history expansion character, but the history expansion character is also treated as quoted if it immediately precedes the closing double quote in a double-quoted string.

Several shell options settable with the shopt builtin (see Bash Builtins) may be used to tailor the behavior of history expansion. If the histverify shell option is enabled, and Readline is being used, history substitutions are not immediately passed to the shell parser. Instead, the expanded line is reloaded into the Readline editing buffer for further modification. If Readline is being used, and the histreedit shell option is enabled, a failed history expansion will be reloaded into the Readline editing buffer for correction. The -p option to the history builtin command may be used to see what a history expansion will do before using it. The -s option to the history builtin may be used to add commands to the end of the history list without actually executing them, so that they are available for subsequent recall. This is most useful in conjunction with Readline.

The shell allows control of the various characters used by the history expansion mechanism with the histchars variable, as explained above (see Bash Variables). The shell uses the history comment character to mark history timestamps when writing the history file.


9.3.1 Event Designators

An event designator is a reference to a command line entry in the history list. Unless the reference is absolute, events are relative to the current position in the history list.

!

Start a history substitution, except when followed by a space, tab, the end of the line, ‘=’ or ‘(’ (when the extglob shell option is enabled using the shopt builtin).

!n

Refer to command line n.

!-n

Refer to the command n lines back.

!!

Refer to the previous command. This is a synonym for ‘!-1’.

!string

Refer to the most recent command preceding the current position in the history list starting with string.

!?string[?]

Refer to the most recent command preceding the current position in the history list containing string. The trailing ‘?’ may be omitted if the string is followed immediately by a newline.

^string1^string2^

Quick Substitution. Repeat the last command, replacing string1 with string2. Equivalent to !!:s/string1/string2/.

!#

The entire command line typed so far.


9.3.2 Word Designators

Word designators are used to select desired words from the event. A ‘:’ separates the event specification from the word designator. It may be omitted if the word designator begins with a ‘^’, ‘$’, ‘*’, ‘-’, or ‘%’. Words are numbered from the beginning of the line, with the first word being denoted by 0 (zero). Words are inserted into the current line separated by single spaces.

For example,

!!

designates the preceding command. When you type this, the preceding command is repeated in toto.

!!:$

designates the last argument of the preceding command. This may be shortened to !$.

!fi:2

designates the second argument of the most recent command starting with the letters fi.

Here are the word designators:

0 (zero)

The 0th word. For many applications, this is the command word.

n

The nth word.

^

The first argument; that is, word 1.

$

The last argument.

%

The word matched by the most recent ‘?string?’ search.

x-y

A range of words; ‘-y’ abbreviates ‘0-y’.

*

All of the words, except the 0th. This is a synonym for ‘1-$’. It is not an error to use ‘*’ if there is just one word in the event; the empty string is returned in that case.

x*

Abbreviates ‘x-$

x-

Abbreviates ‘x-$’ like ‘x*’, but omits the last word.

If a word designator is supplied without an event specification, the previous command is used as the event.


9.3.3 Modifiers

After the optional word designator, you can add a sequence of one or more of the following modifiers, each preceded by a ‘:’.

h

Remove a trailing pathname component, leaving only the head.

t

Remove all leading pathname components, leaving the tail.

r

Remove a trailing suffix of the form ‘.suffix’, leaving the basename.

e

Remove all but the trailing suffix.

p

Print the new command but do not execute it.

q

Quote the substituted words, escaping further substitutions.

x

Quote the substituted words as with ‘q’, but break into words at spaces, tabs, and newlines.

s/old/new/

Substitute new for the first occurrence of old in the event line. Any delimiter may be used in place of ‘/’. The delimiter may be quoted in old and new with a single backslash. If ‘&’ appears in new, it is replaced by old. A single backslash will quote the ‘&’. The final delimiter is optional if it is the last character on the input line.

&

Repeat the previous substitution.

g
a

Cause changes to be applied over the entire event line. Used in conjunction with ‘s’, as in gs/old/new/, or with ‘&’.

G

Apply the following ‘s’ modifier once to each word in the event.


10 Installing Bash

This chapter provides basic instructions for installing Bash on the various supported platforms. The distribution supports the GNU operating systems, nearly every version of Unix, and several non-Unix systems such as BeOS and Interix. Other independent ports exist for MS-DOS, OS/2, and Windows platforms.


10.1 Basic Installation

These are installation instructions for Bash.

The simplest way to compile Bash is:

  1. cd to the directory containing the source code and type ‘./configure’ to configure Bash for your system. If you’re using csh on an old version of System V, you might need to type ‘sh ./configure’ instead to prevent csh from trying to execute configure itself.

    Running configure takes some time. While running, it prints messages telling which features it is checking for.

  2. Type ‘make’ to compile Bash and build the bashbug bug reporting script.
  3. Optionally, type ‘make tests’ to run the Bash test suite.
  4. Type ‘make install’ to install bash and bashbug. This will also install the manual pages and Info file.

The configure shell script attempts to guess correct values for various system-dependent variables used during compilation. It uses those values to create a Makefile in each directory of the package (the top directory, the builtins, doc, and support directories, each directory under lib, and several others). It also creates a config.h file containing system-dependent definitions. Finally, it creates a shell script named config.status that you can run in the future to recreate the current configuration, a file config.cache that saves the results of its tests to speed up reconfiguring, and a file config.log containing compiler output (useful mainly for debugging configure). If at some point config.cache contains results you don’t want to keep, you may remove or edit it.

To find out more about the options and arguments that the configure script understands, type

bash-2.04$ ./configure --help

at the Bash prompt in your Bash source directory.

If you need to do unusual things to compile Bash, please try to figure out how configure could check whether or not to do them, and mail diffs or instructions to bash-maintainers@gnu.org so they can be considered for the next release.

The file configure.ac is used to create configure by a program called Autoconf. You only need configure.ac if you want to change it or regenerate configure using a newer version of Autoconf. If you do this, make sure you are using Autoconf version 2.50 or newer.

You can remove the program binaries and object files from the source code directory by typing ‘make clean’. To also remove the files that configure created (so you can compile Bash for a different kind of computer), type ‘make distclean’.


10.2 Compilers and Options

Some systems require unusual options for compilation or linking that the configure script does not know about. You can give configure initial values for variables by setting them in the environment. Using a Bourne-compatible shell, you can do that on the command line like this:

CC=c89 CFLAGS=-O2 LIBS=-lposix ./configure

On systems that have the env program, you can do it like this:

env CPPFLAGS=-I/usr/local/include LDFLAGS=-s ./configure

The configuration process uses GCC to build Bash if it is available.


10.3 Compiling For Multiple Architectures

You can compile Bash for more than one kind of computer at the same time, by placing the object files for each architecture in their own directory. To do this, you must use a version of make that supports the VPATH variable, such as GNU make. cd to the directory where you want the object files and executables to go and run the configure script from the source directory. You may need to supply the --srcdir=PATH argument to tell configure where the source files are. configure automatically checks for the source code in the directory that configure is in and in ‘..’.

If you have to use a make that does not supports the VPATH variable, you can compile Bash for one architecture at a time in the source code directory. After you have installed Bash for one architecture, use ‘make distclean’ before reconfiguring for another architecture.

Alternatively, if your system supports symbolic links, you can use the support/mkclone script to create a build tree which has symbolic links back to each file in the source directory. Here’s an example that creates a build directory in the current directory from a source directory /usr/gnu/src/bash-2.0:

bash /usr/gnu/src/bash-2.0/support/mkclone -s /usr/gnu/src/bash-2.0 .

The mkclone script requires Bash, so you must have already built Bash for at least one architecture before you can create build directories for other architectures.


10.4 Installation Names

By default, ‘make install’ will install into /usr/local/bin, /usr/local/man, etc. You can specify an installation prefix other than /usr/local by giving configure the option --prefix=PATH, or by specifying a value for the DESTDIRmake’ variable when running ‘make install’.

You can specify separate installation prefixes for architecture-specific files and architecture-independent files. If you give configure the option --exec-prefix=PATH, ‘make install’ will use PATH as the prefix for installing programs and libraries. Documentation and other data files will still use the regular prefix.


10.5 Specifying the System Type

There may be some features configure can not figure out automatically, but need to determine by the type of host Bash will run on. Usually configure can figure that out, but if it prints a message saying it can not guess the host type, give it the --host=TYPE option. ‘TYPE’ can either be a short name for the system type, such as ‘sun4’, or a canonical name with three fields: ‘CPU-COMPANY-SYSTEM’ (e.g., ‘i386-unknown-freebsd4.2’).

See the file support/config.sub for the possible values of each field.


10.6 Sharing Defaults

If you want to set default values for configure scripts to share, you can create a site shell script called config.site that gives default values for variables like CC, cache_file, and prefix. configure looks for PREFIX/share/config.site if it exists, then PREFIX/etc/config.site if it exists. Or, you can set the CONFIG_SITE environment variable to the location of the site script. A warning: the Bash configure looks for a site script, but not all configure scripts do.


10.7 Operation Controls

configure recognizes the following options to control how it operates.

--cache-file=file

Use and save the results of the tests in file instead of ./config.cache. Set file to /dev/null to disable caching, for debugging configure.

--help

Print a summary of the options to configure, and exit.

--quiet
--silent
-q

Do not print messages saying which checks are being made.

--srcdir=dir

Look for the Bash source code in directory dir. Usually configure can determine that directory automatically.

--version

Print the version of Autoconf used to generate the configure script, and exit.

configure also accepts some other, not widely used, boilerplate options. ‘configure --help’ prints the complete list.


10.8 Optional Features

The Bash configure has a number of --enable-feature options, where feature indicates an optional part of Bash. There are also several --with-package options, where package is something like ‘bash-malloc’ or ‘purify’. To turn off the default use of a package, use --without-package. To configure Bash without a feature that is enabled by default, use --disable-feature.

Here is a complete list of the --enable- and --with- options that the Bash configure recognizes.

--with-afs

Define if you are using the Andrew File System from Transarc.

--with-bash-malloc

Use the Bash version of malloc in the directory lib/malloc. This is not the same malloc that appears in GNU libc, but an older version originally derived from the 4.2 BSD malloc. This malloc is very fast, but wastes some space on each allocation. This option is enabled by default. The NOTES file contains a list of systems for which this should be turned off, and configure disables this option automatically for a number of systems.

--with-curses

Use the curses library instead of the termcap library. This should be supplied if your system has an inadequate or incomplete termcap database.

--with-gnu-malloc

A synonym for --with-bash-malloc.

--with-installed-readline[=PREFIX]

Define this to make Bash link with a locally-installed version of Readline rather than the version in lib/readline. This works only with Readline 5.0 and later versions. If PREFIX is yes or not supplied, configure uses the values of the make variables includedir and libdir, which are subdirectories of prefix by default, to find the installed version of Readline if it is not in the standard system include and library directories. If PREFIX is no, Bash links with the version in lib/readline. If PREFIX is set to any other value, configure treats it as a directory pathname and looks for the installed version of Readline in subdirectories of that directory (include files in PREFIX/include and the library in PREFIX/lib).

--with-purify

Define this to use the Purify memory allocation checker from Rational Software.

--enable-minimal-config

This produces a shell with minimal features, close to the historical Bourne shell.

There are several --enable- options that alter how Bash is compiled and linked, rather than changing run-time features.

--enable-largefile

Enable support for large files if the operating system requires special compiler options to build programs which can access large files. This is enabled by default, if the operating system provides large file support.

--enable-profiling

This builds a Bash binary that produces profiling information to be processed by gprof each time it is executed.

--enable-static-link

This causes Bash to be linked statically, if gcc is being used. This could be used to build a version to use as root’s shell.

The ‘minimal-config’ option can be used to disable all of the following options, but it is processed first, so individual options may be enabled using ‘enable-feature’.

All of the following options except for ‘disabled-builtins’, ‘direxpand-default’, and ‘xpg-echo-default’ are enabled by default, unless the operating system does not provide the necessary support.

--enable-alias

Allow alias expansion and include the alias and unalias builtins (see Aliases).

--enable-arith-for-command

Include support for the alternate form of the for command that behaves like the C language for statement (see Looping Constructs).

--enable-array-variables

Include support for one-dimensional array shell variables (see Arrays).

--enable-bang-history

Include support for csh-like history substitution (see History Interaction).

--enable-brace-expansion

Include csh-like brace expansion ( b{a,b}cbac bbc ). See Brace Expansion, for a complete description.

--enable-casemod-attributes

Include support for case-modifying attributes in the declare builtin and assignment statements. Variables with the uppercase attribute, for example, will have their values converted to uppercase upon assignment.

--enable-casemod-expansion

Include support for case-modifying word expansions.

--enable-command-timing

Include support for recognizing time as a reserved word and for displaying timing statistics for the pipeline following time (see Pipelines). This allows pipelines as well as shell builtins and functions to be timed.

--enable-cond-command

Include support for the [[ conditional command. (see Conditional Constructs).

--enable-cond-regexp

Include support for matching POSIX regular expressions using the ‘=~’ binary operator in the [[ conditional command. (see Conditional Constructs).

--enable-coprocesses

Include support for coprocesses and the coproc reserved word (see Pipelines).

--enable-debugger

Include support for the bash debugger (distributed separately).

--enable-direxpand-default

Cause the direxpand shell option (see The Shopt Builtin) to be enabled by default when the shell starts. It is normally disabled by default.

--enable-directory-stack

Include support for a csh-like directory stack and the pushd, popd, and dirs builtins (see The Directory Stack).

--enable-disabled-builtins

Allow builtin commands to be invoked via ‘builtin xxx’ even after xxx has been disabled using ‘enable -n xxx’. See Bash Builtins, for details of the builtin and enable builtin commands.

--enable-dparen-arithmetic

Include support for the ((…)) command (see Conditional Constructs).

--enable-extended-glob

Include support for the extended pattern matching features described above under Pattern Matching.

--enable-extended-glob-default

Set the default value of the extglob shell option described above under The Shopt Builtin to be enabled.

--enable-function-import

Include support for importing function definitions exported by another instance of the shell from the environment. This option is enabled by default.

--enable-glob-asciirange-default

Set the default value of the globasciiranges shell option described above under The Shopt Builtin to be enabled. This controls the behavior of character ranges when used in pattern matching bracket expressions.

--enable-help-builtin

Include the help builtin, which displays help on shell builtins and variables (see Bash Builtins).

--enable-history

Include command history and the fc and history builtin commands (see Bash History Facilities).

--enable-job-control

This enables the job control features (see Job Control), if the operating system supports them.

--enable-multibyte

This enables support for multibyte characters if the operating system provides the necessary support.

--enable-net-redirections

This enables the special handling of filenames of the form /dev/tcp/host/port and /dev/udp/host/port when used in redirections (see Redirections).

--enable-process-substitution

This enables process substitution (see Process Substitution) if the operating system provides the necessary support.

--enable-progcomp

Enable the programmable completion facilities (see Programmable Completion). If Readline is not enabled, this option has no effect.

--enable-prompt-string-decoding

Turn on the interpretation of a number of backslash-escaped characters in the $PS1, $PS2, $PS3, and $PS4 prompt strings. See Controlling the Prompt, for a complete list of prompt string escape sequences.

--enable-readline

Include support for command-line editing and history with the Bash version of the Readline library (see Command Line Editing).

--enable-restricted

Include support for a restricted shell. If this is enabled, Bash, when called as rbash, enters a restricted mode. See The Restricted Shell, for a description of restricted mode.

--enable-select

Include the select compound command, which allows the generation of simple menus (see Conditional Constructs).

--enable-separate-helpfiles

Use external files for the documentation displayed by the help builtin instead of storing the text internally.

--enable-single-help-strings

Store the text displayed by the help builtin as a single string for each help topic. This aids in translating the text to different languages. You may need to disable this if your compiler cannot handle very long string literals.

--enable-strict-posix-default

Make Bash POSIX-conformant by default (see Bash POSIX Mode).

--enable-usg-echo-default

A synonym for --enable-xpg-echo-default.

--enable-xpg-echo-default

Make the echo builtin expand backslash-escaped characters by default, without requiring the -e option. This sets the default value of the xpg_echo shell option to on, which makes the Bash echo behave more like the version specified in the Single Unix Specification, version 3. See Bash Builtins, for a description of the escape sequences that echo recognizes.

The file config-top.h contains C Preprocessor ‘#define’ statements for options which are not settable from configure. Some of these are not meant to be changed; beware of the consequences if you do. Read the comments associated with each definition for more information about its effect.


Appendix A Reporting Bugs

Please report all bugs you find in Bash. But first, you should make sure that it really is a bug, and that it appears in the latest version of Bash. The latest version of Bash is always available for FTP from ftp://ftp.gnu.org/pub/gnu/bash/.

Once you have determined that a bug actually exists, use the bashbug command to submit a bug report. If you have a fix, you are encouraged to mail that as well! Suggestions and ‘philosophical’ bug reports may be mailed to bug-bash@gnu.org or posted to the Usenet newsgroup gnu.bash.bug.

All bug reports should include:

  • The version number of Bash.
  • The hardware and operating system.
  • The compiler used to compile Bash.
  • A description of the bug behaviour.
  • A short script or ‘recipe’ which exercises the bug and may be used to reproduce it.

bashbug inserts the first three items automatically into the template it provides for filing a bug report.

Please send all reports concerning this manual to bug-bash@gnu.org.


Appendix B Major Differences From The Bourne Shell

Bash implements essentially the same grammar, parameter and variable expansion, redirection, and quoting as the Bourne Shell. Bash uses the POSIX standard as the specification of how these features are to be implemented. There are some differences between the traditional Bourne shell and Bash; this section quickly details the differences of significance. A number of these differences are explained in greater depth in previous sections. This section uses the version of sh included in SVR4.2 (the last version of the historical Bourne shell) as the baseline reference.

