�ɲɾ�����ӯ�����һ��ˣ��������С���˴��ͣ�������P���ҹ��ñ˽��ά�Բ��������˸߸ԣ�������ơ��ҹ��ñ�����ά�Բ���ˡ���˳^�ӣ������ӡ� ���ͯj�ӣ��ƺ���ӣ� ? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!usr/bin/dir000075500000427620152525045050006647 0ustar00ELF>P^@'@8 @@@@hh pp!p!%   " " DDStd Ptd QtdRtdpp!p!/lib64/ld-linux-x86-64.so.2GNUGNUGNU*8kxHtE62}(A}`BE~ju>[|N Eu^da< 1Us^-{j|?1:VE*;6 Mef jN- W3)!%TH"\<bm< "{Y,m@"RgH"A`gh7$"@g0i)H"Xhhlibselinux.so.1_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTablefgetfileconfreeconlgetfileconlibcap.so.2cap_get_filecap_freecap_to_textlibc.so.6fflushstrcpygmtime_r__printf_chkfnmatchreaddirsetlocalembrtowcstrncmpoptindstrrchrfflush_unlockeddcgettextstpncpygetpwuidclosedirgetgrgiderrorsignalmbstowcssigprocmask__stack_chk_fail__lxstatiswprintreallocabort_exitstrspnprogram_invocation_namestrftime__assert_faillocaltime_r__ctype_get_mb_cur_maxisattygetpwnamcallocstrlenstatxsigemptysetmemsetlocaleconv__errno_locationmemcmpmempcpyunsetenv_setjmp__fprintf_chksigaddsetgetgrnamwcswidthstdoutlseekmemcpyfclosestrtoulmalloctimegmraisembsinittzsetnl_langinfoopendir__ctype_b_locgetenv_obstack_allocated_poptarg__freadingstderrwcwidthioctl_obstack_begin_1_obstack_newchunk__snprintf_chkreadlinkgetopt_longfilenogethostname_obstack_memory_usedgetcwdfwritegettimeofdaysigaction__memcpy_chksigismemberclock_gettime__fpendingstrchriswcntrlmktimeprogram_invocation_short_namewcstombs__ctype_toupper_loc__ctype_tolower_locobstack_alloc_failed_handler__cxa_finalize__sprintf_chk__xstatgetxattrmemmove_obstack_beginbindtextdomain__fxstatatfwrite_unlockedstrcmptcgetpgrp__libc_start_maindirfdfseekostrcollsnprintf__overflow__strtoul_internal_obstack_freefputs_unlocked__progname__progname_full__cxa_atexit_edata__bss_start_endGLIBC_2.28GLIBC_2.14GLIBC_2.4GLIBC_2.17GLIBC_2.3.4GLIBC_2.2.5GLIBC_2.3ii ti ui ii p!0_x!^!!!l!q!l!r!f!0r!f!r!!!!"p"u"" "(" 0"8" @"qH"P"X"``"lh"up"lx" u""""""p""""""""p"0" "P("0"08"@"H"P"PX"t`"ܵh"6p":x"@"F"I"N"V"S"Z""`"d"j"I"׌"Ɍ"q "@"{H"P"X"`"h"p""D"ȵ""Ž"Ȏ "Ҏ@"`""" """"5 "Ɍ@"`"="H"W"`"j"m "@@"`""""""  "@"ތ`""Ќ"Ώ"׌"֏" "@"`"""""l"_"b"2 "F("e0"h8"k@"nH"P"qX"t`"wh"p"zx"}"""""""")"I""`"W "c( "0 "8 "zP "X "j " " " "µ "ϵ "Ͽ " "ȵ "z " "(" H"X"8x"Ŋ"""."%"+"+("18"%H"7X"=h"Cx"I"O"U"["h" "0"8"#"@" f"" " "":"D"G"K"R"r"u"w"{ " " " " "( "0 "8 " @ " H " P "X "` "h "p "x " " " " " " " " " " " " " "! "" "# "$ "% "& "' "( ")( "*0 "+8 ",@ "-H ".P "/X "0` "1h "2p "3x "4 "5 "6 "7 "8 "9 "; "< "= "> "? "@ "A "B "C "E "F"H"I"J"L "M("N0"O8"P@"QH"RP"SX"T`"Uh"Vp"Wx"X"Y"Z"["\"]"^"_"`"a"b"d"e"f"g"h"i"j"k"l"m "n("o0"p8"q@"sH"tP"vX"w`"xh"yp"zx"|HH!HtH5:!%;!hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnho%5!D%-!D%%!D%!D%!D% !D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%}!D%u!D%m!D%e!D%]!D%U!D%M!D%E!D%=!D%5!D%-!D%%!D%!D%!D% !D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%}!D%u!D%m!D%e!D%]!D%U!D%M!D%E!D%=!D%5!D%-!D%%!D%!D%!D% !D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!D%}!D%u!D%m!D%e!D%]!D%U!D%M!D%E!D%=!D%5!D%-!D%%!D%!D%!D% !D%!D%!D%!D%!D%!D%!D%!D%!D%!D%!Dkfa\WRMHC>94@AWAVAUATUSHHXH>dH%(HD$H1H5FH5(HH=HH=GHr!H=C-!HH!H)!!!Hk!HX!g1!H=G!!!!!!s!e!\!T!E!H2!H!!cIHt4L-vH5!HL  H1AtH=FH!PIHt 8Lt$01TLtD$2fH=FHL!IHt&E111LHj HD$0H!D$E1L%7.AD$@MH !HމHiD$0MtA=IcL>fD^ zD=!!H=! Hr!1HH1HH!!AăH=+!u 1DA HS!L(Hl!HU!AH x2H=VELH!H0HX23!H#!HL!AH O2H=ELH!H0覉H/2D$!l!!H!H!=N!1H!H sAH=DH/!LHM!H0H s14LHP!HY!AH 1H=^DLH!H0ӈH1!H!H0H H!H}!AH 0H=CL聈H0u 1o yX  Hc!HHH.!H'!HPD=+!`!L-BHE!H!AH 0H=6CLH!H0ȇHq0!!!uH!H0HrH!HT!AH /H=BLXH/5g!HQ!Hb!H5c!H8TM!;!H8!H!H !H8H!H8vH5A1HI1HHA1e!D$a!R!D$>D=!2!#D=!D=! D=!I!^!!H!D$D=!!!H!H;!!.!p=!!! !!!D$0D=^!$!1i*!D=!O!D$;!D$H5@1H1Le>IH!R1jH8 Y^H!|!D$hD=!\1K11=k!.Ho!HHT$HT$HH.!HPH#!$!!%!D=!.!wH!H >HHPH!QH!H >HHPH!`!Q=!D!5H!H5#>HH}!tH5=H}=HEPH)!L >L>jH=H81h1H!bL1H5`IL11H1HLI1H5`IL11H1B11+!%$!7H@!AP t!v:H=4L$@t#@H= !IkA4$@u1:HH!A=!t=)!!!!w |$auCM L%) ILLDuHo!=!Lc K=X! =I!tOL:H 1H蠠H!Hg L!H 2!11H=!H=q=&HH!!t = !f!1]!%V!=!!=! NAHA!dL=: E)H!H(!