  • Bash is POSIX-conformant, even where the POSIX specification differs from traditional sh behavior (see Bash POSIX Mode).
  • Bash has multi-character invocation options (see Invoking Bash).
  • Bash has command-line editing (see Command Line Editing) and the bind builtin.
  • Bash provides a programmable word completion mechanism (see Programmable Completion), and builtin commands complete, compgen, and compopt, to manipulate it.
  • Bash has command history (see Bash History Facilities) and the history and fc builtins to manipulate it. The Bash history list maintains timestamp information and uses the value of the HISTTIMEFORMAT variable to display it.
  • Bash implements csh-like history expansion (see History Interaction).
  • Bash has one-dimensional array variables (see Arrays), and the appropriate variable expansions and assignment syntax to use them. Several of the Bash builtins take options to act on arrays. Bash provides a number of built-in array variables.
  • The $'…' quoting syntax, which expands ANSI-C backslash-escaped characters in the text between the single quotes, is supported (see ANSI-C Quoting).
  • Bash supports the $"…" quoting syntax to do locale-specific translation of the characters between the double quotes. The -D, --dump-strings, and --dump-po-strings invocation options list the translatable strings found in a script (see Locale Translation).
  • Bash implements the ! keyword to negate the return value of a pipeline (see Pipelines). Very useful when an if statement needs to act only if a test fails. The Bash ‘-o pipefail’ option to set will cause a pipeline to return a failure status if any command fails.
  • Bash has the time reserved word and command timing (see Pipelines). The display of the timing statistics may be controlled with the TIMEFORMAT variable.
  • Bash implements the for (( expr1 ; expr2 ; expr3 )) arithmetic for command, similar to the C language (see Looping Constructs).
  • Bash includes the select compound command, which allows the generation of simple menus (see Conditional Constructs).
  • Bash includes the [[ compound command, which makes conditional testing part of the shell grammar (see Conditional Constructs), including optional regular expression matching.
  • Bash provides optional case-insensitive matching for the case and [[ constructs.
  • Bash includes brace expansion (see Brace Expansion) and tilde expansion (see Tilde Expansion).
  • Bash implements command aliases and the alias and unalias builtins (see Aliases).
  • Bash provides shell arithmetic, the (( compound command (see Conditional Constructs), and arithmetic expansion (see Shell Arithmetic).
  • Variables present in the shell’s initial environment are automatically exported to child processes. The Bourne shell does not normally do this unless the variables are explicitly marked using the export command.
  • Bash supports the ‘+=’ assignment operator, which appends to the value of the variable named on the left hand side.
  • Bash includes the POSIX pattern removal ‘%’, ‘#’, ‘%%’ and ‘##’ expansions to remove leading or trailing substrings from variable values (see Shell Parameter Expansion).
  • The expansion ${#xx}, which returns the length of ${xx}, is supported (see Shell Parameter Expansion).
  • The expansion ${var:offset[:length]}, which expands to the substring of var’s value of length length, beginning at offset, is present (see Shell Parameter Expansion).
  • The expansion ${var/[/]pattern[/replacement]}, which matches pattern and replaces it with replacement in the value of var, is available (see Shell Parameter Expansion).
  • The expansion ${!prefix*} expansion, which expands to the names of all shell variables whose names begin with prefix, is available (see Shell Parameter Expansion).
  • Bash has indirect variable expansion using ${!word} (see Shell Parameter Expansion).
  • Bash can expand positional parameters beyond $9 using ${num}.
  • The POSIX $() form of command substitution is implemented (see Command Substitution), and preferred to the Bourne shell’s `` (which is also implemented for backwards compatibility).
  • Bash has process substitution (see Process Substitution).
  • Bash automatically assigns variables that provide information about the current user (UID, EUID, and GROUPS), the current host (HOSTTYPE, OSTYPE, MACHTYPE, and HOSTNAME), and the instance of Bash that is running (BASH, BASH_VERSION, and BASH_VERSINFO). See Bash Variables, for details.
  • The IFS variable is used to split only the results of expansion, not all words (see Word Splitting). This closes a longstanding shell security hole.
  • The filename expansion bracket expression code uses ‘!’ and ‘^’ to negate the set of characters between the brackets. The Bourne shell uses only ‘!’.
  • Bash implements the full set of POSIX filename expansion operators, including character classes, equivalence classes, and collating symbols (see Filename Expansion).
  • Bash implements extended pattern matching features when the extglob shell option is enabled (see Pattern Matching).
  • It is possible to have a variable and a function with the same name; sh does not separate the two name spaces.
  • Bash functions are permitted to have local variables using the local builtin, and thus useful recursive functions may be written (see Bash Builtins).
  • Variable assignments preceding commands affect only that command, even builtins and functions (see Environment). In sh, all variable assignments preceding commands are global unless the command is executed from the file system.
  • Bash performs filename expansion on filenames specified as operands to input and output redirection operators (see Redirections).
  • Bash contains the ‘<>’ redirection operator, allowing a file to be opened for both reading and writing, and the ‘&>’ redirection operator, for directing standard output and standard error to the same file (see Redirections).
  • Bash includes the ‘<<<’ redirection operator, allowing a string to be used as the standard input to a command.
  • Bash implements the ‘[n]<&word’ and ‘[n]>&word’ redirection operators, which move one file descriptor to another.
  • Bash treats a number of filenames specially when they are used in redirection operators (see Redirections).
  • Bash can open network connections to arbitrary machines and services with the redirection operators (see Redirections).
  • The noclobber option is available to avoid overwriting existing files with output redirection (see The Set Builtin). The ‘>|’ redirection operator may be used to override noclobber.
  • The Bash cd and pwd builtins (see Bourne Shell Builtins) each take -L and -P options to switch between logical and physical modes.
  • Bash allows a function to override a builtin with the same name, and provides access to that builtin’s functionality within the function via the builtin and command builtins (see Bash Builtins).
  • The command builtin allows selective disabling of functions when command lookup is performed (see Bash Builtins).
  • Individual builtins may be enabled or disabled using the enable builtin (see Bash Builtins).
  • The Bash exec builtin takes additional options that allow users to control the contents of the environment passed to the executed command, and what the zeroth argument to the command is to be (see Bourne Shell Builtins).
  • Shell functions may be exported to children via the environment using export -f (see Shell Functions).
  • The Bash export, readonly, and declare builtins can take a -f option to act on shell functions, a -p option to display variables with various attributes set in a format that can be used as shell input, a -n option to remove various variable attributes, and ‘name=value’ arguments to set variable attributes and values simultaneously.
  • The Bash hash builtin allows a name to be associated with an arbitrary filename, even when that filename cannot be found by searching the $PATH, using ‘hash -p’ (see Bourne Shell Builtins).
  • Bash includes a help builtin for quick reference to shell facilities (see Bash Builtins).
  • The printf builtin is available to display formatted output (see Bash Builtins).
  • The Bash read builtin (see Bash Builtins) will read a line ending in ‘\’ with the -r option, and will use the REPLY variable as a default if no non-option arguments are supplied. The Bash read builtin also accepts a prompt string with the -p option and will use Readline to obtain the line when given the -e option. The read builtin also has additional options to control input: the -s option will turn off echoing of input characters as they are read, the -t option will allow read to time out if input does not arrive within a specified number of seconds, the -n option will allow reading only a specified number of characters rather than a full line, and the -d option will read until a particular character rather than newline.
  • The return builtin may be used to abort execution of scripts executed with the . or source builtins (see Bourne Shell Builtins).
  • Bash includes the shopt builtin, for finer control of shell optional capabilities (see The Shopt Builtin), and allows these options to be set and unset at shell invocation (see Invoking Bash).
  • Bash has much more optional behavior controllable with the set builtin (see The Set Builtin).
  • The ‘-x’ (xtrace) option displays commands other than simple commands when performing an execution trace (see The Set Builtin).
  • The test builtin (see Bourne Shell Builtins) is slightly different, as it implements the POSIX algorithm, which specifies the behavior based on the number of arguments.
  • Bash includes the caller builtin, which displays the context of any active subroutine call (a shell function or a script executed with the . or source builtins). This supports the bash debugger.
  • The trap builtin (see Bourne Shell Builtins) allows a DEBUG pseudo-signal specification, similar to EXIT. Commands specified with a DEBUG trap are executed before every simple command, for command, case command, select command, every arithmetic for command, and before the first command executes in a shell function. The DEBUG trap is not inherited by shell functions unless the function has been given the trace attribute or the functrace option has been enabled using the shopt builtin. The extdebug shell option has additional effects on the DEBUG trap.

    The trap builtin (see Bourne Shell Builtins) allows an ERR pseudo-signal specification, similar to EXIT and DEBUG. Commands specified with an ERR trap are executed after a simple command fails, with a few exceptions. The ERR trap is not inherited by shell functions unless the -o errtrace option to the set builtin is enabled.

    The trap builtin (see Bourne Shell Builtins) allows a RETURN pseudo-signal specification, similar to EXIT and DEBUG. Commands specified with an RETURN trap are executed before execution resumes after a shell function or a shell script executed with . or source returns. The RETURN trap is not inherited by shell functions unless the function has been given the trace attribute or the functrace option has been enabled using the shopt builtin.

  • The Bash type builtin is more extensive and gives more information about the names it finds (see Bash Builtins).
  • The Bash umask builtin permits a -p option to cause the output to be displayed in the form of a umask command that may be reused as input (see Bourne Shell Builtins).
  • Bash implements a csh-like directory stack, and provides the pushd, popd, and dirs builtins to manipulate it (see The Directory Stack). Bash also makes the directory stack visible as the value of the DIRSTACK shell variable.
  • Bash interprets special backslash-escaped characters in the prompt strings when interactive (see Controlling the Prompt).
  • The Bash restricted mode is more useful (see The Restricted Shell); the SVR4.2 shell restricted mode is too limited.
  • The disown builtin can remove a job from the internal shell job table (see Job Control Builtins) or suppress the sending of SIGHUP to a job when the shell exits as the result of a SIGHUP.
  • Bash includes a number of features to support a separate debugger for shell scripts.
  • The SVR4.2 shell has two privilege-related builtins (mldmode and priv) not present in Bash.
  • Bash does not have the stop or newgrp builtins.
  • Bash does not use the SHACCT variable or perform shell accounting.
  • The SVR4.2 sh uses a TIMEOUT variable like Bash uses TMOUT.

More features unique to Bash may be found in Bash Features.

B.1 Implementation Differences From The SVR4.2 Shell

Since Bash is a completely new implementation, it does not suffer from many of the limitations of the SVR4.2 shell. For instance:

  • Bash does not fork a subshell when redirecting into or out of a shell control structure such as an if or while statement.
  • Bash does not allow unbalanced quotes. The SVR4.2 shell will silently insert a needed closing quote at EOF under certain circumstances. This can be the cause of some hard-to-find errors.
  • The SVR4.2 shell uses a baroque memory management scheme based on trapping SIGSEGV. If the shell is started from a process with SIGSEGV blocked (e.g., by using the system() C library function call), it misbehaves badly.
  • In a questionable attempt at security, the SVR4.2 shell, when invoked without the -p option, will alter its real and effective UID and GID if they are less than some magic threshold value, commonly 100. This can lead to unexpected results.
  • The SVR4.2 shell does not allow users to trap SIGSEGV, SIGALRM, or SIGCHLD.
  • The SVR4.2 shell does not allow the IFS, MAILCHECK, PATH, PS1, or PS2 variables to be unset.
  • The SVR4.2 shell treats ‘^’ as the undocumented equivalent of ‘|’.
  • Bash allows multiple option arguments when it is invoked (-x -v); the SVR4.2 shell allows only one option argument (-xv). In fact, some versions of the shell dump core if the second argument begins with a ‘-’.
  • The SVR4.2 shell exits a script if any builtin fails; Bash exits a script only if one of the POSIX special builtins fails, and only for certain failures, as enumerated in the POSIX standard.
  • The SVR4.2 shell behaves differently when invoked as jsh (it turns on job control).

Appendix C GNU Free Documentation License

Version 1.3, 3 November 2008
Copyright © 2000, 2001, 2002, 2007, 2008 Free Software Foundation, Inc.
http://fsf.org/

Everyone is permitted to copy and distribute verbatim copies
of this license document, but changing it is not allowed.
  1. PREAMBLE

    The purpose of this License is to make a manual, textbook, or other functional and useful document free in the sense of freedom: to assure everyone the effective freedom to copy and redistribute it, with or without modifying it, either commercially or noncommercially. Secondarily, this License preserves for the author and publisher a way to get credit for their work, while not being considered responsible for modifications made by others.

    This License is a kind of “copyleft”, which means that derivative works of the document must themselves be free in the same sense. It complements the GNU General Public License, which is a copyleft license designed for free software.

    We have designed this License in order to use it for manuals for free software, because free software needs free documentation: a free program should come with manuals providing the same freedoms that the software does. But this License is not limited to software manuals; it can be used for any textual work, regardless of subject matter or whether it is published as a printed book. We recommend this License principally for works whose purpose is instruction or reference.

  2. APPLICABILITY AND DEFINITIONS

    This License applies to any manual or other work, in any medium, that contains a notice placed by the copyright holder saying it can be distributed under the terms of this License. Such a notice grants a world-wide, royalty-free license, unlimited in duration, to use that work under the conditions stated herein. The “Document”, below, refers to any such manual or work. Any member of the public is a licensee, and is addressed as “you”. You accept the license if you copy, modify or distribute the work in a way requiring permission under copyright law.

    A “Modified Version” of the Document means any work containing the Document or a portion of it, either copied verbatim, or with modifications and/or translated into another language.

    A “Secondary Section” is a named appendix or a front-matter section of the Document that deals exclusively with the relationship of the publishers or authors of the Document to the Document’s overall subject (or to related matters) and contains nothing that could fall directly within that overall subject. (Thus, if the Document is in part a textbook of mathematics, a Secondary Section may not explain any mathematics.) The relationship could be a matter of historical connection with the subject or with related matters, or of legal, commercial, philosophical, ethical or political position regarding them.

    The “Invariant Sections” are certain Secondary Sections whose titles are designated, as being those of Invariant Sections, in the notice that says that the Document is released under this License. If a section does not fit the above definition of Secondary then it is not allowed to be designated as Invariant. The Document may contain zero Invariant Sections. If the Document does not identify any Invariant Sections then there are none.

    The “Cover Texts” are certain short passages of text that are listed, as Front-Cover Texts or Back-Cover Texts, in the notice that says that the Document is released under this License. A Front-Cover Text may be at most 5 words, and a Back-Cover Text may be at most 25 words.

    A “Transparent” copy of the Document means a machine-readable copy, represented in a format whose specification is available to the general public, that is suitable for revising the document straightforwardly with generic text editors or (for images composed of pixels) generic paint programs or (for drawings) some widely available drawing editor, and that is suitable for input to text formatters or for automatic translation to a variety of formats suitable for input to text formatters. A copy made in an otherwise Transparent file format whose markup, or absence of markup, has been arranged to thwart or discourage subsequent modification by readers is not Transparent. An image format is not Transparent if used for any substantial amount of text. A copy that is not “Transparent” is called “Opaque”.

    Examples of suitable formats for Transparent copies include plain ASCII without markup, Texinfo input format, LaTeX input format, SGML or XML using a publicly available DTD, and standard-conforming simple HTML, PostScript or PDF designed for human modification. Examples of transparent image formats include PNG, XCF and JPG. Opaque formats include proprietary formats that can be read and edited only by proprietary word processors, SGML or XML for which the DTD and/or processing tools are not generally available, and the machine-generated HTML, PostScript or PDF produced by some word processors for output purposes only.

    The “Title Page” means, for a printed book, the title page itself, plus such following pages as are needed to hold, legibly, the material this License requires to appear in the title page. For works in formats which do not have any title page as such, “Title Page” means the text near the most prominent appearance of the work’s title, preceding the beginning of the body of the text.

    The “publisher” means any person or entity that distributes copies of the Document to the public.

    A section “Entitled XYZ” means a named subunit of the Document whose title either is precisely XYZ or contains XYZ in parentheses following text that translates XYZ in another language. (Here XYZ stands for a specific section name mentioned below, such as “Acknowledgements”, “Dedications”, “Endorsements”, or “History”.) To “Preserve the Title” of such a section when you modify the Document means that it remains a section “Entitled XYZ” according to this definition.

    The Document may include Warranty Disclaimers next to the notice which states that this License applies to the Document. These Warranty Disclaimers are considered to be included by reference in this License, but only as regards disclaiming warranties: any other implication that these Warranty Disclaimers may have is void and has no effect on the meaning of this License.

  3. VERBATIM COPYING

    You may copy and distribute the Document in any medium, either commercially or noncommercially, provided that this License, the copyright notices, and the license notice saying this License applies to the Document are reproduced in all copies, and that you add no other conditions whatsoever to those of this License. You may not use technical measures to obstruct or control the reading or further copying of the copies you make or distribute. However, you may accept compensation in exchange for copies. If you distribute a large enough number of copies you must also follow the conditions in section 3.

    You may also lend copies, under the same conditions stated above, and you may publicly display copies.

  4. COPYING IN QUANTITY

    If you publish printed copies (or copies in media that commonly have printed covers) of the Document, numbering more than 100, and the Document’s license notice requires Cover Texts, you must enclose the copies in covers that carry, clearly and legibly, all these Cover Texts: Front-Cover Texts on the front cover, and Back-Cover Texts on the back cover. Both covers must also clearly and legibly identify you as the publisher of these copies. The front cover must present the full title with all words of the title equally prominent and visible. You may add other material on the covers in addition. Copying with changes limited to the covers, as long as they preserve the title of the Document and satisfy these conditions, can be treated as verbatim copying in other respects.

    If the required texts for either cover are too voluminous to fit legibly, you should put the first ones listed (as many as fit reasonably) on the actual cover, and continue the rest onto adjacent pages.

    If you publish or distribute Opaque copies of the Document numbering more than 100, you must either include a machine-readable Transparent copy along with each Opaque copy, or state in or with each Opaque copy a computer-network location from which the general network-using public has access to download using public-standard network protocols a complete Transparent copy of the Document, free of added material. If you use the latter option, you must take reasonably prudent steps, when you begin distribution of Opaque copies in quantity, to ensure that this Transparent copy will remain thus accessible at the stated location until at least one year after the last time you distribute an Opaque copy (directly or through your agents or retailers) of that edition to the public.

    It is requested, but not required, that you contact the authors of the Document well before redistributing any large number of copies, to give them a chance to provide you with an updated version of the Document.

  5. MODIFICATIONS

    You may copy and distribute a Modified Version of the Document under the conditions of sections 2 and 3 above, provided that you release the Modified Version under precisely this License, with the Modified Version filling the role of the Document, thus licensing distribution and modification of the Modified Version to whoever possesses a copy of it. In addition, you must do these things in the Modified Version:

    1. Use in the Title Page (and on the covers, if any) a title distinct from that of the Document, and from those of previous versions (which should, if there were any, be listed in the History section of the Document). You may use the same title as a previous version if the original publisher of that version gives permission.
    2. List on the Title Page, as authors, one or more persons or entities responsible for authorship of the modifications in the Modified Version, together with at least five of the principal authors of the Document (all of its principal authors, if it has fewer than five), unless they release you from this requirement.
    3. State on the Title page the name of the publisher of the Modified Version, as the publisher.
    4. Preserve all the copyright notices of the Document.
    5. Add an appropriate copyright notice for your modifications adjacent to the other copyright notices.
    6. Include, immediately after the copyright notices, a license notice giving the public permission to use the Modified Version under the terms of this License, in the form shown in the Addendum below.
    7. Preserve in that license notice the full lists of Invariant Sections and required Cover Texts given in the Document’s license notice.
    8. Include an unaltered copy of this License.
    9. Preserve the section Entitled “History”, Preserve its Title, and add to it an item stating at least the title, year, new authors, and publisher of the Modified Version as given on the Title Page. If there is no section Entitled “History” in the Document, create one stating the title, year, authors, and publisher of the Document as given on its Title Page, then add an item describing the Modified Version as stated in the previous sentence.
    10. Preserve the network location, if any, given in the Document for public access to a Transparent copy of the Document, and likewise the network locations given in the Document for previous versions it was based on. These may be placed in the “History” section. You may omit a network location for a work that was published at least four years before the Document itself, or if the original publisher of the version it refers to gives permission.
    11. For any section Entitled “Acknowledgements” or “Dedications”, Preserve the Title of the section, and preserve in the section all the substance and tone of each of the contributor acknowledgements and/or dedications given therein.
    12. Preserve all the Invariant Sections of the Document, unaltered in their text and in their titles. Section numbers or the equivalent are not considered part of the section titles.
    13. Delete any section Entitled “Endorsements”. Such a section may not be included in the Modified Version.
    14. Do not retitle any existing section to be Entitled “Endorsements” or to conflict in title with any Invariant Section.
    15. Preserve any Warranty Disclaimers.

    If the Modified Version includes new front-matter sections or appendices that qualify as Secondary Sections and contain no material copied from the Document, you may at your option designate some or all of these sections as invariant. To do this, add their titles to the list of Invariant Sections in the Modified Version’s license notice. These titles must be distinct from any other section titles.

    You may add a section Entitled “Endorsements”, provided it contains nothing but endorsements of your Modified Version by various parties—for example, statements of peer review or that the text has been approved by an organization as the authoritative definition of a standard.

    You may add a passage of up to five words as a Front-Cover Text, and a passage of up to 25 words as a Back-Cover Text, to the end of the list of Cover Texts in the Modified Version. Only one passage of Front-Cover Text and one of Back-Cover Text may be added by (or through arrangements made by) any one entity. If the Document already includes a cover text for the same cover, previously added by you or by arrangement made by the same entity you are acting on behalf of, you may not add another; but you may replace the old one, on explicit permission from the previous publisher that added the old one.

    The author(s) and publisher(s) of the Document do not by this License give permission to use their names for publicity for or to assert or imply endorsement of any Modified Version.

  6. COMBINING DOCUMENTS

    You may combine the Document with other documents released under this License, under the terms defined in section 4 above for modified versions, provided that you include in the combination all of the Invariant Sections of all of the original documents, unmodified, and list them all as Invariant Sections of your combined work in its license notice, and that you preserve all their Warranty Disclaimers.

    The combined work need only contain one copy of this License, and multiple identical Invariant Sections may be replaced with a single copy. If there are multiple Invariant Sections with the same name but different contents, make the title of each such section unique by adding at the end of it, in parentheses, the name of the original author or publisher of that section if known, or else a unique number. Make the same adjustment to the section titles in the list of Invariant Sections in the license notice of the combined work.

    In the combination, you must combine any sections Entitled “History” in the various original documents, forming one section Entitled “History”; likewise combine any sections Entitled “Acknowledgements”, and any sections Entitled “Dedications”. You must delete all sections Entitled “Endorsements.”

  7. COLLECTIONS OF DOCUMENTS

    You may make a collection consisting of the Document and other documents released under this License, and replace the individual copies of this License in the various documents with a single copy that is included in the collection, provided that you follow the rules of this License for verbatim copying of each of the documents in all other respects.

    You may extract a single document from such a collection, and distribute it individually under this License, provided you insert a copy of this License into the extracted document, and follow this License in all other respects regarding verbatim copying of that document.

  8. AGGREGATION WITH INDEPENDENT WORKS

    A compilation of the Document or its derivatives with other separate and independent documents or works, in or on a volume of a storage or distribution medium, is called an “aggregate” if the copyright resulting from the compilation is not used to limit the legal rights of the compilation’s users beyond what the individual works permit. When the Document is included in an aggregate, this License does not apply to the other works in the aggregate which are not themselves derivative works of the Document.