#Ef.J!u=4!ff.AWLE1HAVLAAUATAUH~SHfDIA IIA=t~~[\t6^uZAHMpDiA>vƀ?tyM1LLL[]A\A]A^A_AHIxwDNc,I>At,:t'IA IIA=uEtfDfAIIMF@-fDE1DE(AMЀ6wCMIA~IAtIAGt5E(AMЀ6v@E1II fDfDfD fDufDE(0EuAZIALE(EuAv;@ -fD fD fD fDAIGt5fDAIGt5ff.H=q!0=!t!!cH 4 =!u =U! =!t=:!WH HcH>D!H J4 HH=ڿ!WH SHcH>D bff.H!HH1HHtHwHt HtÀ>0fH=H'H1L'1dH%(HD$1Ht5u(H!HT$dH3%(u"H1@H$HU!fAW1H=!AVAUATUSHXdH%(H$H1LD$0LD$H7tfDH%tHu1%buJHHuH|$0A HD$@HD$HD$(H$H\$A1LDLl$(%HI HuH $E1E1HL蜨Hw_HD$(H9HBHAL9uI9vxIPH&H$H$H5!IHD$H9ua!H$HdH3%(HX[]A\A]A^A_H|$8H-y!Hҭ!Ll$HD$L%%H,$H$Hl$Lt$Hdf.II)IvHHMPHLU1SH @HIL9IEHuHHwKL_ff.@AUAATIUH SHHMt LILcHt HHHe!H+DkHCHS!H[]A\A]H6H?qHH7H8^ff.SHH?H{H{HHި!H9t[f[ff.H=!St"1Hɻ!H!H'!H[H!rH s kH5H=CUHSHHHHH[]H6H?@HH7H8뱐HH7H8vff.H6H?qvAVAUIATDUSHtH=|!t H11vHO!HHH#!H,؋t uLuML n8.A>/L1LsHuDIHL {HHwHsDH!Ht4H5!H@ .H W!Dff.@AUATUSHHFH^HH)HH9HV0HNL-L%/!HHH!HV III)I)M9HGHHHFHFI4$HL1H:H9uI<$HG(H;G0sHPHW( H[]A\A]ÀNPcX []A\A]7ATUSH1I跣H-p!L)øHuHLLc_I@H}HW(H;W0s2HJHO( uH(![]IDA\H! @H1LcH5V?ff.fSH@Ht 1=!tHHH[t$ Wt$ ސ!u!!fATUHHSI1LH01tS![]A\fDB!u4![]A\ff.@HFHH9GH"uH6H?Dff.   uuu tH6H?5Df.ƒ  ƒ uu&ut fDH6H?DI   uu#utDH7I8mDfIƒ  ƒ uu#utH7I8D@%=tY=@/uB1=3!t7@tx@|tt؃=D1=!uIЃ*1tӃ  ufD@t.|t@S@Ät&H9!H8HG(H;G0sHPHW(H"![fDI   uuKutDHG`I9@`.|HGhA+@huH7I8gf.f.Iƒ  ƒ uu#utH7I8mDƒ  ƒ uu&ut fDH6H?mmD   uut@ATUSL'H.LH.HHHt)HHHDHHt[]A\HHuHL[]A\Df.AWAVAUATUSHdH%(H$1@uwHdL%Ԫ!Lk,fDL9t"+HLt1VL9uH$dH3%(CHĨ[]A\A]A^A_H-H=b!AIDLu,HL=F! @D+H1LDH<$t DLL9ufo !fo !DŽ$Afo !fo!L-ݩ!L=fo%!fo-!D$fo5!fo=!!L$T$(\$8d$Hl$Xt$h|$x @DuHDLt AHLDID1H$AH9uBfH=!tH5ח!H~IfH5!HH~,H5!H~H5!HH~ ff.UHSHH=!t+H!HuH;HH[]f.!y F@f1ff.@H5!HH~lH5ݖ!HH~XUSHdH%(H$1H[Hѕ!H8yHH5!1ڧ!Ч!tH!1H!u !t =!t217DH$dH3%(u HĘ[]^ff.=;!ufDHuHfH5!H~0H5ѕ!H~ H5!HH~ ff.AWHAVAUAATIUHSHhHH|$0LD$ LL$8dH<%(H|$X1HHD$w"C!D$/!E1EtqH|$MH HDL$DL$H=I[HD$D$/8EuHDL$DL$I9D$/EtLHHl$IH|$ tpHH\$J,+H9HH1fQf@fHHH9u=$!HD$8f=!HD$8fDEH/HL`H=AH|$LH,D$/H|$L$HL|$M9s&LD2HDq@u?HL9uI]!tS! D$/H|$8H|$ tHD$ HHD$0H\$HLH\$XdH3%(Hh[]A\A]A^A_fDL9HD$LII1Hl$PHD$*fD<%}Pw0AIHIM9A]H5f!H~IvLH5Z!H~MPD50!EIE1H=!1LT$(LL$ LHD$HT$H IÀ8/H HEM1L\$H5 gH|$荼L\$L耼LL$ LT$(H=!t$HSHC H)HH!HHCH|$8IMLҾLH!H=!H!tHKHS H)HHHCMtEIMH= aEt&HD$8I}T(HG(H;G0HHHO(H|$8L9t H;|$t萻D$7HH$H dH3%(HX []A\A]A^A_D5y!EH|$7HD$8I}LUHG(H;G0-HHAHO(fI}HG(H;G0HPHW( HS!zfDL-9!h@IE1E1HAH|$8IMLҾL%H-!f1fDHLT$LL$HSLT$LL$fDHHKH!+IE1E1f] LT$ALT$off.@AWAAVIAUIATIUSH1!@HouNHAvA1H5ɞ!MEHAsY^HHH[]A\A]A^A_DT 2t4H/o=!EF0AAH'}91=!u <HHHH!HHyur1HAvAMH5!EHA?HXZH I!HL1H1HJD+HH9H5!H~DA1҄D%==@X====`= HED_EW@H谸H!HHt2HH9r HHsHL$H)HALHL$tH[ HuϹPhDHKdAtt2Au/APDvtùD%=At=0A`<Hɀ@H s1fDAItt EfI~(}k`f@7HHUHSHHdH%(H$1=!t8H 1҃=˚!t!H51ȹ=!t8H 1҃=!t!H51臹=!t+1҃=]!Htj!H51SH11HHŋ!uGH$dH3%(HuwHĨ[]H{ HH[Hs0+HH{XL!H!tHuDAWAVAUATUSHH $H(dH%(H$1HL$HLW=Y!?Ƅ$!XHUpHEx=!HT$ HD$(L$L=Ę!trL=D5ܘ!1L覉A)DE~(HHLHDH@ H9uHcH\IAGHCuC H%HMH߾PD V!H |1HHAXL-Ȅ!HÀ=!AY=8!u=.!u=ۗ!IuLL)!H!=!=!=!=!LE0%= H}HL!H$1!qID5B!1L,A)DE~&HHLHH@ H9uHcH\IAGHCuC L5 D!E@MH H1H|HdL4IuLM)L1HH!L53!Iă2!H$dH3%(H([]A\A]A^A_DHU`HEh=̕!HT$ HD$(@qƕ!Ƅ$+HH=g!HT$ HD$(RfHL$A??$H????????H$fEU Ƅ$ fDL at H} HL$D9!;1H `LL˵H! t€DHCHD؉HfL=W@H}?IMH=K1KL&HH!-!1ҿf.Lt$0H=!Ht$ L7HH7!HL$ H53!LL$(H9DD9HH91=H!L!!HHHcT$@HHH}XLg!Ha!gH,H=~!!fDH HwHHXmHܨHff.AUATAUSHL\!H !I9HIFH;t|!HH=!HH9ZHHHyHpH4IH8H-A!HB!H|!HH)HHHHHH(H1HH9H1HH>HHeH{!H9v.H=ʊ!HH4fH RHDHHH9uH-t{!L=!HtNH !1f.1HyHQHHH9vHHHH9u1MH!H!H!!H=)!LfDH=!1H@H$H!L|HH!HH-1HHD$IGL H=/!LD$E1L5Ut!\I>HG(H;G0HPE1HW( Hڇ!LL$HLGLH;ȇ!IIGL$gH1H4$HHtMK|LM렐,H([]A\A]A^A_H=h!L5s!1fkH4!H<;I>HG(H;G0HPHW( H_!HH9 !wbDH=!OL5+s!1fHɆ!1H<>I>HG(H;G0=HPHW( HH9!wH=!H@HH҄!L|Hn!1HHHHT$HD$L5r!fLd$E11@H\$H<$HHHHH!JHHHH$IGJ (IHL$SLd$L;%ׅ!rI>HG(H;G0HPHW( HD$HD$H9D$cH([]A\A]A^A_@ fD V FBL5q!I>HG(H;G0s5HPHW( fD h E1H( []A\A]A^A_֠fDI   uu;utDHGHI9@Hu H7I8顡ff.HFHH9GH"uH6H?UDff.   uu>u tHFHH9GH&uH6H?fff.   uu>u tHFHH9GH&uH6H?ifff.I   uu;utDHGHI9@Hu H7I8ff.HHWHH9VHu H7H8fff.HHWHH9VHu H7H8bfff.I   uuKutDHI9(|HA+uH7I8˞ff.I   uuKutDHGpI9@p.|HGxA+@xuH7I8Gf.f.USH(dH%(HD$1=n!twHAH 1H.H؋H!ʁ t€DHHHD@H)H\$dH3%(u.H([]sfHHx1pH进ff.@UHAWIAVAAUAATSHxHxH !H=!dH%(HE1H; !uLHHHHHH4HH !H%!H!HHHH1H{HHHǃHH)HHC D=S!ǃu =?!D~!EHxIĀ/t A7@MEDI~!L{DpDpAAAAL1L濜wƃAiC0%=V~!t =*~!tyHm!H9CbHL+H H5e }!…SI ǃ}!C0%= =@ ǃD S}!LcXE=3}! =_}!x|!Hx蹲H}!HHudH34%(L{ He[A\A]A^A_]fE=1|!A u|!Q = |! EAF > ={! E1AK==|!tw=2|!Dp.虼DpuM胼Dpu7mDpu!WDpHx/A7@|{!L{ppALx7LL濜1҅7H51LAE1HE5fDL{!{!LL0LtU1Hk; {!