    If the Cover Text requirement of section 3 is applicable to these copies of the Document, then if the Document is less than one half of the entire aggregate, the Document’s Cover Texts may be placed on covers that bracket the Document within the aggregate, or the electronic equivalent of covers if the Document is in electronic form. Otherwise they must appear on printed covers that bracket the whole aggregate.

  9. TRANSLATION

    Translation is considered a kind of modification, so you may distribute translations of the Document under the terms of section 4. Replacing Invariant Sections with translations requires special permission from their copyright holders, but you may include translations of some or all Invariant Sections in addition to the original versions of these Invariant Sections. You may include a translation of this License, and all the license notices in the Document, and any Warranty Disclaimers, provided that you also include the original English version of this License and the original versions of those notices and disclaimers. In case of a disagreement between the translation and the original version of this License or a notice or disclaimer, the original version will prevail.

    If a section in the Document is Entitled “Acknowledgements”, “Dedications”, or “History”, the requirement (section 4) to Preserve its Title (section 1) will typically require changing the actual title.

  10. TERMINATION

    You may not copy, modify, sublicense, or distribute the Document except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense, or distribute it is void, and will automatically terminate your rights under this License.

    However, if you cease all violation of this License, then your license from a particular copyright holder is reinstated (a) provisionally, unless and until the copyright holder explicitly and finally terminates your license, and (b) permanently, if the copyright holder fails to notify you of the violation by some reasonable means prior to 60 days after the cessation.

    Moreover, your license from a particular copyright holder is reinstated permanently if the copyright holder notifies you of the violation by some reasonable means, this is the first time you have received notice of violation of this License (for any work) from that copyright holder, and you cure the violation prior to 30 days after your receipt of the notice.

    Termination of your rights under this section does not terminate the licenses of parties who have received copies or rights from you under this License. If your rights have been terminated and not permanently reinstated, receipt of a copy of some or all of the same material does not give you any rights to use it.

  11. FUTURE REVISIONS OF THIS LICENSE

    The Free Software Foundation may publish new, revised versions of the GNU Free Documentation License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. See http://www.gnu.org/copyleft/.

    Each version of the License is given a distinguishing version number. If the Document specifies that a particular numbered version of this License “or any later version” applies to it, you have the option of following the terms and conditions either of that specified version or of any later version that has been published (not as a draft) by the Free Software Foundation. If the Document does not specify a version number of this License, you may choose any version ever published (not as a draft) by the Free Software Foundation. If the Document specifies that a proxy can decide which future versions of this License can be used, that proxy’s public statement of acceptance of a version permanently authorizes you to choose that version for the Document.

  12. RELICENSING

    “Massive Multiauthor Collaboration Site” (or “MMC Site”) means any World Wide Web server that publishes copyrightable works and also provides prominent facilities for anybody to edit those works. A public wiki that anybody can edit is an example of such a server. A “Massive Multiauthor Collaboration” (or “MMC”) contained in the site means any set of copyrightable works thus published on the MMC site.

    “CC-BY-SA” means the Creative Commons Attribution-Share Alike 3.0 license published by Creative Commons Corporation, a not-for-profit corporation with a principal place of business in San Francisco, California, as well as future copyleft versions of that license published by that same organization.

    “Incorporate” means to publish or republish a Document, in whole or in part, as part of another Document.

    An MMC is “eligible for relicensing” if it is licensed under this License, and if all works that were first published under this License somewhere other than this MMC, and subsequently incorporated in whole or in part into the MMC, (1) had no cover texts or invariant sections, and (2) were thus incorporated prior to November 1, 2008.

    The operator of an MMC Site may republish an MMC contained in the site under CC-BY-SA on the same site at any time before August 1, 2009, provided the MMC is eligible for relicensing.

ADDENDUM: How to use this License for your documents

To use this License in a document you have written, include a copy of the License in the document and put the following copyright and license notices just after the title page:

  Copyright (C)  year  your name.
  Permission is granted to copy, distribute and/or modify this document
  under the terms of the GNU Free Documentation License, Version 1.3
  or any later version published by the Free Software Foundation;
  with no Invariant Sections, no Front-Cover Texts, and no Back-Cover
  Texts.  A copy of the license is included in the section entitled ``GNU
  Free Documentation License''.

If you have Invariant Sections, Front-Cover Texts and Back-Cover Texts, replace the “with…Texts.” line with this:

    with the Invariant Sections being list their titles, with
    the Front-Cover Texts being list, and with the Back-Cover Texts
    being list.

If you have Invariant Sections without Cover Texts, or some other combination of the three, merge those two alternatives to suit the situation.

If your document contains nontrivial examples of program code, we recommend releasing these examples in parallel under your choice of free software license, such as the GNU General Public License, to permit their use in free software.


Appendix D Indexes


D.1 Index of Shell Builtin Commands

Jump to:   .   :   [  
A   B   C   D   E   F   G   H   J   K   L   M   P   R   S   T   U   W  
Index Entry  Section

.
.: Bourne Shell Builtins

:
:: Bourne Shell Builtins

[
[: Bourne Shell Builtins

A
alias: Bash Builtins

B
bg: Job Control Builtins
bind: Bash Builtins
break: Bourne Shell Builtins
builtin: Bash Builtins

C
caller: Bash Builtins
cd: Bourne Shell Builtins
command: Bash Builtins
compgen: Programmable Completion Builtins
complete: Programmable Completion Builtins
compopt: Programmable Completion Builtins
continue: Bourne Shell Builtins

D
declare: Bash Builtins
dirs: Directory Stack Builtins
disown: Job Control Builtins

E
echo: Bash Builtins
enable: Bash Builtins
eval: Bourne Shell Builtins
exec: Bourne Shell Builtins
exit: Bourne Shell Builtins
export: Bourne Shell Builtins

F
fc: Bash History Builtins
fg: Job Control Builtins

G
getopts: Bourne Shell Builtins

H
hash: Bourne Shell Builtins
help: Bash Builtins
history: Bash History Builtins

J
jobs: Job Control Builtins

K
kill: Job Control Builtins

L
let: Bash Builtins
local: Bash Builtins
logout: Bash Builtins

M
mapfile: Bash Builtins

P
popd: Directory Stack Builtins
printf: Bash Builtins
pushd: Directory Stack Builtins
pwd: Bourne Shell Builtins

R
read: Bash Builtins
readarray: Bash Builtins
readonly: Bourne Shell Builtins
return: Bourne Shell Builtins

S
set: The Set Builtin
shift: Bourne Shell Builtins
shopt: The Shopt Builtin
source: Bash Builtins
suspend: Job Control Builtins

T
test: Bourne Shell Builtins
times: Bourne Shell Builtins
trap: Bourne Shell Builtins
type: Bash Builtins
typeset: Bash Builtins

U
ulimit: Bash Builtins
umask: Bourne Shell Builtins
unalias: Bash Builtins
unset: Bourne Shell Builtins

W
wait: Job Control Builtins

Jump to:   .   :   [  
A   B   C   D   E   F   G   H   J   K   L   M   P   R   S   T   U   W  

Next: , Previous: , Up: Indexes   [Contents][Index]

D.2 Index of Shell Reserved Words

Jump to:   !   [   ]   {   }  
C   D   E   F   I   S   T   U   W  
Index Entry  Section

!
!: Pipelines

[
[[: Conditional Constructs

]
]]: Conditional Constructs

{
{: Command Grouping

}
}: Command Grouping

C
case: Conditional Constructs

D
do: Looping Constructs
done: Looping Constructs

E
elif: Conditional Constructs
else: Conditional Constructs
esac: Conditional Constructs

F
fi: Conditional Constructs
for: Looping Constructs
function: Shell Functions

I
if: Conditional Constructs
in: Conditional Constructs

S
select: Conditional Constructs

T
then: Conditional Constructs
time: Pipelines

U
until: Looping Constructs

W
while: Looping Constructs

Jump to:   !   [   ]   {   }  
C   D   E   F   I   S   T   U   W  

D.3 Parameter and Variable Index

Jump to:   !   #   $   *   -   0   ?   @   _  
A   B   C   D   E   F   G   H   I   K   L   M   O   P   R   S   T   U   V  
Index Entry  Section

!
!: Special Parameters

#
#: Special Parameters

$
$: Special Parameters
$!: Special Parameters
$#: Special Parameters
$$: Special Parameters
$*: Special Parameters
$-: Special Parameters
$0: Special Parameters
$?: Special Parameters
$@: Special Parameters
$_: Special Parameters

*
*: Special Parameters

-
-: Special Parameters

0
0: Special Parameters

?
?: Special Parameters

@
@: Special Parameters

_
_: Special Parameters

A
auto_resume: Job Control Variables

B
BASH: Bash Variables
BASHOPTS: Bash Variables
BASHPID: Bash Variables
BASH_ALIASES: Bash Variables
BASH_ARGC: Bash Variables
BASH_ARGV: Bash Variables
BASH_CMDS: Bash Variables
BASH_COMMAND: Bash Variables
BASH_COMPAT: Bash Variables
BASH_ENV: Bash Variables
BASH_EXECUTION_STRING: Bash Variables
BASH_LINENO: Bash Variables
BASH_LOADABLES_PATH: Bash Variables
BASH_REMATCH: Bash Variables
BASH_SOURCE: Bash Variables
BASH_SUBSHELL: Bash Variables
BASH_VERSINFO: Bash Variables
BASH_VERSION: Bash Variables
BASH_XTRACEFD: Bash Variables
bell-style: Readline Init File Syntax
bind-tty-special-chars: Readline Init File Syntax
blink-matching-paren: Readline Init File Syntax

C
CDPATH: Bourne Shell Variables
CHILD_MAX: Bash Variables
colored-completion-prefix: Readline Init File Syntax
colored-stats: Readline Init File Syntax
COLUMNS: Bash Variables
comment-begin: Readline Init File Syntax
completion-display-width: Readline Init File Syntax
completion-ignore-case: Readline Init File Syntax
completion-map-case: Readline Init File Syntax
completion-prefix-display-length: Readline Init File Syntax
completion-query-items: Readline Init File Syntax
COMPREPLY: Bash Variables
COMP_CWORD: Bash Variables
COMP_KEY: Bash Variables
COMP_LINE: Bash Variables
COMP_POINT: Bash Variables
COMP_TYPE: Bash Variables
COMP_WORDBREAKS: Bash Variables
COMP_WORDS: Bash Variables
convert-meta: Readline Init File Syntax
COPROC: Bash Variables

D
DIRSTACK: Bash Variables
disable-completion: Readline Init File Syntax

E
echo-control-characters: Readline Init File Syntax
editing-mode: Readline Init File Syntax
EMACS: Bash Variables
emacs-mode-string: Readline Init File Syntax
enable-bracketed-paste: Readline Init File Syntax
enable-keypad: Readline Init File Syntax
ENV: Bash Variables
EUID: Bash Variables
EXECIGNORE: Bash Variables
expand-tilde: Readline Init File Syntax

F
FCEDIT: Bash Variables
FIGNORE: Bash Variables
FUNCNAME: Bash Variables
FUNCNEST: Bash Variables

G
GLOBIGNORE: Bash Variables
GROUPS: Bash Variables

H
histchars: Bash Variables
HISTCMD: Bash Variables
HISTCONTROL: Bash Variables
HISTFILE: Bash Variables
HISTFILESIZE: Bash Variables
HISTIGNORE: Bash Variables
history-preserve-point: Readline Init File Syntax
history-size: Readline Init File Syntax
HISTSIZE: Bash Variables
HISTTIMEFORMAT: Bash Variables
HOME: Bourne Shell Variables
horizontal-scroll-mode: Readline Init File Syntax
HOSTFILE: Bash Variables
HOSTNAME: Bash Variables
HOSTTYPE: Bash Variables

I
IFS: Bourne Shell Variables
IGNOREEOF: Bash Variables
input-meta: Readline Init File Syntax
INPUTRC: Bash Variables
isearch-terminators: Readline Init File Syntax

K
keymap: Readline Init File Syntax

L
LANG: Bash Variables
LC_ALL: Bash Variables
LC_COLLATE: Bash Variables
LC_CTYPE: Bash Variables
LC_MESSAGES: Locale Translation
LC_MESSAGES: Bash Variables
LC_NUMERIC: Bash Variables
LC_TIME: Bash Variables
LINENO: Bash Variables
LINES: Bash Variables

M
MACHTYPE: Bash Variables
MAIL: Bourne Shell Variables
MAILCHECK: Bash Variables
MAILPATH: Bourne Shell Variables
MAPFILE: Bash Variables
mark-modified-lines: Readline Init File Syntax
mark-symlinked-directories: Readline Init File Syntax
match-hidden-files: Readline Init File Syntax
menu-complete-display-prefix: Readline Init File Syntax
meta-flag: Readline Init File Syntax

O
OLDPWD: Bash Variables
OPTARG: Bourne Shell Variables
OPTERR: Bash Variables
OPTIND: Bourne Shell Variables
OSTYPE: Bash Variables
output-meta: Readline Init File Syntax

P
page-completions: Readline Init File Syntax
PATH: Bourne Shell Variables
PIPESTATUS: Bash Variables
POSIXLY_CORRECT: Bash Variables
PPID: Bash Variables
PROMPT_COMMAND: Bash Variables
PROMPT_DIRTRIM: Bash Variables
PS0: Bash Variables
PS1: Bourne Shell Variables
PS2: Bourne Shell Variables
PS3: Bash Variables
PS4: Bash Variables
PWD: Bash Variables

R
RANDOM: Bash Variables
READLINE_LINE: Bash Variables
READLINE_POINT: Bash Variables
REPLY: Bash Variables
revert-all-at-newline: Readline Init File Syntax

S
SECONDS: Bash Variables
SHELL: Bash Variables
SHELLOPTS: Bash Variables
SHLVL: Bash Variables
show-all-if-ambiguous: Readline Init File Syntax
show-all-if-unmodified: Readline Init File Syntax
show-mode-in-prompt: Readline Init File Syntax
skip-completed-text: Readline Init File Syntax

T
TEXTDOMAIN: Locale Translation
TEXTDOMAINDIR: Locale Translation
TIMEFORMAT: Bash Variables
TMOUT: Bash Variables
TMPDIR: Bash Variables

U
UID: Bash Variables

V
vi-cmd-mode-string: Readline Init File Syntax
vi-ins-mode-string: Readline Init File Syntax
visible-stats: Readline Init File Syntax

Jump to:   !   #   $   *   -   0   ?   @   _  
A   B   C   D   E   F   G   H   I   K   L   M   O   P   R   S   T   U   V  

Next: , Previous: , Up: Indexes   [Contents][Index]

D.4 Function Index

Jump to:   A   B   C   D   E   F   G   H   I   K   M   N   O   P   Q   R   S   T   U   Y  
Index Entry  Section

A
abort (C-g): Miscellaneous Commands
accept-line (Newline or Return): Commands For History
alias-expand-line (): Miscellaneous Commands

B
backward-char (C-b): Commands For Moving
backward-delete-char (Rubout): Commands For Text
backward-kill-line (C-x Rubout): Commands For Killing
backward-kill-word (M-DEL): Commands For Killing
backward-word (M-b): Commands For Moving
beginning-of-history (M-<): Commands For History
beginning-of-line (C-a): Commands For Moving
bracketed-paste-begin (): Commands For Text

C
call-last-kbd-macro (C-x e): Keyboard Macros
capitalize-word (M-c): Commands For Text
character-search (C-]): Miscellaneous Commands
character-search-backward (M-C-]): Miscellaneous Commands
clear-screen (C-l): Commands For Moving
complete (TAB): Commands For Completion
complete-command (M-!): Commands For Completion
complete-filename (M-/): Commands For Completion
complete-hostname (M-@): Commands For Completion
complete-into-braces (M-{): Commands For Completion
complete-username (M-~): Commands For Completion
complete-variable (M-$): Commands For Completion
copy-backward-word (): Commands For Killing
copy-forward-word (): Commands For Killing
copy-region-as-kill (): Commands For Killing

D
dabbrev-expand (): Commands For Completion
delete-char (C-d): Commands For Text
delete-char-or-list (): Commands For Completion
delete-horizontal-space (): Commands For Killing
digit-argument (M-0, M-1, … M--): Numeric Arguments
display-shell-version (C-x C-v): Miscellaneous Commands
do-uppercase-version (M-a, M-b, M-x, …): Miscellaneous Commands
downcase-word (M-l): Commands For Text
dump-functions (): Miscellaneous Commands
dump-macros (): Miscellaneous Commands
dump-variables (): Miscellaneous Commands
dynamic-complete-history (M-TAB): Commands For Completion

E
edit-and-execute-command (C-xC-e): Miscellaneous Commands
end-kbd-macro (C-x )): Keyboard Macros
end-of-file (usually C-d): Commands For Text
end-of-history (M->): Commands For History
end-of-line (C-e): Commands For Moving
exchange-point-and-mark (C-x C-x): Miscellaneous Commands

F
forward-backward-delete-char (): Commands For Text
forward-char (C-f): Commands For Moving
forward-search-history (C-s): Commands For History
forward-word (M-f): Commands For Moving

G
glob-complete-word (M-g): Miscellaneous Commands
glob-expand-word (C-x *): Miscellaneous Commands
glob-list-expansions (C-x g): Miscellaneous Commands

H
history-and-alias-expand-line (): Miscellaneous Commands
history-expand-line (M-^): Miscellaneous Commands
history-search-backward (): Commands For History
history-search-forward (): Commands For History
history-substr-search-backward (): Commands For History
history-substr-search-forward (): Commands For History

I
insert-comment (M-#): Miscellaneous Commands
insert-completions (M-*): Commands For Completion
insert-last-argument (M-. or M-_): Miscellaneous Commands

K
kill-line (C-k): Commands For Killing
kill-region (): Commands For Killing
kill-whole-line (): Commands For Killing
kill-word (M-d): Commands For Killing

M
magic-space (): Miscellaneous Commands
menu-complete (): Commands For Completion
menu-complete-backward (): Commands For Completion

N
next-history (C-n): Commands For History
non-incremental-forward-search-history (M-n): Commands For History
non-incremental-reverse-search-history (M-p): Commands For History

O
operate-and-get-next (C-o): Miscellaneous Commands
overwrite-mode (): Commands For Text

P
possible-command-completions (C-x !): Commands For Completion
possible-completions (M-?): Commands For Completion
possible-filename-completions (C-x /): Commands For Completion
possible-hostname-completions (C-x @): Commands For Completion
possible-username-completions (C-x ~): Commands For Completion
possible-variable-completions (C-x $): Commands For Completion
prefix-meta (ESC): Miscellaneous Commands
previous-history (C-p): Commands For History
print-last-kbd-macro (): Keyboard Macros

Q
quoted-insert (C-q or C-v): Commands For Text

R
re-read-init-file (C-x C-r): Miscellaneous Commands
redraw-current-line (): Commands For Moving
reverse-search-history (C-r): Commands For History
revert-line (M-r): Miscellaneous Commands

S
self-insert (a, b, A, 1, !, …): Commands For Text
set-mark (C-@): Miscellaneous Commands
shell-backward-kill-word (): Commands For Killing
shell-backward-word (): Commands For Moving
shell-expand-line (M-C-e): Miscellaneous Commands
shell-forward-word (): Commands For Moving
shell-kill-word (): Commands For Killing
skip-csi-sequence (): Miscellaneous Commands
start-kbd-macro (C-x (): Keyboard Macros

T
tilde-expand (M-&): Miscellaneous Commands
transpose-chars (C-t): Commands For Text
transpose-words (M-t): Commands For Text

U
undo (C-_ or C-x C-u): Miscellaneous Commands
universal-argument (): Numeric Arguments
unix-filename-rubout (): Commands For Killing
unix-line-discard (C-u): Commands For Killing
unix-word-rubout (C-w): Commands For Killing
upcase-word (M-u): Commands For Text

Y
yank (C-y): Commands For Killing
yank-last-arg (M-. or M-_): Commands For History
yank-nth-arg (M-C-y): Commands For History
yank-pop (M-y): Commands For Killing

Jump to:   A   B   C   D   E   F   G   H   I   K   M   N   O   P   Q   R   S   T   U   Y  

Previous: , Up: Indexes   [Contents][Index]

D.5 Concept Index

Jump to:   A   B   C   D   E   F   H   I   J   K   L   M   N   O   P   Q   R   S   T   V   W   Y  
Index Entry  Section

A
alias expansion: Aliases
arithmetic evaluation: Shell Arithmetic
arithmetic expansion: Arithmetic Expansion
arithmetic, shell: Shell Arithmetic
arrays: Arrays

B
background: Job Control Basics
Bash configuration: Basic Installation
Bash installation: Basic Installation
Bourne shell: Basic Shell Features
brace expansion: Brace Expansion
builtin: Definitions

C
command editing: Readline Bare Essentials
command execution: Command Search and Execution
command expansion: Simple Command Expansion
command history: Bash History Facilities
command search: Command Search and Execution
command substitution: Command Substitution
command timing: Pipelines
commands, compound: Compound Commands
commands, conditional: Conditional Constructs
commands, grouping: Command Grouping
commands, lists: Lists
commands, looping: Looping Constructs
commands, pipelines: Pipelines
commands, shell: Shell Commands
commands, simple: Simple Commands
comments, shell: Comments
completion builtins: Programmable Completion Builtins
configuration: Basic Installation
control operator: Definitions
coprocess: Coprocesses

D
directory stack: The Directory Stack

E
editing command lines: Readline Bare Essentials
environment: Environment
evaluation, arithmetic: Shell Arithmetic
event designators: Event Designators
execution environment: Command Execution Environment
exit status: Definitions
exit status: Exit Status
expansion: Shell Expansions
expansion, arithmetic: Arithmetic Expansion
expansion, brace: Brace Expansion
expansion, filename: Filename Expansion
expansion, parameter: Shell Parameter Expansion
expansion, pathname: Filename Expansion
expansion, tilde: Tilde Expansion
expressions, arithmetic: Shell Arithmetic
expressions, conditional: Bash Conditional Expressions

F
field: Definitions
filename: Definitions
filename expansion: Filename Expansion
foreground: Job Control Basics
functions, shell: Shell Functions

H
history builtins: Bash History Builtins
history events: Event Designators
history expansion: History Interaction
history list: Bash History Facilities
History, how to use: A Programmable Completion Example

I
identifier: Definitions
initialization file, readline: Readline Init File
installation: Basic Installation
interaction, readline: Readline Interaction
interactive shell: Invoking Bash
interactive shell: Interactive Shells
internationalization: Locale Translation

J
job: Definitions
job control: Definitions
job control: Job Control Basics

K
kill ring: Readline Killing Commands
killing text: Readline Killing Commands

L
localization: Locale Translation
login shell: Invoking Bash

M
matching, pattern: Pattern Matching
metacharacter: Definitions

N
name: Definitions
native languages: Locale Translation
notation, readline: Readline Bare Essentials

O
operator, shell: Definitions

P
parameter expansion: Shell Parameter Expansion
parameters: Shell Parameters
parameters, positional: Positional Parameters
parameters, special: Special Parameters
pathname expansion: Filename Expansion
pattern matching: Pattern Matching
pipeline: Pipelines
POSIX: Definitions
POSIX Mode: Bash POSIX Mode
process group: Definitions
process group ID: Definitions
process substitution: Process Substitution
programmable completion: Programmable Completion
prompting: Controlling the Prompt

Q
quoting: Quoting
quoting, ANSI: ANSI-C Quoting

R
Readline, how to use: Job Control Variables
redirection: Redirections
reserved word: Definitions
restricted shell: The Restricted Shell
return status: Definitions

S
shell arithmetic: Shell Arithmetic
shell function: Shell Functions
shell script: Shell Scripts
shell variable: Shell Parameters
shell, interactive: Interactive Shells
signal: Definitions
signal handling: Signals
special builtin: Definitions
special builtin: Special Builtins
startup files: Bash Startup Files
suspending jobs: Job Control Basics

T
tilde expansion: Tilde Expansion
token: Definitions
translation, native languages: Locale Translation

V
variable, shell: Shell Parameters
variables, readline: Readline Init File Syntax

W
word: Definitions
word splitting: Word Splitting

Y
yanking text: Readline Killing Commands

Jump to:   A   B   C   D   E   F   H   I   J   K   L   M   N   O   P   Q   R   S   T   V   W   Y  

README000064400000002074152530212110005417 0ustar00This directory contains the bash documentation. FAQ - a set of frequently-asked questions about Bash with answers INTRO - a short introduction to bash article.ms - an article I wrote about bash for The Linux Journal bash.1 - the bash man page builtins.1 - a man page that documents the builtins, extracted from bash.1 bashref.texi - the `bash reference manual' bashref.info - the `bash reference manual' processed by `makeinfo' readline.3 - the readline man page The `.ps' files are postscript versions of the above. The `.html' files are HTML versions of the man page and reference manual. The `.0' files are formatted manual pages. The `.txt' versions are ascii -- the output of `groff -Tascii'. The rest of this file explains how to use the `builtins.1' man page. For each command in the list of builtins create a file in man/man1 called: ${command}.1 eg. for.1 type.1 alias.1 etc. All these files are identical as follows: jaws@jaws(264)$ cat alias.1 .so man1/builtins.1 jaws@jaws(265)$ Make sure you adjust the .so line in builtins.1 to reflect where you put it. INTRO000064400000015640152530212110005360 0ustar00 BASH - The Bourne-Again Shell Bash is the shell, or command language interpreter, that will appear in the GNU operating system. Bash is an sh-compatible shell that incorporates useful features from the Korn shell (ksh) and C shell (csh). It is intended to conform to the IEEE POSIX P1003.2/ISO 9945.2 Shell and Tools standard. It offers functional improvements over sh for both programming and interactive use. In addition, most sh scripts can be run by Bash without modification. Bash is quite portable. It uses a configuration system that discovers characteristics of the compilation platform at build time, and may therefore be built on nearly every version of UNIX. Ports to UNIX-like systems such as QNX and Minix and to non-UNIX systems such as OS/2, Windows 95, and Windows NT are available. Bash includes the following features: Editing and Completion Bash offers a command-line editing facility which permits users to edit command lines using familiar emacs or vi-style editing commands. Editing allows corrections to be made without having to erase back to the point of error or start the command line anew. The editing facilities include a feature that allows users to complete command and file names. The Bash line editing library is fully customizable. Users may define their own key bindings -- the action taken when a key is pressed. A number of variables to fine-tune editing behavior are also available. History and Command Re-entry The Bash history feature remembers commands entered to the shell and allows them to be recalled and re-executed. The history list may be of unlimited size. Bash allows users to search for previous commands and reuse portions of those commands when composing new ones. The history list may be saved across shell sessions. Bash allows users to control which commands are saved on the history list. Job Control On systems that support it, Bash provides an interface to the operating system's job control facilities, which allow processes to be suspended and restarted, and moved between the foreground and background. Bash allows users to selectively `forget' about background jobs. Shell Functions and Aliases These mechanisms are available to bind a user-selected identifier to a list of commands that will be executed when the identifier is used as a command name. Functions allow local variables and recursion, and have access to the environment of the calling shell. Aliases may be used to create a mnemonic for a command name, expand a single word to a complex command, or ensure that a command is called with a basic set of options. Arrays Bash-2.0 supports indexed arrays of unlimited size. The subscript for an array is an arithmetic expression. Arrays may be assigned to with a new compound assignment syntax, and several builtins have options to operate on array variables. Bash includes a number of built-in array variables. Arithmetic Bash allows users to perform integer arithmetic in any base from two to sixty-four. Nearly all of the C language arithmetic operators are available with the same syntax and precedence as in C. Arithmetic expansion allows an arithmetic expression to be evaluated and the result substituted into the command line. Shell variables can be used as operands, and the value of an expression may be assigned to a variable. An arithmetic expression may be used as a command; the exit status of the command is the value of the expression. ANSI-C Quoting There is a new quoting syntax that allows backslash-escaped characters in strings to be expanded according to the ANSI C standard. Tilde Expansion Users' home directories may be expanded using this feature. Words beginning with a tilde may also be expanded to the current or previous working directory. Brace Expansion Brace expansion is a convenient way to generate a list of strings that share a common prefix or suffix. Substring Capabilities Bash allows new strings to be created by removing leading or trailing substrings from existing variable values, or by specifying a starting offset and length. Portions of variable values may be matched against shell patterns and the matching portion removed or a new value substituted. Indirect Variable Expansion Bash makes it easy to find the value of a shell variable whose name is the value of another variable. Expanded I/O Capabilities Bash provides several input and output features not available in sh, including the ability to: o specify a file or file descriptor for both input and output o read from or write to asynchronous processes using named pipes o read lines ending in backslash o display a prompt on the terminal before a read o format menus and interpret responses to them o echo lines exactly as input without escape processing Control of Builtin Commands Bash implements several builtin commands to give users more control over which commands are executed. The enable builtin allows other builtin commands to be selectively enabled or disabled. The command and builtin builtins change the order in which the shell searches for commands. On systems that provide dynamic loading, new builtins may be loaded into a running shell from a shared object file. These new builtins have access to all of the shell facilities. Help Bash includes a built-in help facility. Shell Optional Behavior There is a great deal of customizable shell behavior. The shopt builtin command provides a unified interface that allows users to alter shell defaults. Prompt Customization Bash allows the primary and secondary prompts to be customized by interpreting a number of backslash-escaped special characters. Parameter and variable expansion is also performed on the values of the primary and secondary prompt strings before they are displayed. Security Bash provides a restricted shell environment. It is also possible to control the execution of setuid/setgid scripts. Directory Stack Bash provides a `directory stack', to which directories may be added and removed. The current directory may be changed to any directory in the stack. It is easy to toggle between two directories in the stack. The directory stack may be saved and restored across different shell invocations. POSIX Mode Bash is nearly completely conformant to POSIX.2. POSIX mode changes those few areas where the Bash default behavior differs from the standard to match the standard. In POSIX mode, Bash is POSIX.2 compliant. Internationalization Bash provides a new quoting syntax that allows strings to be translated according to the current locale. The locale in which the shell itself runs may also be changed, so that the shell messages themselves may be language-specific. The command-line editing facilities allow the input of eight-bit characters, so most of the ISO-8859 family of character sets are supported. Command Timing Bash allows external commands, shell builtin commands and shell functions to be timed. The format used to display the timing information may be changed by the user. RBASH000064400000003235152530212110005321 0ustar006.10 The Restricted Shell ========================= If Bash is started with the name 'rbash', or the '--restricted' or '-r' option is supplied at invocation, the shell becomes restricted. A restricted shell is used to set up an environment more controlled than the standard shell. A restricted shell behaves identically to 'bash' with the exception that the following are disallowed or not performed: * Changing directories with the 'cd' builtin. * Setting or unsetting the values of the 'SHELL', 'PATH', 'ENV', or 'BASH_ENV' variables. * Specifying command names containing slashes. * Specifying a filename containing a slash as an argument to the '.' builtin command. * Specifying a filename containing a slash as an argument to the '-p' option to the 'hash' builtin command. * Importing function definitions from the shell environment at startup. * Parsing the value of 'SHELLOPTS' from the shell environment at startup. * Redirecting output using the '>', '>|', '<>', '>&', '&>', and '>>' redirection operators. * Using the 'exec' builtin to replace the shell with another command. * Adding or deleting builtin commands with the '-f' and '-d' options to the 'enable' builtin. * Using the 'enable' builtin command to enable disabled shell builtins. * Specifying the '-p' option to the 'command' builtin. * Turning off restricted mode with 'set +r' or 'set +o restricted'. These restrictions are enforced after any startup files are read. When a command that is found to be a shell script is executed (*note Shell Scripts::), 'rbash' turns off any restrictions in the shell spawned to execute the script. FAQ000064400000303176152530212110005100 0ustar00This is the Bash FAQ, version 4.14, for Bash version 4.4. [THIS FAQ IS NO LONGER MAINTAINED] This document contains a set of frequently-asked questions concerning Bash, the GNU Bourne-Again Shell. Bash is a freely-available command interpreter with advanced features for both interactive use and shell programming. Another good source of basic information about shells is the collection of FAQ articles periodically posted to comp.unix.shell. Questions and comments concerning this document should be sent to chet.ramey@case.edu. This document is available for anonymous FTP with the URL ftp://ftp.cwru.edu/pub/bash/FAQ The Bash home page is http://cnswww.cns.cwru.edu/~chet/bash/bashtop.html ---------- Contents: Section A: The Basics A1) What is it? A2) What's the latest version? A3) Where can I get it? A4) On what machines will bash run? A5) Will bash run on operating systems other than Unix? A6) How can I build bash with gcc? A7) How can I make bash my login shell? A8) I just changed my login shell to bash, and now I can't FTP into my machine. Why not? A9) What's the `POSIX Shell and Utilities standard'? A10) What is the bash `posix mode'? Section B: The latest version B1) What's new in version 4.3? B2) Are there any user-visible incompatibilities between bash-4.3 and previous bash versions? Section C: Differences from other Unix shells C1) How does bash differ from sh, the Bourne shell? C2) How does bash differ from the Korn shell, version ksh88? C3) Which new features in ksh-93 are not in bash, and which are? Section D: Why does bash do some things differently than other Unix shells? D1) Why does bash run a different version of `command' than `which command' says it will? D2) Why doesn't bash treat brace expansions exactly like csh? D3) Why doesn't bash have csh variable modifiers? D4) How can I make my csh aliases work when I convert to bash? D5) How can I pipe standard output and standard error from one command to another, like csh does with `|&'? D6) Now that I've converted from ksh to bash, are there equivalents to ksh features like autoloaded functions and the `whence' command? Section E: Why does bash do certain things the way it does? E1) Why is the bash builtin `test' slightly different from /bin/test? E2) Why does bash sometimes say `Broken pipe'? E3) When I have terminal escape sequences in my prompt, why does bash wrap lines at the wrong column? E4) If I pipe the output of a command into `read variable', why doesn't the output show up in $variable when the read command finishes? E5) I have a bunch of shell scripts that use backslash-escaped characters in arguments to `echo'. Bash doesn't interpret these characters. Why not, and how can I make it understand them? E6) Why doesn't a while or for loop get suspended when I type ^Z? E7) What about empty for loops in Makefiles? E8) Why does the arithmetic evaluation code complain about `08'? E9) Why does the pattern matching expression [A-Z]* match files beginning with every letter except `z'? E10) Why does `cd //' leave $PWD as `//'? E11) If I resize my xterm while another program is running, why doesn't bash notice the change? E12) Why don't negative offsets in substring expansion work like I expect? E13) Why does filename completion misbehave if a colon appears in the filename? E14) Why does quoting the pattern argument to the regular expression matching conditional operator (=~) cause matching to stop working? E15) Tell me more about the shell compatibility level. Section F: Things to watch out for on certain Unix versions F1) Why can't I use command line editing in my `cmdtool'? F2) I built bash on Solaris 2. Why do globbing expansions and filename completion chop off the first few characters of each filename? F3) Why does bash dump core after I interrupt username completion or `~user' tilde expansion on a machine running NIS? F4) I'm running SVR4.2. Why is the line erased every time I type `@'? F5) Why does bash report syntax errors when my C News scripts use a redirection before a subshell command? F6) Why can't I use vi-mode editing on Red Hat Linux 6.1? F7) Why do bash-2.05a and bash-2.05b fail to compile `printf.def' on HP/UX 11.x? Section G: How can I get bash to do certain common things? G1) How can I get bash to read and display eight-bit characters? G2) How do I write a function `x' to replace builtin command `x', but still invoke the command from within the function? G3) How can I find the value of a shell variable whose name is the value of another shell variable? G4) How can I make the bash `time' reserved word print timing output that looks like the output from my system's /usr/bin/time? G5) How do I get the current directory into my prompt? G6) How can I rename "*.foo" to "*.bar"? G7) How can I translate a filename from uppercase to lowercase? G8) How can I write a filename expansion (globbing) pattern that will match all files in the current directory except "." and ".."? Section H: Where do I go from here? H1) How do I report bugs in bash, and where should I look for fixes and advice? H2) What kind of bash documentation is there? H3) What's coming in future versions? H4) What's on the bash `wish list'? H5) When will the next release appear? ---------- Section A: The Basics A1) What is it? Bash is a Unix command interpreter (shell). It is an implementation of the Posix 1003.2 shell standard, and resembles the Korn and System V shells. Bash contains a number of enhancements over those shells, both for interactive use and shell programming. Features geared toward interactive use include command line editing, command history, job control, aliases, and prompt expansion. Programming features include additional variable expansions, shell arithmetic, and a number of variables and options to control shell behavior. Bash was originally written by Brian Fox of the Free Software Foundation. The current developer and maintainer is Chet Ramey of Case Western Reserve University. A2) What's the latest version? The latest version is 4.3, first made available on 26 February, 2014. A3) Where can I get it? Bash is the GNU project's shell, and so is available from the master GNU archive site, ftp.gnu.org, and its mirrors. The latest version is also available for FTP from ftp.cwru.edu. The following URLs tell how to get version 4.3: ftp://ftp.gnu.org/pub/gnu/bash/bash-4.3.tar.gz ftp://ftp.cwru.edu/pub/bash/bash-4.3.tar.gz Formatted versions of the documentation are available with the URLs: ftp://ftp.gnu.org/pub/gnu/bash/bash-doc-4.3.tar.gz ftp://ftp.cwru.edu/pub/bash/bash-doc-4.3.tar.gz Any patches for the current version are available with the URL: ftp://ftp.cwru.edu/pub/bash/bash-4.3-patches/ A4) On what machines will bash run? Bash has been ported to nearly every version of Unix. All you should have to do to build it on a machine for which a port exists is to type `configure' and then `make'. The build process will attempt to discover the version of Unix you have and tailor itself accordingly, using a script created by GNU autoconf. More information appears in the file `INSTALL' in the distribution. The Bash web page (http://cnswww.cns.cwru.edu/~chet/bash/bashtop.html) explains how to obtain binary versions of bash for most of the major commercial Unix systems. A5) Will bash run on operating systems other than Unix? Configuration specifics for Unix-like systems such as QNX and LynxOS are included in the distribution. Bash-2.05 and later versions should compile and run on Minix 2.0 (patches were contributed), but I don't believe anyone has built bash-2.x on earlier Minix versions yet. Bash has been ported to versions of Windows implementing the Win32 programming interface. This includes Windows 95 and Windows NT. The port was done by Cygnus Solutions (now part of Red Hat) as part of their CYGWIN project. For more information about the project, see http://www.cygwin.com/. Cygnus originally ported bash-1.14.7, and that port was part of their early GNU-Win32 (the original name) releases. Cygnus has also done ports of bash-3.2 and bash-4.0 to the CYGWIN environment, and both are available as part of their current release. Bash-2.05b and later versions should require no local Cygnus changes to build and run under CYGWIN. DJ Delorie has a port of bash-2.x which runs under MS-DOS, as part of the DJGPP project. For more information on the project, see http://www.delorie.com/djgpp/ I have been told that the original DJGPP port was done by Daisuke Aoyama. Mark Elbrecht has sent me notice that bash-2.04 is available for DJGPP V2. The files are available as: ftp://ftp.simtel.net/pub/simtelnet/gnu/djgpp/v2gnu/bsh204b.zip binary ftp://ftp.simtel.net/pub/simtelnet/gnu/djgpp/v2gnu/bsh204d.zip documentation ftp://ftp.simtel.net/pub/simtelnet/gnu/djgpp/v2gnu/bsh204s.zip source Mark began to work with bash-2.05, but I don't know the current status. Bash-3.0 compiles and runs with no modifications under Microsoft's Services for Unix (SFU), once known as Interix. I do not anticipate any problems with building bash-4.2 and later, but will gladly accept any patches that are needed. A6) How can I build bash with gcc? Bash configures to use gcc by default if it is available. Read the file INSTALL in the distribution for more information. A7) How can I make bash my login shell? Some machines let you use `chsh' to change your login shell. Other systems use `passwd -s' or `passwd -e'. If one of these works for you, that's all you need. Note that many systems require the full pathname to a shell to appear in /etc/shells before you can make it your login shell. For this, you may need the assistance of your friendly local system administrator. If you cannot do this, you can still use bash as your login shell, but you need to perform some tricks. The basic idea is to add a command to your login shell's startup file to replace your login shell with bash. For example, if your login shell is csh or tcsh, and you have installed bash in /usr/gnu/bin/bash, add the following line to ~/.login: if ( -f /usr/gnu/bin/bash ) exec /usr/gnu/bin/bash --login (the `--login' tells bash that it is a login shell). It's not a good idea to put this command into ~/.cshrc, because every csh you run without the `-f' option, even ones started to run csh scripts, reads that file. If you must put the command in ~/.cshrc, use something like if ( $?prompt ) exec /usr/gnu/bin/bash --login to ensure that bash is exec'd only when the csh is interactive. If your login shell is sh or ksh, you have to do two things. First, create an empty file in your home directory named `.bash_profile'. The existence of this file will prevent the exec'd bash from trying to read ~/.profile, and re-execing itself over and over again. ~/.bash_profile is the first file bash tries to read initialization commands from when it is invoked as a login shell. Next, add a line similar to the above to ~/.profile: [ -f /usr/gnu/bin/bash ] && [ -x /usr/gnu/bin/bash ] && \ exec /usr/gnu/bin/bash --login This will cause login shells to replace themselves with bash running as a login shell. Once you have this working, you can copy your initialization code from ~/.profile to ~/.bash_profile. I have received word that the recipe supplied above is insufficient for machines running CDE. CDE has a maze of twisty little startup files, all slightly different. If you cannot change your login shell in the password file to bash, you will have to (apparently) live with CDE using the shell in the password file to run its startup scripts. If you have changed your shell to bash, there is code in the CDE startup files (on Solaris, at least) that attempts to do the right thing. It is, however, often broken, and may require that you use the $BASH_ENV trick described below. `dtterm' claims to use $SHELL as the default program to start, so if you can change $SHELL in the CDE startup files, you should be able to use bash in your terminal windows. Setting DTSOURCEPROFILE in ~/.dtprofile will cause the `Xsession' program to read your login shell's startup files. You may be able to use bash for the rest of the CDE programs by setting SHELL to bash in ~/.dtprofile as well, but I have not tried this. You can use the above `exec' recipe to start bash when not logging in with CDE by testing the value of the DT variable: if [ -n "$DT" ]; then [ -f /usr/gnu/bin/bash ] && exec /usr/gnu/bin/bash --login fi If CDE starts its shells non-interactively during login, the login shell startup files (~/.profile, ~/.bash_profile) will not be sourced at login. To get around this problem, append a line similar to the following to your ~/.dtprofile: BASH_ENV=${HOME}/.bash_profile ; export BASH_ENV and add the following line to the beginning of ~/.bash_profile: unset BASH_ENV A8) I just changed my login shell to bash, and now I can't FTP into my machine. Why not? You must add the full pathname to bash to the file /etc/shells. As noted in the answer to the previous question, many systems require this before you can make bash your login shell. Most versions of ftpd use this file to prohibit `special' users such as `uucp' and `news' from using FTP. A9) What's the `POSIX Shell and Utilities standard'? POSIX is a name originally coined by Richard Stallman for a family of open system standards based on UNIX. There are a number of aspects of UNIX under consideration for standardization, from the basic system services at the system call and C library level to applications and tools to system administration and management. Each area of standardization is assigned to a working group in the 1003 series. The POSIX Shell and Utilities standard was originally developed by IEEE Working Group 1003.2 (POSIX.2). Today it has been merged with the original 1003.1 Working Group and is maintained by the Austin Group (a joint working group of the IEEE, The Open Group and ISO/IEC SC22/WG15). Today the Shell and Utilities are a volume within the set of documents that make up IEEE Std 1003.1-2001, and thus now the former POSIX.2 (from 1992) is now part of the current POSIX.1 standard (POSIX 1003.1-2001). The Shell and Utilities volume concentrates on the command interpreter interface and utility programs commonly executed from the command line or by other programs. The standard is freely available on the web at http://www.UNIX-systems.org/version3/ . Work continues at the Austin Group on maintenance issues; see http://www.opengroup.org/austin/ to join the discussions. Bash is concerned with the aspects of the shell's behavior defined by the POSIX Shell and Utilities volume. The shell command language has of course been standardized, including the basic flow control and program execution constructs, I/O redirection and pipelining, argument handling, variable expansion, and quoting. The `special' builtins, which must be implemented as part of the shell to provide the desired functionality, are specified as being part of the shell; examples of these are `eval' and `export'. Other utilities appear in the sections of POSIX not devoted to the shell which are commonly (and in some cases must be) implemented as builtin commands, such as `read' and `test'. POSIX also specifies aspects of the shell's interactive behavior as part of the UPE, including job control and command line editing. Only vi-style line editing commands have been standardized; emacs editing commands were left out due to objections. The latest version of the POSIX Shell and Utilities standard is available (now updated to the 2004 Edition) as part of the Single UNIX Specification Version 3 at http://www.UNIX-systems.org/version3/ A10) What is the bash `posix mode'? Although bash is an implementation of the POSIX shell specification, there are areas where the bash default behavior differs from that spec. The bash `posix mode' changes the bash behavior in these areas so that it obeys the spec more closely. Posix mode is entered by starting bash with the --posix or '-o posix' option or executing `set -o posix' after bash is running. The specific aspects of bash which change when posix mode is active are listed in the file POSIX in the bash distribution. They are also listed in a section in the Bash Reference Manual (from which that file is generated). Section B: The latest version B1) What's new in version 4.3? Bash-4.3 is the third revision to the fourth major release of bash. Bash-4.3 contains the following new features (see the manual page for complete descriptions and the CHANGES and NEWS files in the bash-4.3 distribution): o The `helptopic' completion action now maps to all the help topics, not just the shell builtins. o The `help' builtin no longer does prefix substring matching first, so `help read' does not match `readonly', but will do it if exact string matching fails. o The shell can be compiled to not display a message about processes that terminate due to SIGTERM. o Non-interactive shells now react to the setting of checkwinsize and set LINES and COLUMNS after a foreground job exits. o There is a new shell option, `globasciiranges', which, when set to on, forces globbing range comparisons to use character ordering as if they were run in the C locale. o There is a new shell option, `direxpand', which makes filename completion expand variables in directory names in the way bash-4.1 did. o In Posix mode, the `command' builtin does not change whether or not a builtin it shadows is treated as an assignment builtin. o The `return' and `exit' builtins accept negative exit status arguments. o The word completion code checks whether or not a filename containing a shell variable expands to a directory name and appends `/' to the word as appropriate. The same code expands shell variables in command names when performing command completion. o In Posix mode, it is now an error to attempt to define a shell function with the same name as a Posix special builtin. o When compiled for strict Posix conformance, history expansion is disabled by default. o The history expansion character (!) does not cause history expansion when followed by the closing quote in a double-quoted string. o `complete' and its siblings compgen/compopt now takes a new `-o noquote' option to inhibit quoting of the completions. o Setting HISTSIZE to a value less than zero causes the history list to be unlimited (setting it 0 zero disables the history list). o Setting HISTFILESIZE to a value less than zero causes the history file size to be unlimited (setting it to 0 causes the history file to be truncated to zero size). o The `read' builtin now skips NUL bytes in the input. o There is a new `bind -X' option to print all key sequences bound to Unix commands. o When in Posix mode, `read' is interruptible by a trapped signal. After running the trap handler, read returns 128+signal and throws away any partially-read input. o The command completion code skips whitespace and assignment statements before looking for the command name word to be completed. o The build process has a new mechanism for constructing separate help files that better reflects the current set of compilation options. o The -nt and -ot options to test now work with files with nanosecond timestamp resolution. o The shell saves the command history in any shell for which history is enabled and HISTFILE is set, not just interactive shells. o The shell has `nameref' variables and new -n(/+n) options to declare and unset to use them, and a `test -R' option to test for them. o The shell now allows assigning, referencing, and unsetting elements of indexed arrays using negative subscripts (a[-1]=2, echo ${a[-1]}) which count back from the last element of the array. o The {x} operators to the [[ conditional command now do string comparison according to the current locale. o Programmable completion now uses the completion for `b' instead of `a' when completion is attempted on a line like: a $(b c. o Force extglob on temporarily when parsing the pattern argument to the == and != operators to the [[ command, for compatibility. o Changed the behavior of interrupting the wait builtin when a SIGCHLD is received and a trap on SIGCHLD is set to be Posix-mode only. o The read builtin has a new `-N nchars' option, which reads exactly NCHARS characters, ignoring delimiters like newline. o The mapfile/readarray builtin no longer stores the commands it invokes via callbacks in the history list. o There is a new `compat40' shopt option. o The < and > operators to [[ do string comparisons using the current locale only if the compatibility level is greater than 40 (set to 41 by default). o New bindable readline function: menu-complete-backward. o In the readline vi-mode insertion keymap, C-n is now bound to menu-complete by default, and C-p to menu-complete-backward. o When in readline vi command mode, repeatedly hitting ESC now does nothing, even when ESC introduces a bound key sequence. This is closer to how historical vi behaves. o New bindable readline function: skip-csi-sequence. Can be used as a default to consume key sequences generated by keys like Home and End without having to bind all keys. o New bindable readline variable: skip-completed-text, active when completing in the middle of a word. If enabled, it means that characters in the completion that match characters in the remainder of the word are "skipped" rather than inserted into the line. o The pre-readline-6.0 version of menu completion is available as "old-menu-complete" for users who do not like the readline-6.0 version. o New bindable readline variable: echo-control-characters. If enabled, and the tty ECHOCTL bit is set, controls the echoing of characters corresponding to keyboard-generated signals. o New bindable readline variable: enable-meta-key. Controls whether or not readline sends the smm/rmm sequences if the terminal indicates it has a meta key that enables eight-bit characters. Bash-4.0 contained the following new features: o When using substring expansion on the positional parameters, a starting index of 0 now causes $0 to be prefixed to the list. o There is a new variable, $BASHPID, which always returns the process id of the current shell. o There is a new `autocd' option that, when enabled, causes bash to attempt to `cd' to a directory name that is supplied as the first word of a simple command. o There is a new `checkjobs' option that causes the shell to check for and report any running or stopped jobs at exit. o The programmable completion code exports a new COMP_TYPE variable, set to a character describing the type of completion being attempted. o The programmable completion code exports a new COMP_KEY variable, set to the character that caused the completion to be invoked (e.g., TAB). o The programmable completion code now uses the same set of characters as readline when breaking the command line into a list of words. o The block multiplier for the ulimit -c and -f options is now 512 when in Posix mode, as Posix specifies. o Changed the behavior of the read builtin to save any partial input received in the specified variable when the read builtin times out. This also results in variables specified as arguments to read to be set to the empty string when there is no input available. When the read builtin times out, it returns an exit status greater than 128. o The shell now has the notion of a `compatibility level', controlled by new variables settable by `shopt'. Setting this variable currently restores the bash-3.1 behavior when processing quoted strings on the rhs of the `=~' operator to the `[[' command. o The `ulimit' builtin now has new -b (socket buffer size) and -T (number of threads) options. o There is a new `compopt' builtin that allows completion functions to modify completion options for existing completions or the completion currently being executed. o The `read' builtin has a new -i option which inserts text into the reply buffer when using readline. o A new `-E' option to the complete builtin allows control of the default behavior for completion on an empty line. o There is now limited support for completing command name words containing globbing characters. o The `help' builtin now has a new -d option, to display a short description, and a -m option, to print help information in a man page-like format. o There is a new `mapfile' builtin to populate an array with lines from a given file. o If a command is not found, the shell attempts to execute a shell function named `command_not_found_handle', supplying the command words as the function arguments. o There is a new shell option: `globstar'. When enabled, the globbing code treats `**' specially -- it matches all directories (and files within them, when appropriate) recursively. o There is a new shell option: `dirspell'. When enabled, the filename completion code performs spelling correction on directory names during completion. o The `-t' option to the `read' builtin now supports fractional timeout values. o Brace expansion now allows zero-padding of expanded numeric values and will add the proper number of zeroes to make sure all values contain the same number of digits. o There is a new bash-specific bindable readline function: `dabbrev-expand'. It uses menu completion on a set of words taken from the history list. o The command assigned to a key sequence with `bind -x' now sets two new variables in the environment of the executed command: READLINE_LINE_BUFFER and READLINE_POINT. The command can change the current readline line and cursor position by modifying READLINE_LINE_BUFFER and READLINE_POINT, respectively. o There is a new >>& redirection operator, which appends the standard output and standard error to the named file. o The parser now understands `|&' as a synonym for `2>&1 |', which redirects the standard error for a command through a pipe. o The new `;&' case statement action list terminator causes execution to continue with the action associated with the next pattern in the statement rather than terminating the command. o The new `;;&' case statement action list terminator causes the shell to test the next set of patterns after completing execution of the current action, rather than terminating the command. o The shell understands a new variable: PROMPT_DIRTRIM. When set to an integer value greater than zero, prompt expansion of \w and \W will retain only that number of trailing pathname components and replace the intervening characters with `...'. o There are new case-modifying word expansions: uppercase (^[^]) and lowercase (,[,]). They can work on either the first character or array element, or globally. They accept an optional shell pattern that determines which characters to modify. There is an optionally- configured feature to include capitalization operators. o The shell provides associative array variables, with the appropriate support to create, delete, assign values to, and expand them. o The `declare' builtin now has new -l (convert value to lowercase upon assignment) and -u (convert value to uppercase upon assignment) options. There is an optionally-configurable -c option to capitalize a value at assignment. o There is a new `coproc' reserved word that specifies a coprocess: an asynchronous command run with two pipes connected to the creating shell. Coprocs can be named. The input and output file descriptors and the PID of the coprocess are available to the calling shell in variables with coproc-specific names. o A value of 0 for the -t option to `read' now returns success if there is input available to be read from the specified file descriptor. o CDPATH and GLOBIGNORE are ignored when the shell is running in privileged mode. o New bindable readline functions shell-forward-word and shell-backward-word, which move forward and backward words delimited by shell metacharacters and honor shell quoting. o New bindable readline functions shell-backward-kill-word and shell-kill-word which kill words backward and forward, but use the same word boundaries as shell-forward-word and shell-backward-word. Bash-3.2 contained the following new features: o Bash-3.2 now checks shell scripts for NUL characters rather than non-printing characters when deciding whether or not a script is a binary file. o Quoting the string argument to the [[ command's =~ (regexp) operator now forces string matching, as with the other pattern-matching operators. Bash-3.1 contained the following new features: o Bash-3.1 may now be configured and built in a mode that enforces strict POSIX compliance. o The `+=' assignment operator, which appends to the value of a string or array variable, has been implemented. o It is now possible to ignore case when matching in contexts other than filename generation using the new `nocasematch' shell option. Bash-3.0 contained the following new features: o Features to support the bash debugger have been implemented, and there is a new `extdebug' option to turn the non-default options on o HISTCONTROL is now a colon-separated list of options and has been extended with a new `erasedups' option that will result in only one copy of a command being kept in the history list o Brace expansion has been extended with a new {x..y} form, producing sequences of digits or characters o Timestamps are now kept with history entries, with an option to save and restore them from the history file; there is a new HISTTIMEFORMAT variable describing how to display the timestamps when listing history entries o The `[[' command can now perform extended regular expression (egrep-like) matching, with matched subexpressions placed in the BASH_REMATCH array variable o A new `pipefail' option causes a pipeline to return a failure status if any command in it fails o The `jobs', `kill', and `wait' builtins now accept job control notation in their arguments even if job control is not enabled o The `gettext' package and libintl have been integrated, and the shell messages may be translated into other languages Bash-2.05b introduced the following new features: o support for multibyte characters has been added to both bash and readline o the DEBUG trap is now run *before* simple commands, ((...)) commands, [[...]] conditional commands, and for ((...)) loops o the shell now performs arithmetic in the largest integer size the machine supports (intmax_t) o there is a new \D{...} prompt expansion; passes the `...' to strftime(3) and inserts the result into the expanded prompt o there is a new `here-string' redirection operator: <<< word o when displaying variables, function attributes and definitions are shown separately, allowing them to be re-used as input (attempting to re-use the old output would result in syntax errors). o `read' has a new `-u fd' option to read from a specified file descriptor o the bash debugger in examples/bashdb has been modified to work with the new DEBUG trap semantics, the command set has been made more gdb-like, and the changes to $LINENO make debugging functions work better o the expansion of $LINENO inside a shell function is only relative to the function start if the shell is interactive -- if the shell is running a script, $LINENO expands to the line number in the script. This is as POSIX-2001 requires Bash-2.05a introduced the following new features: o The `printf' builtin has undergone major work o There is a new read-only `shopt' option: login_shell, which is set by login shells and unset otherwise o New `\A' prompt string escape sequence; expanding to time in 24-hour HH:MM format o New `-A group/-g' option to complete and compgen; goes group name completion o New [+-]O invocation option to set and unset `shopt' options at startup o ksh-like `ERR' trap o `for' loops now allow empty word lists after the `in' reserved word o new `hard' and `soft' arguments for the `ulimit' builtin o Readline can be configured to place the user at the same point on the line when retrieving commands from the history list o Readline can be configured to skip `hidden' files (filenames with a leading `.' on Unix) when performing completion Bash-2.05 introduced the following new features: o This version has once again reverted to using locales and strcoll(3) when processing pattern matching bracket expressions, as POSIX requires. o Added a new `--init-file' invocation argument as a synonym for `--rcfile', per the new GNU coding standards. o The /dev/tcp and /dev/udp redirections now accept service names as well as port numbers. o `complete' and `compgen' now take a `-o value' option, which controls some of the aspects of that compspec. Valid values are: default - perform bash default completion if programmable completion produces no matches dirnames - perform directory name completion if programmable completion produces no matches filenames - tell readline that the compspec produces filenames, so it can do things like append slashes to directory names and suppress trailing spaces o A new loadable builtin, realpath, which canonicalizes and expands symlinks in pathname arguments. o When `set' is called without options, it prints function defintions in a way that allows them to be reused as input. This affects `declare' and `declare -p' as well. This only happens when the shell is not in POSIX mode, since POSIX.2 forbids this behavior. Bash-2.04 introduced the following new features: o Programmable word completion with the new `complete' and `compgen' builtins; examples are provided in examples/complete/complete-examples o `history' has a new `-d' option to delete a history entry o `bind' has a new `-x' option to bind key sequences to shell commands o The prompt expansion code has new `\j' and `\l' escape sequences o The `no_empty_cmd_completion' shell option, if enabled, inhibits command completion when TAB is typed on an empty line o `help' has a new `-s' option to print a usage synopsis o New arithmetic operators: var++, var--, ++var, --var, expr1,expr2 (comma) o New ksh93-style arithmetic for command: for ((expr1 ; expr2; expr3 )); do list; done o `read' has new options: `-t', `-n', `-d', `-s' o The redirection code handles several filenames specially: /dev/fd/N, /dev/stdin, /dev/stdout, /dev/stderr o The redirection code now recognizes /dev/tcp/HOST/PORT and /dev/udp/HOST/PORT and tries to open a TCP or UDP socket, respectively, to the specified port on the specified host o The ${!prefix*} expansion has been implemented o A new FUNCNAME variable, which expands to the name of a currently-executing function o The GROUPS variable is no longer readonly o A new shopt `xpg_echo' variable, to control the behavior of echo with respect to backslash-escape sequences at runtime o The NON_INTERACTIVE_LOGIN_SHELLS #define has returned The version of Readline released with Bash-2.04, Readline-4.1, had several new features as well: o Parentheses matching is always compiled into readline, and controllable with the new `blink-matching-paren' variable o The history-search-forward and history-search-backward functions now leave point at the end of the line when the search string is empty, like reverse-search-history, and forward-search-history o A new function for applications: rl_on_new_line_with_prompt() o New variables for applications: rl_already_prompted, and rl_gnu_readline_p Bash-2.03 had very few new features, in keeping with the convention that odd-numbered releases provide mainly bug fixes. A number of new features were added to Readline, mostly at the request of the Cygnus folks. A new shopt option, `restricted_shell', so that startup files can test whether or not the shell was started in restricted mode Filename generation is now performed on the words between ( and ) in compound array assignments (this is really a bug fix) OLDPWD is now auto-exported, as POSIX.2 requires ENV and BASH_ENV are read-only variables in a restricted shell Bash may now be linked against an already-installed Readline library, as long as the Readline library is version 4 or newer All shells begun with the `--login' option will source the login shell startup files, even if the shell is not interactive There were lots of changes to the version of the Readline library released along with Bash-2.03. For a complete list of the changes, read the file CHANGES in the Bash-2.03 distribution. Bash-2.02 contained the following new features: a new version of malloc (based on the old GNU malloc code in previous bash versions) that is more page-oriented, more conservative with memory usage, does not `orphan' large blocks when they are freed, is usable on 64-bit machines, and has allocation checking turned on unconditionally POSIX.2-style globbing character classes ([:alpha:], [:alnum:], etc.) POSIX.2-style globbing equivalence classes POSIX.2-style globbing collating symbols the ksh [[...]] extended conditional command the ksh egrep-style extended pattern matching operators a new `printf' builtin the ksh-like $(, &>, >|, <<<, [n]<&word-, [n]>&word-, >>& prompt string special char translation and variable expansion auto-export of variables in initial environment command search finds functions before builtins bash return builtin will exit a file sourced with `.' builtins: cd -/-L/-P/-@, exec -l/-c/-a, echo -e/-E, hash -d/-l/-p/-t. export -n/-f/-p/name=value, pwd -L/-P, read -e/-p/-a/-t/-n/-d/-s/-u/-i/-N, readonly -a/-f/name=value, trap -l, set +o, set -b/-m/-o option/-h/-p/-B/-C/-H/-P, unset -f/-n/-v, ulimit -i/-m/-p/-q/-u/-x, type -a/-p/-t/-f/-P, suspend -f, kill -n, test -o optname/s1 == s2/s1 < s2/s1 > s2/-nt/-ot/-ef/-O/-G/-S/-R bash reads ~/.bashrc for interactive shells, $ENV for non-interactive bash restricted shell mode is more extensive bash allows functions and variables with the same name brace expansion tilde expansion arithmetic expansion with $((...)) and `let' builtin the `[[...]]' extended conditional command process substitution aliases and alias/unalias builtins local variables in functions and `local' builtin readline and command-line editing with programmable completion command history and history/fc builtins csh-like history expansion other new bash builtins: bind, command, compgen, complete, builtin, declare/typeset, dirs, enable, fc, help, history, logout, popd, pushd, disown, shopt, printf, compopt, mapfile exported functions filename generation when using output redirection (command >a*) POSIX.2-style globbing character classes POSIX.2-style globbing equivalence classes POSIX.2-style globbing collating symbols egrep-like extended pattern matching operators case-insensitive pattern matching and globbing variable assignments preceding commands affect only that command, even for builtins and functions posix mode and strict posix conformance redirection to /dev/fd/N, /dev/stdin, /dev/stdout, /dev/stderr, /dev/tcp/host/port, /dev/udp/host/port debugger support, including `caller' builtin and new variables RETURN trap the `+=' assignment operator autocd shell option and behavior command-not-found hook with command_not_found_handle shell function globstar shell option and `**' globbing behavior |& synonym for `2>&1 |' ;& and ;;& case action list terminators case-modifying word expansions and variable attributes associative arrays coprocesses using the `coproc' reserved word and variables shell assignment of a file descriptor used in a redirection to a variable Things sh has that bash does not: uses variable SHACCT to do shell accounting includes `stop' builtin (bash can use alias stop='kill -s STOP') `newgrp' builtin turns on job control if called as `jsh' $TIMEOUT (like bash $TMOUT) `^' is a synonym for `|' new SVR4.2 sh builtins: mldmode, priv Implementation differences: redirection to/from compound commands causes sh to create a subshell bash does not allow unbalanced quotes; sh silently inserts them at EOF bash does not mess with signal 11 sh sets (euid, egid) to (uid, gid) if -p not supplied and uid < 100 bash splits only the results of expansions on IFS, using POSIX.2 field splitting rules; sh splits all words on IFS sh does not allow MAILCHECK to be unset (?) sh does not allow traps on SIGALRM or SIGCHLD bash allows multiple option arguments when invoked (e.g. -x -v); sh allows only a single option argument (`sh -x -v' attempts to open a file named `-v', and, on SunOS 4.1.4, dumps core. On Solaris 2.4 and earlier versions, sh goes into an infinite loop.) sh exits a script if any builtin fails; bash exits only if one of the POSIX.2 `special' builtins fails C2) How does bash differ from the Korn shell, version ksh88? Things bash has or uses that ksh88 does not: long invocation options [-+]O invocation option -l invocation option `!' reserved word arithmetic for command: for ((expr1 ; expr2; expr3 )); do list; done arithmetic in largest machine-supported size (intmax_t) posix mode and posix conformance command hashing tilde expansion for assignment statements that look like $PATH process substitution with named pipes if /dev/fd is not available the ${!param} indirect parameter expansion operator the ${!param*} prefix expansion operator the ${param:offset[:length]} parameter substring operator the ${param/pat[/string]} parameter pattern substitution operator variables: BASH, BASH_VERSION, BASH_VERSINFO, BASHPID, UID, EUID, SHLVL, TIMEFORMAT, HISTCMD, HOSTTYPE, OSTYPE, MACHTYPE, HISTFILESIZE, HISTIGNORE, HISTCONTROL, PROMPT_COMMAND, IGNOREEOF, FIGNORE, INPUTRC, HOSTFILE, DIRSTACK, PIPESTATUS, HOSTNAME, OPTERR, SHELLOPTS, GLOBIGNORE, GROUPS, FUNCNAME, histchars, auto_resume, PROMPT_DIRTRIM prompt expansion with backslash escapes and command substitution redirection: &> (stdout and stderr), <<<, [n]<&word-, [n]>&word-, >>& more extensive and extensible editing and programmable completion builtins: bind, builtin, command, declare, dirs, echo -e/-E, enable, exec -l/-c/-a, fc -s, export -n/-f/-p, hash, help, history, jobs -x/-r/-s, kill -s/-n/-l, local, logout, popd, pushd, read -e/-p/-a/-t/-n/-d/-s/-N, readonly -a/-n/-f/-p, set -o braceexpand/-o histexpand/-o interactive-comments/ -o notify/-o physical/-o posix/-o hashall/-o onecmd/ -h/-B/-C/-b/-H/-P, set +o, suspend, trap -l, type, typeset -a/-F/-p, ulimit -i/-q/-u/-x, umask -S, alias -p, shopt, disown, printf, complete, compgen, compopt, mapfile `!' csh-style history expansion POSIX.2-style globbing character classes POSIX.2-style globbing equivalence classes POSIX.2-style globbing collating symbols egrep-like extended pattern matching operators case-insensitive pattern matching and globbing `**' arithmetic operator to do exponentiation redirection to /dev/fd/N, /dev/stdin, /dev/stdout, /dev/stderr arrays of unlimited size TMOUT is default timeout for `read' and `select' debugger support, including the `caller' builtin RETURN trap Timestamps in history entries {x..y} brace expansion The `+=' assignment operator autocd shell option and behavior command-not-found hook with command_not_found_handle shell function globstar shell option and `**' globbing behavior |& synonym for `2>&1 |' ;& and ;;& case action list terminators case-modifying word expansions and variable attributes associative arrays coprocesses using the `coproc' reserved word and variables shell assignment of a file descriptor used in a redirection to a variable Things ksh88 has or uses that bash does not: tracked aliases (alias -t) variables: ERRNO, FPATH, EDITOR, VISUAL co-processes (bash uses different syntax) weirdly-scoped functions typeset +f to list all function names without definitions text of command history kept in a file, not memory builtins: alias -x, cd old new, newgrp, print, read -p/-s/var?prompt, set -A/-o gmacs/ -o bgnice/-o markdirs/-o trackall/-o viraw/-s, typeset -H/-L/-R/-Z/-A/-ft/-fu/-fx/-t, whence using environment to pass attributes of exported variables arithmetic evaluation done on arguments to some builtins reads .profile from $PWD when invoked as login shell Implementation differences: ksh runs last command of a pipeline in parent shell context bash has brace expansion by default (ksh88 compile-time option) bash has fixed startup file for all interactive shells; ksh reads $ENV bash has exported functions bash command search finds functions before builtins bash waits for all commands in pipeline to exit before returning status emacs-mode editing has some slightly different key bindings C3) Which new features in ksh-93 are not in bash, and which are? This list is current through ksh93v (10/08/2013) New things in ksh-93 not in bash-4.3: floating point arithmetic, variables, and constants math library functions, including user-defined math functions ${!name[sub]} name of subscript for associative array `.' is allowed in variable names to create a hierarchical namespace more extensive compound assignment syntax discipline functions KEYBD trap variables: .sh.edchar, .sh.edmode, .sh.edcol, .sh.edtext, .sh.version, .sh.name, .sh.subscript, .sh.value, .sh.match, HISTEDIT, .sh.sig, .sh.stats, .sh.siginfo, .sh.pwdfd, .sh.op_astbin, .sh.pool backreferences in pattern matching (\N) `&' operator in pattern lists for matching (match all instead of any) exit statuses between 0 and 255 FPATH and PATH mixing lexical scoping for local variables in `ksh' functions no scoping for local variables in `POSIX' functions $'' \C[.collating-element.] escape sequence -C/-I invocation options print -f (bash uses printf) and rest of print builtin options printf %(type)q, %#q `fc' has been renamed to `hist' `.' can execute shell functions getopts -a printf %B, %H, %P, %R, %Z modifiers, output base for %d, `=' flag read -n/-N differ/-v/-S set -o showme/-o multiline (bash default) set -K kill -Q/-q/-L trap -a `sleep' and `getconf' builtins (bash has loadable versions) [[ -R name ]] (checks whether or not name is a nameref) typeset -C/-S/-T/-X/-h/-s/-c/-M experimental `type' definitions (a la typedef) using typeset array expansions ${array[sub1..sub2]} and ${!array[sub1..sub2]} associative array assignments using `;' as element separator command substitution $(n<#) expands to current byte offset for fd N new '${ ' form of command substitution, executed in current shell new >;/<>;/<#pat/<##pat/<#/># redirections brace expansion printf-like formats CHLD trap triggered by SIGSTOP and SIGCONT ~{fd} expansion, which replaces fd with the corresponding path name $"string" expanded when referenced rather than when first parsed job "pools", which allow a collection of jobs to be managed as a unit New things in ksh-93 present in bash-4.3: associative arrays [n]<&word- and [n]>&word- redirections (combination dup and close) for (( expr1; expr2; expr3 )) ; do list; done - arithmetic for command ?:, ++, --, `expr1 , expr2' arithmetic operators expansions: ${!param}, ${param:offset[:len]}, ${param/pat[/str]}, ${!param*} compound array assignment negative subscripts for indexed array variables the `!' reserved word loadable builtins -- but ksh uses `builtin' while bash uses `enable' new $'...' and $"..." quoting FIGNORE (but bash uses GLOBIGNORE), HISTCMD brace expansion and set -B changes to kill builtin `command', `builtin', `disown' builtins echo -e exec -c/-a printf %T modifier read -A (bash uses read -a) read -t/-d trap -p `.' restores the positional parameters when it completes set -o notify/-C set -o pipefail set -G (-o globstar) and ** POSIX.2 `test' umask -S unalias -a command and arithmetic substitution performed on PS1, PS4, and ENV command name completion, TAB displaying possible completions ENV processed only for interactive shells The `+=' assignment operator the `;&' case statement "fallthrough" pattern list terminator csh-style history expansion and set -H negative offsets in ${param:offset:length} redirection operators preceded with {varname} to store fd number in varname DEBUG can force skipping following command [[ -v var ]] operator (checks whether or not var is set) typeset -n and `nameref' variables process substitutions work without /dev/fd Section D: Why does bash do some things differently than other Unix shells? D1) Why does bash run a different version of `command' than `which command' says it will? On many systems, `which' is actually a csh script that assumes you're running csh. In tcsh, `which' and its cousin `where' are builtins. On other Unix systems, `which' is a perl script that uses the PATH environment variable. Many Linux distributions use GNU `which', which is a C program that can understand shell aliases. The csh script version reads the csh startup files from your home directory and uses those to determine which `command' will be invoked. Since bash doesn't use any of those startup files, there's a good chance that your bash environment differs from your csh environment. The bash `type' builtin does everything `which' does, and will report correct results for the running shell. If you're really wedded to the name `which', try adding the following function definition to your .bashrc: which() { builtin type "$@" } If you're moving from tcsh and would like to bring `where' along as well, use this function: where() { builtin type -a "$@" } D2) Why doesn't bash treat brace expansions exactly like csh? The only difference between bash and csh brace expansion is that bash requires a brace expression to contain at least one unquoted comma if it is to be expanded. Any brace-surrounded word not containing an unquoted comma is left unchanged by the brace expansion code. This affords the greatest degree of sh compatibility. Bash, ksh, zsh, and pd-ksh all implement brace expansion this way. D3) Why doesn't bash have csh variable modifiers? Posix has specified a more powerful, albeit somewhat more cryptic, mechanism cribbed from ksh, and bash implements it. ${parameter%word} Remove smallest suffix pattern. The WORD is expanded to produce a pattern. It then expands to the value of PARAMETER, with the smallest portion of the suffix matched by the pattern deleted. x=file.c echo ${x%.c}.o -->file.o ${parameter%%word} Remove largest suffix pattern. The WORD is expanded to produce a pattern. It then expands to the value of PARAMETER, with the largest portion of the suffix matched by the pattern deleted. x=posix/src/std echo ${x%%/*} -->posix ${parameter#word} Remove smallest prefix pattern. The WORD is expanded to produce a pattern. It then expands to the value of PARAMETER, with the smallest portion of the prefix matched by the pattern deleted. x=$HOME/src/cmd echo ${x#$HOME} -->/src/cmd ${parameter##word} Remove largest prefix pattern. The WORD is expanded to produce a pattern. It then expands to the value of PARAMETER, with the largest portion of the prefix matched by the pattern deleted. x=/one/two/three echo ${x##*/} -->three Given a=/a/b/c/d b=b.xxx csh bash result --- ---- ------ $a:h ${a%/*} /a/b/c $a:t ${a##*/} d $b:r ${b%.*} b $b:e ${b##*.} xxx D4) How can I make my csh aliases work when I convert to bash? Bash uses a different syntax to support aliases than csh does. The details can be found in the documentation. We have provided a shell script which does most of the work of conversion for you; this script can be found in ./examples/misc/aliasconv.sh. Here is how you use it: Start csh in the normal way for you. (e.g., `csh') Pipe the output of `alias' through `aliasconv.sh', saving the results into `bash_aliases': alias | bash aliasconv.sh >bash_aliases Edit `bash_aliases', carefully reading through any created functions. You will need to change the names of some csh specific variables to the bash equivalents. The script converts $cwd to $PWD, $term to $TERM, $home to $HOME, $user to $USER, and $prompt to $PS1. You may also have to add quotes to avoid unwanted expansion. For example, the csh alias: alias cd 'cd \!*; echo $cwd' is converted to the bash function: cd () { command cd "$@"; echo $PWD ; } The only thing that needs to be done is to quote $PWD: cd () { command cd "$@"; echo "$PWD" ; } Merge the edited file into your ~/.bashrc. There is an additional, more ambitious, script in examples/misc/cshtobash that attempts to convert your entire csh environment to its bash equivalent. This script can be run as simply `cshtobash' to convert your normal interactive environment, or as `cshtobash ~/.login' to convert your login environment. D5) How can I pipe standard output and standard error from one command to another, like csh does with `|&'? Use command 2>&1 | command2 The key is to remember that piping is performed before redirection, so file descriptor 1 points to the pipe when it is duplicated onto file descriptor 2. D6) Now that I've converted from ksh to bash, are there equivalents to ksh features like autoloaded functions and the `whence' command? There are features in ksh-88 and ksh-93 that do not have direct bash equivalents. Most, however, can be emulated with very little trouble. ksh-88 feature Bash equivalent -------------- --------------- compiled-in aliases set up aliases in .bashrc; some ksh aliases are bash builtins (hash, history, type) coprocesses named pipe pairs (one for read, one for write) typeset +f declare -F cd, print, whence function substitutes in examples/functions/kshenv autoloaded functions examples/functions/autoload is the same as typeset -fu read var?prompt read -p prompt var ksh-93 feature Bash equivalent -------------- --------------- sleep, getconf Bash has loadable versions in examples/loadables ${.sh.version} $BASH_VERSION print -f printf hist alias hist=fc $HISTEDIT $FCEDIT Section E: How can I get bash to do certain things, and why does bash do things the way it does? E1) Why is the bash builtin `test' slightly different from /bin/test? The specific example used here is [ ! x -o x ], which is false. Bash's builtin `test' implements the Posix.2 spec, which can be summarized as follows (the wording is due to David Korn): Here is the set of rules for processing test arguments. 0 Args: False 1 Arg: True iff argument is not null. 2 Args: If first arg is !, True iff second argument is null. If first argument is unary, then true if unary test is true Otherwise error. 3 Args: If second argument is a binary operator, do binary test of $1 $3 If first argument is !, negate two argument test of $2 $3 If first argument is `(' and third argument is `)', do the one-argument test of the second argument. Otherwise error. 4 Args: If first argument is !, negate three argument test of $2 $3 $4. Otherwise unspecified 5 or more Args: unspecified. (Historical shells would use their current algorithm). The operators -a and -o are considered binary operators for the purpose of the 3 Arg case. As you can see, the test becomes (not (x or x)), which is false. E2) Why does bash sometimes say `Broken pipe'? If a sequence of commands appears in a pipeline, and one of the reading commands finishes before the writer has finished, the writer receives a SIGPIPE signal. Many other shells special-case SIGPIPE as an exit status in the pipeline and do not report it. For example, in: ps -aux | head `head' can finish before `ps' writes all of its output, and ps will try to write on a pipe without a reader. In that case, bash will print `Broken pipe' to stderr when ps is killed by a SIGPIPE. As of bash-3.1, bash does not report SIGPIPE errors by default. You can build a version of bash that will report such errors. E3) When I have terminal escape sequences in my prompt, why does bash wrap lines at the wrong column? Readline, the line editing library that bash uses, does not know that the terminal escape sequences do not take up space on the screen. The redisplay code assumes, unless told otherwise, that each character in the prompt is a `printable' character that takes up one character position on the screen. You can use the bash prompt expansion facility (see the PROMPTING section in the manual page) to tell readline that sequences of characters in the prompt strings take up no screen space. Use the \[ escape to begin a sequence of non-printing characters, and the \] escape to signal the end of such a sequence. E4) If I pipe the output of a command into `read variable', why doesn't the output show up in $variable when the read command finishes? This has to do with the parent-child relationship between Unix processes. It affects all commands run in pipelines, not just simple calls to `read'. For example, piping a command's output into a `while' loop that repeatedly calls `read' will result in the same behavior. Each element of a pipeline, even a builtin or shell function, runs in a separate process, a child of the shell running the pipeline. A subprocess cannot affect its parent's environment. When the `read' command sets the variable to the input, that variable is set only in the subshell, not the parent shell. When the subshell exits, the value of the variable is lost. Many pipelines that end with `read variable' can be converted into command substitutions, which will capture the output of a specified command. The output can then be assigned to a variable: grep ^gnu /usr/lib/news/active | wc -l | read ngroup can be converted into ngroup=$(grep ^gnu /usr/lib/news/active | wc -l) This does not, unfortunately, work to split the text among multiple variables, as read does when given multiple variable arguments. If you need to do this, you can either use the command substitution above to read the output into a variable and chop up the variable using the bash pattern removal expansion operators or use some variant of the following approach. Say /usr/local/bin/ipaddr is the following shell script: #! /bin/sh host `hostname` | awk '/address/ {print $NF}' Instead of using /usr/local/bin/ipaddr | read A B C D to break the local machine's IP address into separate octets, use OIFS="$IFS" IFS=. set -- $(/usr/local/bin/ipaddr) IFS="$OIFS" A="$1" B="$2" C="$3" D="$4" Beware, however, that this will change the shell's positional parameters. If you need them, you should save them before doing this. This is the general approach -- in most cases you will not need to set $IFS to a different value. Some other user-supplied alternatives include: read A B C D << HERE $(IFS=.; echo $(/usr/local/bin/ipaddr)) HERE and, where process substitution is available, read A B C D < <(IFS=.; echo $(/usr/local/bin/ipaddr)) E5) I have a bunch of shell scripts that use backslash-escaped characters in arguments to `echo'. Bash doesn't interpret these characters. Why not, and how can I make it understand them? This is the behavior of echo on most Unix System V machines. The bash builtin `echo' is modeled after the 9th Edition Research Unix version of `echo'. It does not interpret backslash-escaped characters in its argument strings by default; it requires the use of the -e option to enable the interpretation. The System V echo provides no way to disable the special characters; the bash echo has a -E option to disable them. There is a configuration option that will make bash behave like the System V echo and interpret things like `\t' by default. Run configure with the --enable-xpg-echo-default option to turn this on. Be aware that this will cause some of the tests run when you type `make tests' to fail. There is a shell option, `xpg_echo', settable with `shopt', that will change the behavior of echo at runtime. Enabling this option turns on expansion of backslash-escape sequences. E6) Why doesn't a while or for loop get suspended when I type ^Z? This is a consequence of how job control works on Unix. The only thing that can be suspended is the process group. This is a single command or pipeline of commands that the shell forks and executes. When you run a while or for loop, the only thing that the shell forks and executes are any commands in the while loop test and commands in the loop bodies. These, therefore, are the only things that can be suspended when you type ^Z. If you want to be able to stop the entire loop, you need to put it within parentheses, which will force the loop into a subshell that may be stopped (and subsequently restarted) as a single unit. E7) What about empty for loops in Makefiles? It's fairly common to see constructs like this in automatically-generated Makefiles: SUBDIRS = @SUBDIRS@ ... subdirs-clean: for d in ${SUBDIRS}; do \ ( cd $$d && ${MAKE} ${MFLAGS} clean ) \ done When SUBDIRS is empty, this results in a command like this being passed to bash: for d in ; do ( cd $d && ${MAKE} ${MFLAGS} clean ) done In versions of bash before bash-2.05a, this was a syntax error. If the reserved word `in' was present, a word must follow it before the semicolon or newline. The language in the manual page referring to the list of words being empty referred to the list after it is expanded. These versions of bash required that there be at least one word following the `in' when the construct was parsed. The idiomatic Makefile solution is something like: SUBDIRS = @SUBDIRS@ subdirs-clean: subdirs=$SUBDIRS ; for d in $$subdirs; do \ ( cd $$d && ${MAKE} ${MFLAGS} clean ) \ done The latest updated POSIX standard has changed this: the word list is no longer required. Bash versions 2.05a and later accept the new syntax. E8) Why does the arithmetic evaluation code complain about `08'? The bash arithmetic evaluation code (used for `let', $(()), (()), and in other places), interprets a leading `0' in numeric constants as denoting an octal number, and a leading `0x' as denoting hexadecimal. This is in accordance with the POSIX.2 spec, section 2.9.2.1, which states that arithmetic constants should be handled as signed long integers as defined by the ANSI/ISO C standard. The POSIX.2 interpretation committee has confirmed this: http://www.pasc.org/interps/unofficial/db/p1003.2/pasc-1003.2-173.html E9) Why does the pattern matching expression [A-Z]* match files beginning with every letter except `z'? Bash-2.03, Bash-2.05 and later versions honor the current locale setting when processing ranges within pattern matching bracket expressions ([A-Z]). This is what POSIX.2 and SUSv3/XPG6 specify. The behavior of the matcher in bash-2.05 and later versions depends on the current LC_COLLATE setting. Setting this variable to `C' or `POSIX' will result in the traditional behavior ([A-Z] matches all uppercase ASCII characters). Many other locales, including the en_US locale (the default on many US versions of Linux) collate the upper and lower case letters like this: AaBb...Zz which means that [A-Z] matches every letter except `z'. Others collate like aAbBcC...zZ which means that [A-Z] matches every letter except `a'. The portable way to specify upper case letters is [:upper:] instead of A-Z; lower case may be specified as [:lower:] instead of a-z. Look at the manual pages for setlocale(3), strcoll(3), and, if it is present, locale(1). If you have locale(1), you can use it to find your current locale information even if you do not have any of the LC_ variables set. My advice is to put export LC_COLLATE=C into /etc/profile and inspect any shell scripts run from cron for constructs like [A-Z]. This will prevent things like rm [A-Z]* from removing every file in the current directory except those beginning with `z' and still allow individual users to change the collation order. Users may put the above command into their own profiles as well, of course. E10) Why does `cd //' leave $PWD as `//'? POSIX.2, in its description of `cd', says that *three* or more leading slashes may be replaced with a single slash when canonicalizing the current working directory. This is, I presume, for historical compatibility. Certain versions of Unix, and early network file systems, used paths of the form //hostname/path to access `path' on server `hostname'. E11) If I resize my xterm while another program is running, why doesn't bash notice the change? This is another issue that deals with job control. The kernel maintains a notion of a current terminal process group. Members of this process group (processes whose process group ID is equal to the current terminal process group ID) receive terminal-generated signals like SIGWINCH. (For more details, see the JOB CONTROL section of the bash man page.) If a terminal is resized, the kernel sends SIGWINCH to each member of the terminal's current process group (the `foreground' process group). When bash is running with job control enabled, each pipeline (which may be a single command) is run in its own process group, different from bash's process group. This foreground process group receives the SIGWINCH; bash does not. Bash has no way of knowing that the terminal has been resized. There is a `checkwinsize' option, settable with the `shopt' builtin, that will cause bash to check the window size and adjust its idea of the terminal's dimensions each time a process stops or exits and returns control of the terminal to bash. Enable it with `shopt -s checkwinsize'. E12) Why don't negative offsets in substring expansion work like I expect? When substring expansion of the form ${param:offset[:length} is used, an `offset' that evaluates to a number less than zero counts back from the end of the expanded value of $param. When a negative `offset' begins with a minus sign, however, unexpected things can happen. Consider a=12345678 echo ${a:-4} intending to print the last four characters of $a. The problem is that ${param:-word} already has a well-defined meaning: expand to word if the expanded value of param is unset or null, and $param otherwise. To use negative offsets that begin with a minus sign, separate the minus sign and the colon with a space. E13) Why does filename completion misbehave if a colon appears in the filename? Filename completion (and word completion in general) may appear to behave improperly if there is a colon in the word to be completed. The colon is special to readline's word completion code: it is one of the characters that breaks words for the completer. Readline uses these characters in sort of the same way that bash uses $IFS: they break or separate the words the completion code hands to the application-specific or default word completion functions. The original intent was to make it easy to edit colon-separated lists (such as $PATH in bash) in various applications using readline for input. This is complicated by the fact that some versions of the popular `bash-completion' programmable completion package have problems with the default completion behavior in the presence of colons. The current set of completion word break characters is available in bash as the value of the COMP_WORDBREAKS variable. Removing `:' from that value is enough to make the colon not special to completion: COMP_WORDBREAKS=${COMP_WORDBREAKS//:} You can also quote the colon with a backslash to achieve the same result temporarily. E14) Why does quoting the pattern argument to the regular expression matching conditional operator (=~) cause regexp matching to stop working? In versions of bash prior to bash-3.2, the effect of quoting the regular expression argument to the [[ command's =~ operator was not specified. The practical effect was that double-quoting the pattern argument required backslashes to quote special pattern characters, which interfered with the backslash processing performed by double-quoted word expansion and was inconsistent with how the == shell pattern matching operator treated quoted characters. In bash-3.2, the shell was changed to internally quote characters in single- and double-quoted string arguments to the =~ operator, which suppresses the special meaning of the characters special to regular expression processing (`.', `[', `\', `(', `), `*', `+', `?', `{', `|', `^', and `$') and forces them to be matched literally. This is consistent with how the `==' pattern matching operator treats quoted portions of its pattern argument. Since the treatment of quoted string arguments was changed, several issues have arisen, chief among them the problem of white space in pattern arguments and the differing treatment of quoted strings between bash-3.1 and bash-3.2. Both problems may be solved by using a shell variable to hold the pattern. Since word splitting is not performed when expanding shell variables in all operands of the [[ command, this allows users to quote patterns as they wish when assigning the variable, then expand the values to a single string that may contain whitespace. The first problem may be solved by using backslashes or any other quoting mechanism to escape the white space in the patterns. Bash-4.0 introduces the concept of a `compatibility level', controlled by several options to the `shopt' builtin. If the `compat31' option is enabled, bash reverts to the bash-3.1 behavior with respect to quoting the rhs of the =~ operator. E15) Tell me more about the shell compatibility level. Bash-4.0 introduced the concept of a `shell compatibility level', specified as a set of options to the shopt builtin (compat31, compat32, compat40 at this writing). There is only one current compatibility level -- each option is mutually exclusive. This list does not mention behavior that is standard for a particular version (e.g., setting compat32 means that quoting the rhs of the regexp matching operator quotes special regexp characters in the word, which is default behavior in bash-3.2 and above). compat31 set - the < and > operators to the [[ command do not consider the current locale when comparing strings - quoting the rhs of the regexp matching operator (=~) has no special effect compat32 set - the < and > operators to the [[ command do not consider the current locale when comparing strings compat40 set - the < and > operators to the [[ command do not consider the current locale when comparing strings - interrupting a command list such as "a ; b ; c" causes the execution of the entire list to be aborted (in versions before bash-4.0, interrupting one command in a list caused the next to be executed) compat41 set - interrupting a command list such as "a ; b ; c" causes the execution of the entire list to be aborted (in versions before bash-4.1, interrupting one command in a list caused the next to be executed) - when in posix mode, single quotes in the `word' portion of a double-quoted parameter expansion define a new quoting context and are treated specially compat42 set - the replacement string in double-quoted pattern substitution is not run through quote removal, as in previous versions Section F: Things to watch out for on certain Unix versions F1) Why can't I use command line editing in my `cmdtool'? The problem is `cmdtool' and bash fighting over the input. When scrolling is enabled in a cmdtool window, cmdtool puts the tty in `raw mode' to permit command-line editing using the mouse for applications that cannot do it themselves. As a result, bash and cmdtool each try to read keyboard input immediately, with neither getting enough of it to be useful. This mode also causes cmdtool to not implement many of the terminal functions and control sequences appearing in the `sun-cmd' termcap entry. For a more complete explanation, see that file examples/suncmd.termcap in the bash distribution. `xterm' is a better choice, and gets along with bash much more smoothly. If you must use cmdtool, you can use the termcap description in examples/suncmd.termcap. Set the TERMCAP variable to the terminal description contained in that file, i.e. TERMCAP='Mu|sun-cmd:am:bs:km:pt:li#34:co#80:cl=^L:ce=\E[K:cd=\E[J:rs=\E[s:' Then export TERMCAP and start a new cmdtool window from that shell. The bash command-line editing should behave better in the new cmdtool. If this works, you can put the assignment to TERMCAP in your bashrc file. F2) I built bash on Solaris 2. Why do globbing expansions and filename completion chop off the first few characters of each filename? This is the consequence of building bash on SunOS 5 and linking with the libraries in /usr/ucblib, but using the definitions and structures from files in /usr/include. The actual conflict is between the dirent structure in /usr/include/dirent.h and the struct returned by the version of `readdir' in libucb.a (a 4.3-BSD style `struct direct'). Make sure you've got /usr/ccs/bin ahead of /usr/ucb in your $PATH when configuring and building bash. This will ensure that you use /usr/ccs/bin/cc or acc instead of /usr/ucb/cc and that you link with libc before libucb. If you have installed the Sun C compiler, you may also need to put /usr/ccs/bin and /opt/SUNWspro/bin into your $PATH before /usr/ucb. F3) Why does bash dump core after I interrupt username completion or `~user' tilde expansion on a machine running NIS? This is a famous and long-standing bug in the SunOS YP (sorry, NIS) client library, which is part of libc. The YP library code keeps static state -- a pointer into the data returned from the server. When YP initializes itself (setpwent), it looks at this pointer and calls free on it if it's non-null. So far, so good. If one of the YP functions is interrupted during getpwent (the exact function is interpretwithsave()), and returns NULL, the pointer is freed without being reset to NULL, and the function returns. The next time getpwent is called, it sees that this pointer is non-null, calls free, and the bash free() blows up because it's being asked to free freed memory. The traditional Unix mallocs allow memory to be freed multiple times; that's probably why this has never been fixed. You can run configure with the `--without-gnu-malloc' option to use the C library malloc and avoid the problem. F4) I'm running SVR4.2. Why is the line erased every time I type `@'? The `@' character is the default `line kill' character in most versions of System V, including SVR4.2. You can change this character to whatever you want using `stty'. For example, to change the line kill character to control-u, type stty kill ^U where the `^' and `U' can be two separate characters. F5) Why does bash report syntax errors when my C News scripts use a redirection before a subshell command? The actual command in question is something like < file ( command ) According to the grammar given in the POSIX.2 standard, this construct is, in fact, a syntax error. Redirections may only precede `simple commands'. A subshell construct such as the above is one of the shell's `compound commands'. A redirection may only follow a compound command. This affects the mechanical transformation of commands that use `cat' to pipe a file into a command (a favorite Useless-Use-Of-Cat topic on comp.unix.shell). While most commands of the form cat file | command can be converted to `< file command', shell control structures such as loops and subshells require `command < file'. The file CWRU/sh-redir-hack in the bash distribution is an (unofficial) patch to parse.y that will modify the grammar to support this construct. It will not apply with `patch'; you must modify parse.y by hand. Note that if you apply this, you must recompile with -DREDIRECTION_HACK. This introduces a large number of reduce/reduce conflicts into the shell grammar. F6) Why can't I use vi-mode editing on Red Hat Linux 6.1? The short answer is that Red Hat screwed up. The long answer is that they shipped an /etc/inputrc that only works for emacs mode editing, and then screwed all the vi users by setting INPUTRC to /etc/inputrc in /etc/profile. The short fix is to do one of the following: remove or rename /etc/inputrc, set INPUTRC=~/.inputrc in ~/.bashrc (or .bash_profile, but make sure you export it if you do), remove the assignment to INPUTRC from /etc/profile, add set keymap emacs to the beginning of /etc/inputrc, or bracket the key bindings in /etc/inputrc with these lines $if mode=emacs [...] $endif F7) Why do bash-2.05a and bash-2.05b fail to compile `printf.def' on HP/UX 11.x? HP/UX's support for long double is imperfect at best. GCC will support it without problems, but the HP C library functions like strtold(3) and printf(3) don't actually work with long doubles. HP implemented a `long_double' type as a 4-element array of 32-bit ints, and that is what the library functions use. The ANSI C `long double' type is a 128-bit floating point scalar. The easiest fix, until HP fixes things up, is to edit the generated config.h and #undef the HAVE_LONG_DOUBLE line. After doing that, the compilation should complete successfully. Section G: How can I get bash to do certain common things? G1) How can I get bash to read and display eight-bit characters? This is a process requiring several steps. First, you must ensure that the `physical' data path is a full eight bits. For xterms, for example, the `vt100' resources `eightBitInput' and `eightBitOutput' should be set to `true'. Once you have set up an eight-bit path, you must tell the kernel and tty driver to leave the eighth bit of characters alone when processing keyboard input. Use `stty' to do this: stty cs8 -istrip -parenb For old BSD-style systems, you can use stty pass8 You may also need stty even odd Finally, you need to tell readline that you will be inputting and displaying eight-bit characters. You use readline variables to do this. convert-meta says what to do if you read a character with its eighth bit set. input-meta says whether to permit characters with the eighth bit at all. output-meta determines how to display characters with the eighth bit set: if on, they are output directly; if it is off, such characters are displayed as a meta-prefixed escape sequence. These variables can be set in your .inputrc or using the bash `bind' builtin. Here's an example using `bind': bash$ bind 'set convert-meta off' bash$ bind 'set input-meta on' bash$ bind 'set output-meta on' The `set' commands between the single quotes may also be placed in ~/.inputrc. The script examples/scripts.noah/meta.bash encapsulates the bind commands in a shell function. G2) How do I write a function `x' to replace builtin command `x', but still invoke the command from within the function? This is why the `command' and `builtin' builtins exist. The `command' builtin executes the command supplied as its first argument, skipping over any function defined with that name. The `builtin' builtin executes the builtin command given as its first argument directly. For example, to write a function to replace `cd' that writes the hostname and current directory to an xterm title bar, use something like the following: cd() { builtin cd "$@" && xtitle "$HOST: $PWD" } This could also be written using `command' instead of `builtin'; the version above is marginally more efficient. G3) How can I find the value of a shell variable whose name is the value of another shell variable? Versions of Bash newer than Bash-2.0 support this directly. You can use ${!var} For example, the following sequence of commands will echo `z': var1=var2 var2=z echo ${!var1} For sh compatibility, use the `eval' builtin. The important thing to remember is that `eval' expands the arguments you give it again, so you need to quote the parts of the arguments that you want `eval' to act on. For example, this expression prints the value of the last positional parameter: eval echo \"\$\{$#\}\" The expansion of the quoted portions of this expression will be deferred until `eval' runs, while the `$#' will be expanded before `eval' is executed. In versions of bash later than bash-2.0, echo ${!#} does the same thing. This is not the same thing as ksh93 `nameref' variables, though the syntax is similar. Namerefs are available bash version 4.3, and work as in ksh93. G4) How can I make the bash `time' reserved word print timing output that looks like the output from my system's /usr/bin/time? The bash command timing code looks for a variable `TIMEFORMAT' and uses its value as a format string to decide how to display the timing statistics. The value of TIMEFORMAT is a string with `%' escapes expanded in a fashion similar in spirit to printf(3). The manual page explains the meanings of the escape sequences in the format string. If TIMEFORMAT is not set, bash acts as if the following assignment had been performed: TIMEFORMAT=$'\nreal\t%3lR\nuser\t%3lU\nsys\t%3lS' The POSIX.2 default time format (used by `time -p command') is TIMEFORMAT=$'real %2R\nuser %2U\nsys %2S' The BSD /usr/bin/time format can be emulated with: TIMEFORMAT=$'\t%1R real\t%1U user\t%1S sys' The System V /usr/bin/time format can be emulated with: TIMEFORMAT=$'\nreal\t%1R\nuser\t%1U\nsys\t%1S' The ksh format can be emulated with: TIMEFORMAT=$'\nreal\t%2lR\nuser\t%2lU\nsys\t%2lS' G5) How do I get the current directory into my prompt? Bash provides a number of backslash-escape sequences which are expanded when the prompt string (PS1 or PS2) is displayed. The full list is in the manual page. The \w expansion gives the full pathname of the current directory, with a tilde (`~') substituted for the current value of $HOME. The \W expansion gives the basename of the current directory. To put the full pathname of the current directory into the path without any tilde subsitution, use $PWD. Here are some examples: PS1='\w$ ' # current directory with tilde PS1='\W$ ' # basename of current directory PS1='$PWD$ ' # full pathname of current directory The single quotes are important in the final example to prevent $PWD from being expanded when the assignment to PS1 is performed. G6) How can I rename "*.foo" to "*.bar"? Use the pattern removal functionality described in D3. The following `for' loop will do the trick: for f in *.foo; do mv $f ${f%foo}bar done G7) How can I translate a filename from uppercase to lowercase? The script examples/functions/lowercase, originally written by John DuBois, will do the trick. The converse is left as an exercise. G8) How can I write a filename expansion (globbing) pattern that will match all files in the current directory except "." and ".."? You must have set the `extglob' shell option using `shopt -s extglob' to use this: echo .!(.|) * A solution that works without extended globbing is given in the Unix Shell FAQ, posted periodically to comp.unix.shell. It's a variant of echo .[!.]* ..?* * (The ..?* catches files with names of three or more characters beginning with `..') Section H: Where do I go from here? H1) How do I report bugs in bash, and where should I look for fixes and advice? Use the `bashbug' script to report bugs. It is built and installed at the same time as bash. It provides a standard template for reporting a problem and automatically includes information about your configuration and build environment. `bashbug' sends its reports to bug-bash@gnu.org, which is a large mailing list gatewayed to the usenet newsgroup gnu.bash.bug. Bug fixes, answers to questions, and announcements of new releases are all posted to gnu.bash.bug. Discussions concerning bash features and problems also take place there. To reach the bash maintainers directly, send mail to bash-maintainers@gnu.org. H2) What kind of bash documentation is there? First, look in the doc directory in the bash distribution. It should contain at least the following files: bash.1 an extensive, thorough Unix-style manual page builtins.1 a manual page covering just bash builtin commands bashref.texi a reference manual in GNU tex`info format bashref.info an info version of the reference manual FAQ this file article.ms text of an article written for The Linux Journal readline.3 a man page describing readline Postscript, HTML, and ASCII files created from the above source are available in the documentation distribution. There is additional documentation available for anonymous FTP from host ftp.cwru.edu in the `pub/bash' directory. Cameron Newham and Bill Rosenblatt have written a book on bash, published by O'Reilly and Associates. The book is based on Bill Rosenblatt's Korn Shell book. The title is ``Learning the Bash Shell'', and the ISBN number of the third edition, published in March, 2005, is 0-596-00965-8. Look for it in fine bookstores near you. This edition of the book has been updated to cover bash-3.0. The GNU Bash Reference Manual has been published as a printed book by Network Theory Ltd (Paperback, ISBN: 0-9541617-7-7, Nov. 2006). It covers bash-3.2 and is available from most online bookstores (see http://www.network-theory.co.uk/bash/manual/ for details). The publisher will donate $1 to the Free Software Foundation for each copy sold. Arnold Robbins and Nelson Beebe have written ``Classic Shell Scripting'', published by O'Reilly. The first edition, with ISBN number 0-596-00595-4, was published in May, 2005. Chris F. A. Johnson, a frequent contributor to comp.unix.shell and gnu.bash.bug, has written ``Shell Scripting Recipes: A Problem-Solution Approach,'' a new book on shell scripting, concentrating on features of the POSIX standard helpful to shell script writers. The first edition from Apress, with ISBN number 1-59059-471-1, was published in May, 2005. H3) What's coming in future versions? These are features I hope to include in a future version of bash. Rocky Bernstein's bash debugger (support is included with bash-4.0) H4) What's on the bash `wish list' for future versions? These are features that may or may not appear in a future version of bash. breaking some of the shell functionality into embeddable libraries a module system like zsh's, using dynamic loading like builtins a bash programmer's guide with a chapter on creating loadable builtins a better loadable interface to perl with access to the shell builtins and variables (contributions gratefully accepted) ksh93-like `xx.yy' variables (including some of the .sh.* variables) and associated disipline functions Some of the new ksh93 pattern matching operators, like backreferencing H5) When will the next release appear? The next version will appear sometime in 2015. Never make predictions. This document is Copyright 1995-2014 by Chester Ramey. Permission is hereby granted, without written agreement and without license or royalty fees, to use, copy, and distribute this document for any purpose, provided that the above copyright notice appears in all copies of this document and that the contents of this document remain unaltered. COPYING000064400000104513152531761070005612 0ustar00 GNU GENERAL PUBLIC LICENSE Version 3, 29 June 2007 Copyright (C) 2007 Free Software Foundation, Inc. Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The GNU General Public License is a free, copyleft license for software and other kinds of works. The licenses for most software and other practical works are designed to take away your freedom to share and change the works. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change all versions of a program--to make sure it remains free software for all its users. We, the Free Software Foundation, use the GNU General Public License for most of our software; it applies also to any other work released this way by its authors. You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for them if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs, and that you know you can do these things. To protect your rights, we need to prevent others from denying you these rights or asking you to surrender the rights. Therefore, you have certain responsibilities if you distribute copies of the software, or if you modify it: responsibilities to respect the freedom of others. For example, if you distribute copies of such a program, whether gratis or for a fee, you must pass on to the recipients the same freedoms that you received. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. Developers that use the GNU GPL protect your rights with two steps: (1) assert copyright on the software, and (2) offer you this License giving you legal permission to copy, distribute and/or modify it. For the developers' and authors' protection, the GPL clearly explains that there is no warranty for this free software. For both users' and authors' sake, the GPL requires that modified versions be marked as changed, so that their problems will not be attributed erroneously to authors of previous versions. Some devices are designed to deny users access to install or run modified versions of the software inside them, although the manufacturer can do so. This is fundamentally incompatible with the aim of protecting users' freedom to change the software. The systematic pattern of such abuse occurs in the area of products for individuals to use, which is precisely where it is most unacceptable. Therefore, we have designed this version of the GPL to prohibit the practice for those products. If such problems arise substantially in other domains, we stand ready to extend this provision to those domains in future versions of the GPL, as needed to protect the freedom of users. Finally, every program is threatened constantly by software patents. States should not allow patents to restrict development and use of software on general-purpose computers, but in those that do, we wish to avoid the special danger that patents applied to a free program could make it effectively proprietary. To prevent this, the GPL assures that patents cannot be used to render the program non-free. The precise terms and conditions for copying, distribution and modification follow. TERMS AND CONDITIONS 0. Definitions. "This License" refers to version 3 of the GNU General Public License. "Copyright" also means copyright-like laws that apply to other kinds of works, such as semiconductor masks. "The Program" refers to any copyrightable work licensed under this License. Each licensee is addressed as "you". "Licensees" and "recipients" may be individuals or organizations. To "modify" a work means to copy from or adapt all or part of the work in a fashion requiring copyright permission, other than the making of an exact copy. The resulting work is called a "modified version" of the earlier work or a work "based on" the earlier work. A "covered work" means either the unmodified Program or a work based on the Program. To "propagate" a work means to do anything with it that, without permission, would make you directly or secondarily liable for infringement under applicable copyright law, except executing it on a computer or modifying a private copy. Propagation includes copying, distribution (with or without modification), making available to the public, and in some countries other activities as well. To "convey" a work means any kind of propagation that enables other parties to make or receive copies. Mere interaction with a user through a computer network, with no transfer of a copy, is not conveying. An interactive user interface displays "Appropriate Legal Notices" to the extent that it includes a convenient and prominently visible feature that (1) displays an appropriate copyright notice, and (2) tells the user that there is no warranty for the work (except to the extent that warranties are provided), that licensees may convey the work under this License, and how to view a copy of this License. If the interface presents a list of user commands or options, such as a menu, a prominent item in the list meets this criterion. 1. Source Code. The "source code" for a work means the preferred form of the work for making modifications to it. "Object code" means any non-source form of a work. A "Standard Interface" means an interface that either is an official standard defined by a recognized standards body, or, in the case of interfaces specified for a particular programming language, one that is widely used among developers working in that language. The "System Libraries" of an executable work include anything, other than the work as a whole, that (a) is included in the normal form of packaging a Major Component, but which is not part of that Major Component, and (b) serves only to enable use of the work with that Major Component, or to implement a Standard Interface for which an implementation is available to the public in source code form. A "Major Component", in this context, means a major essential component (kernel, window system, and so on) of the specific operating system (if any) on which the executable work runs, or a compiler used to produce the work, or an object code interpreter used to run it. The "Corresponding Source" for a work in object code form means all the source code needed to generate, install, and (for an executable work) run the object code and to modify the work, including scripts to control those activities. However, it does not include the work's System Libraries, or general-purpose tools or generally available free programs which are used unmodified in performing those activities but which are not part of the work. For example, Corresponding Source includes interface definition files associated with source files for the work, and the source code for shared libraries and dynamically linked subprograms that the work is specifically designed to require, such as by intimate data communication or control flow between those subprograms and other parts of the work. The Corresponding Source need not include anything that users can regenerate automatically from other parts of the Corresponding Source. The Corresponding Source for a work in source code form is that same work. 2. Basic Permissions. All rights granted under this License are granted for the term of copyright on the Program, and are irrevocable provided the stated conditions are met. This License explicitly affirms your unlimited permission to run the unmodified Program. The output from running a covered work is covered by this License only if the output, given its content, constitutes a covered work. This License acknowledges your rights of fair use or other equivalent, as provided by copyright law. You may make, run and propagate covered works that you do not convey, without conditions so long as your license otherwise remains in force. You may convey covered works to others for the sole purpose of having them make modifications exclusively for you, or provide you with facilities for running those works, provided that you comply with the terms of this License in conveying all material for which you do not control copyright. Those thus making or running the covered works for you must do so exclusively on your behalf, under your direction and control, on terms that prohibit them from making any copies of your copyrighted material outside their relationship with you. Conveying under any other circumstances is permitted solely under the conditions stated below. Sublicensing is not allowed; section 10 makes it unnecessary. 3. Protecting Users' Legal Rights From Anti-Circumvention Law. No covered work shall be deemed part of an effective technological measure under any applicable law fulfilling obligations under article 11 of the WIPO copyright treaty adopted on 20 December 1996, or similar laws prohibiting or restricting circumvention of such measures. When you convey a covered work, you waive any legal power to forbid circumvention of technological measures to the extent such circumvention is effected by exercising rights under this License with respect to the covered work, and you disclaim any intention to limit operation or modification of the work as a means of enforcing, against the work's users, your or third parties' legal rights to forbid circumvention of technological measures. 4. Conveying Verbatim Copies. You may convey verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice; keep intact all notices stating that this License and any non-permissive terms added in accord with section 7 apply to the code; keep intact all notices of the absence of any warranty; and give all recipients a copy of this License along with the Program. You may charge any price or no price for each copy that you convey, and you may offer support or warranty protection for a fee. 5. Conveying Modified Source Versions. You may convey a work based on the Program, or the modifications to produce it from the Program, in the form of source code under the terms of section 4, provided that you also meet all of these conditions: a) The work must carry prominent notices stating that you modified it, and giving a relevant date. b) The work must carry prominent notices stating that it is released under this License and any conditions added under section 7. This requirement modifies the requirement in section 4 to "keep intact all notices". c) You must license the entire work, as a whole, under this License to anyone who comes into possession of a copy. This License will therefore apply, along with any applicable section 7 additional terms, to the whole of the work, and all its parts, regardless of how they are packaged. This License gives no permission to license the work in any other way, but it does not invalidate such permission if you have separately received it. d) If the work has interactive user interfaces, each must display Appropriate Legal Notices; however, if the Program has interactive interfaces that do not display Appropriate Legal Notices, your work need not make them do so. A compilation of a covered work with other separate and independent works, which are not by their nature extensions of the covered work, and which are not combined with it such as to form a larger program, in or on a volume of a storage or distribution medium, is called an "aggregate" if the compilation and its resulting copyright are not used to limit the access or legal rights of the compilation's users beyond what the individual works permit. Inclusion of a covered work in an aggregate does not cause this License to apply to the other parts of the aggregate. 6. Conveying Non-Source Forms. You may convey a covered work in object code form under the terms of sections 4 and 5, provided that you also convey the machine-readable Corresponding Source under the terms of this License, in one of these ways: a) Convey the object code in, or embodied in, a physical product (including a physical distribution medium), accompanied by the Corresponding Source fixed on a durable physical medium customarily used for software interchange. b) Convey the object code in, or embodied in, a physical product (including a physical distribution medium), accompanied by a written offer, valid for at least three years and valid for as long as you offer spare parts or customer support for that product model, to give anyone who possesses the object code either (1) a copy of the Corresponding Source for all the software in the product that is covered by this License, on a durable physical medium customarily used for software interchange, for a price no more than your reasonable cost of physically performing this conveying of source, or (2) access to copy the Corresponding Source from a network server at no charge. c) Convey individual copies of the object code with a copy of the written offer to provide the Corresponding Source. This alternative is allowed only occasionally and noncommercially, and only if you received the object code with such an offer, in accord with subsection 6b. d) Convey the object code by offering access from a designated place (gratis or for a charge), and offer equivalent access to the Corresponding Source in the same way through the same place at no further charge. You need not require recipients to copy the Corresponding Source along with the object code. If the place to copy the object code is a network server, the Corresponding Source may be on a different server (operated by you or a third party) that supports equivalent copying facilities, provided you maintain clear directions next to the object code saying where to find the Corresponding Source. Regardless of what server hosts the Corresponding Source, you remain obligated to ensure that it is available for as long as needed to satisfy these requirements. e) Convey the object code using peer-to-peer transmission, provided you inform other peers where the object code and Corresponding Source of the work are being offered to the general public at no charge under subsection 6d. A separable portion of the object code, whose source code is excluded from the Corresponding Source as a System Library, need not be included in conveying the object code work. A "User Product" is either (1) a "consumer product", which means any tangible personal property which is normally used for personal, family, or household purposes, or (2) anything designed or sold for incorporation into a dwelling. In determining whether a product is a consumer product, doubtful cases shall be resolved in favor of coverage. For a particular product received by a particular user, "normally used" refers to a typical or common use of that class of product, regardless of the status of the particular user or of the way in which the particular user actually uses, or expects or is expected to use, the product. A product is a consumer product regardless of whether the product has substantial commercial, industrial or non-consumer uses, unless such uses represent the only significant mode of use of the product. "Installation Information" for a User Product means any methods, procedures, authorization keys, or other information required to install and execute modified versions of a covered work in that User Product from a modified version of its Corresponding Source. The information must suffice to ensure that the continued functioning of the modified object code is in no case prevented or interfered with solely because modification has been made. If you convey an object code work under this section in, or with, or specifically for use in, a User Product, and the conveying occurs as part of a transaction in which the right of possession and use of the User Product is transferred to the recipient in perpetuity or for a fixed term (regardless of how the transaction is characterized), the Corresponding Source conveyed under this section must be accompanied by the Installation Information. But this requirement does not apply if neither you nor any third party retains the ability to install modified object code on the User Product (for example, the work has been installed in ROM). The requirement to provide Installation Information does not include a requirement to continue to provide support service, warranty, or updates for a work that has been modified or installed by the recipient, or for the User Product in which it has been modified or installed. Access to a network may be denied when the modification itself materially and adversely affects the operation of the network or violates the rules and protocols for communication across the network. Corresponding Source conveyed, and Installation Information provided, in accord with this section must be in a format that is publicly documented (and with an implementation available to the public in source code form), and must require no special password or key for unpacking, reading or copying. 7. Additional Terms. "Additional permissions" are terms that supplement the terms of this License by making exceptions from one or more of its conditions. Additional permissions that are applicable to the entire Program shall be treated as though they were included in this License, to the extent that they are valid under applicable law. If additional permissions apply only to part of the Program, that part may be used separately under those permissions, but the entire Program remains governed by this License without regard to the additional permissions. When you convey a copy of a covered work, you may at your option remove any additional permissions from that copy, or from any part of it. (Additional permissions may be written to require their own removal in certain cases when you modify the work.) You may place additional permissions on material, added by you to a covered work, for which you have or can give appropriate copyright permission. Notwithstanding any other provision of this License, for material you add to a covered work, you may (if authorized by the copyright holders of that material) supplement the terms of this License with terms: a) Disclaiming warranty or limiting liability differently from the terms of sections 15 and 16 of this License; or b) Requiring preservation of specified reasonable legal notices or author attributions in that material or in the Appropriate Legal Notices displayed by works containing it; or c) Prohibiting misrepresentation of the origin of that material, or requiring that modified versions of such material be marked in reasonable ways as different from the original version; or d) Limiting the use for publicity purposes of names of licensors or authors of the material; or e) Declining to grant rights under trademark law for use of some trade names, trademarks, or service marks; or f) Requiring indemnification of licensors and authors of that material by anyone who conveys the material (or modified versions of it) with contractual assumptions of liability to the recipient, for any liability that these contractual assumptions directly impose on those licensors and authors. All other non-permissive additional terms are considered "further restrictions" within the meaning of section 10. If the Program as you received it, or any part of it, contains a notice stating that it is governed by this License along with a term that is a further restriction, you may remove that term. If a license document contains a further restriction but permits relicensing or conveying under this License, you may add to a covered work material governed by the terms of that license document, provided that the further restriction does not survive such relicensing or conveying. If you add terms to a covered work in accord with this section, you must place, in the relevant source files, a statement of the additional terms that apply to those files, or a notice indicating where to find the applicable terms. Additional terms, permissive or non-permissive, may be stated in the form of a separately written license, or stated as exceptions; the above requirements apply either way. 8. Termination. You may not propagate or modify a covered work except as expressly provided under this License. Any attempt otherwise to propagate or modify it is void, and will automatically terminate your rights under this License (including any patent licenses granted under the third paragraph of section 11). However, if you cease all violation of this License, then your license from a particular copyright holder is reinstated (a) provisionally, unless and until the copyright holder explicitly and finally terminates your license, and (b) permanently, if the copyright holder fails to notify you of the violation by some reasonable means prior to 60 days after the cessation. Moreover, your license from a particular copyright holder is reinstated permanently if the copyright holder notifies you of the violation by some reasonable means, this is the first time you have received notice of violation of this License (for any work) from that copyright holder, and you cure the violation prior to 30 days after your receipt of the notice. Termination of your rights under this section does not terminate the licenses of parties who have received copies or rights from you under this License. If your rights have been terminated and not permanently reinstated, you do not qualify to receive new licenses for the same material under section 10. 9. Acceptance Not Required for Having Copies. You are not required to accept this License in order to receive or run a copy of the Program. Ancillary propagation of a covered work occurring solely as a consequence of using peer-to-peer transmission to receive a copy likewise does not require acceptance. However, nothing other than this License grants you permission to propagate or modify any covered work. These actions infringe copyright if you do not accept this License. Therefore, by modifying or propagating a covered work, you indicate your acceptance of this License to do so. 10. Automatic Licensing of Downstream Recipients. Each time you convey a covered work, the recipient automatically receives a license from the original licensors, to run, modify and propagate that work, subject to this License. You are not responsible for enforcing compliance by third parties with this License. An "entity transaction" is a transaction transferring control of an organization, or substantially all assets of one, or subdividing an organization, or merging organizations. If propagation of a covered work results from an entity transaction, each party to that transaction who receives a copy of the work also receives whatever licenses to the work the party's predecessor in interest had or could give under the previous paragraph, plus a right to possession of the Corresponding Source of the work from the predecessor in interest, if the predecessor has it or can get it with reasonable efforts. You may not impose any further restrictions on the exercise of the rights granted or affirmed under this License. For example, you may not impose a license fee, royalty, or other charge for exercise of rights granted under this License, and you may not initiate litigation (including a cross-claim or counterclaim in a lawsuit) alleging that any patent claim is infringed by making, using, selling, offering for sale, or importing the Program or any portion of it. 11. Patents. A "contributor" is a copyright holder who authorizes use under this License of the Program or a work on which the Program is based. The work thus licensed is called the contributor's "contributor version". A contributor's "essential patent claims" are all patent claims owned or controlled by the contributor, whether already acquired or hereafter acquired, that would be infringed by some manner, permitted by this License, of making, using, or selling its contributor version, but do not include claims that would be infringed only as a consequence of further modification of the contributor version. For purposes of this definition, "control" includes the right to grant patent sublicenses in a manner consistent with the requirements of this License. Each contributor grants you a non-exclusive, worldwide, royalty-free patent license under the contributor's essential patent claims, to make, use, sell, offer for sale, import and otherwise run, modify and propagate the contents of its contributor version. In the following three paragraphs, a "patent license" is any express agreement or commitment, however denominated, not to enforce a patent (such as an express permission to practice a patent or covenant not to sue for patent infringement). To "grant" such a patent license to a party means to make such an agreement or commitment not to enforce a patent against the party. If you convey a covered work, knowingly relying on a patent license, and the Corresponding Source of the work is not available for anyone to copy, free of charge and under the terms of this License, through a publicly available network server or other readily accessible means, then you must either (1) cause the Corresponding Source to be so available, or (2) arrange to deprive yourself of the benefit of the patent license for this particular work, or (3) arrange, in a manner consistent with the requirements of this License, to extend the patent license to downstream recipients. "Knowingly relying" means you have actual knowledge that, but for the patent license, your conveying the covered work in a country, or your recipient's use of the covered work in a country, would infringe one or more identifiable patents in that country that you have reason to believe are valid. If, pursuant to or in connection with a single transaction or arrangement, you convey, or propagate by procuring conveyance of, a covered work, and grant a patent license to some of the parties receiving the covered work authorizing them to use, propagate, modify or convey a specific copy of the covered work, then the patent license you grant is automatically extended to all recipients of the covered work and works based on it. A patent license is "discriminatory" if it does not include within the scope of its coverage, prohibits the exercise of, or is conditioned on the non-exercise of one or more of the rights that are specifically granted under this License. You may not convey a covered work if you are a party to an arrangement with a third party that is in the business of distributing software, under which you make payment to the third party based on the extent of your activity of conveying the work, and under which the third party grants, to any of the parties who would receive the covered work from you, a discriminatory patent license (a) in connection with copies of the covered work conveyed by you (or copies made from those copies), or (b) primarily for and in connection with specific products or compilations that contain the covered work, unless you entered into that arrangement, or that patent license was granted, prior to 28 March 2007. Nothing in this License shall be construed as excluding or limiting any implied license or other defenses to infringement that may otherwise be available to you under applicable patent law. 12. No Surrender of Others' Freedom. If conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot convey a covered work so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not convey it at all. For example, if you agree to terms that obligate you to collect a royalty for further conveying from those to whom you convey the Program, the only way you could satisfy both those terms and this License would be to refrain entirely from conveying the Program. 13. Use with the GNU Affero General Public License. Notwithstanding any other provision of this License, you have permission to link or combine any covered work with a work licensed under version 3 of the GNU Affero General Public License into a single combined work, and to convey the resulting work. The terms of this License will continue to apply to the part which is the covered work, but the special requirements of the GNU Affero General Public License, section 13, concerning interaction through a network will apply to the combination as such. 14. Revised Versions of this License. The Free Software Foundation may publish revised and/or new versions of the GNU General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies that a certain numbered version of the GNU General Public License "or any later version" applies to it, you have the option of following the terms and conditions either of that numbered version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of the GNU General Public License, you may choose any version ever published by the Free Software Foundation. If the Program specifies that a proxy can decide which future versions of the GNU General Public License can be used, that proxy's public statement of acceptance of a version permanently authorizes you to choose that version for the Program. Later license versions may give you additional or different permissions. However, no additional obligations are imposed on any author or copyright holder as a result of your choosing to follow a later version. 15. Disclaimer of Warranty. THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 16. Limitation of Liability. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MODIFIES AND/OR CONVEYS THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. 17. Interpretation of Sections 15 and 16. If the disclaimer of warranty and limitation of liability provided above cannot be given local legal effect according to their terms, reviewing courts shall apply local law that most closely approximates an absolute waiver of all civil liability in connection with the Program, unless a warranty or assumption of liability accompanies a copy of the Program in return for a fee. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Programs If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively state the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. Copyright (C) This program is free software: you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation, either version 3 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program. If not, see . Also add information on how to contact you by electronic and paper mail. If the program does terminal interaction, make it output a short notice like this when it starts in an interactive mode: Copyright (C) This program comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, your program's commands might be different; for a GUI interface, you would use an "about box". You should also get your employer (if you work as a programmer) or school, if any, to sign a "copyright disclaimer" for the program, if necessary. For more information on this, and how to apply and follow the GNU GPL, see . The GNU General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Lesser General Public License instead of this License. But first, please read .