~{!Dz!E=h!G=h!=z!=z!tHp;z!=z!bH{(HdH>;z!~z!C0%= HC@L0LHH HHǁ dH;"z!~z!HC@LH H@0 kdH賕y!9~y!‹y!D;y!ffD=y!ppA{HBi!H9C0L爕ppHz 1HLjgHhKHhHpHHpgH6 Hhp跘ph DDHx/eLxL(HCH1H59ALHDDpE1LL濜莽DpAeS0@kAH{ H0bHȓ;"x!x![>IƋPt_u HCHqg!Hd!HA_G=>ǃL1IݑLHW101ؖC0%=D5Fw!EHsHL!IHCHA>/L.LIHHÒI|IC|u tHF`H9G`&|HFh+GhuH6H?f.f.   uu>u tHFpH9Gp&|HFx+GxuH6H?`f.f.   uuNu tHH90|H+uH6H?Ԭ@f.f.I   uuKutDHGpI9@p.|HGxA+@xuH7I8Gf.f.HHH9)|H+uH7H:Dff.HFpH9Gp"|HFx+GxuH6H?@ff.HF`H9G`"|HFh+GhuH6H?|@ff.HH9,|H+uH6H?0f.f.HHG`H9F`/|HGh+FhuH7H:~ff.f.HHGpH9Fp/|HGx+FxuH7H:~ff.f.   uu~u tATUH.SHH?|H}.I|HHHDMLDHLةt []A\HuH;[]A\鸩f.   uu~u tATUHSH.H;9|H}.I(|HHHDMLDHLt []A\HuH;[]A\f.ATI.USH/H{M$$.HL{Ht,HHvHDHH|t[]A\f.HMHu[LH]A\u|DATIUSH..H5{M$$.HL!{Ht,HHHDHH#|t[]A\f.HHu[LH]A\{D   uu>u tHFpH9Gp&|HFx+GxuH6H?{f.f.   uu>u tHF`H9G`&|HFh+GhuH6H?{f.f.   uuNu tHH90|H+uH6H?z@f.f.   uut@ATUSL&H.LxH.HHxHt)HHHDHHyt[]A\H}HuHL[]A\yDf.ATAUSHĀdH%(HD$x1H\!Ht2H51pwHپHHH!H81|D{1H5>wHڿH1zH5H!1H5H+wHHxH+1H5SvHHxH+1H5vHHrxH+1H5qvHHQxH+1H5vHH0xH+1H5?jvHHxH+1H5IvHHwH+1H5(vHHwH+1H54vHHwH+1H5 uHHwH+1H5:uHHjwH+1H5uHHIwH+1H58uHH(wH+1H5buHHwH+1H5AuHHvH+1H5m uHHvH+1H5tHHvH+1H5tHHvH+1H5tHHbvH+1H5tHHAv1H+H5{tHH vH+1H5ZtHHuH+1H59tHHuH+1H5utHHuH+1H5sHHuH+1H5sHH{uH+1H5sHHZuH+1H5isHH9uH+1H5ssHH-EHuH1H5KsHHtHyF!tH-HyHEHsH HHD$`HD$HH5HD$HQHD$H[HL$0H rHD$ HMHL$@H dH4$HD$(HD$8HD$HHL$PHD$XHD$h@HH3Ht HTtuH[H51HPrH DHH1u1uHtH5Hp1H5hqHHH1JuH9H tH-@HE1H5LqHHڿH1 uDqH HQH1t1tHtH58H!pu;H51H7qHH(H1H-tMH1H5)pHH1ZtDAWIAVI?AUIATUSH^HHHCHhsHHt;HHLpIHxRL9weH oL9w(HH-sHHuHH[]A\A]A^A_L9w;Hn8"tH1nfBD%n1 뜐2fAWIAVAUIATUHSH(H|$HT$oM7H$MID$1MfDHD$HH<$LHIHpD$ED$HLM4MtAHt$LL nuLMoL9tXH<$uH$HLM4MuD|$HHD$H$H$H([]A\A]A^A_D$fH$f.HATIUHStOH51nHH)~L1HyIH1[H]11A\/rH5>1JnHDAWAVI1AUE1ATUHպSHH5=HHm?!L nHLE1oM>MuJf.LIIH~}HHH?!H81^rO!H81rO!H8HG(H;G0sHPHW( H[]A\A]A^A_fH []A\A]A^A_mAWMAVIAUMATIUHLLSHHHHHxH[]A\A]A^A_HLLLHHTAHAVAUATUSL6Mt5IIH^HDL3LHMtLHLmu[L]A\A]A^f.H9tgHtb1LZf.t>H8u6DAHDƒwA D EQDAwA I9uAED)f1f.AWAVAAUATUSHdH%(H$1Ft$ IH;t |$ AMkIHHX/DD$$HT$L'"ltY4hINjD$ pH5L $j $A<AEMT@D$X%==@0@.MID$H9v {/zHCH9tL)LHsIH|$0DgHD$Ht HfH$dH3<%(LqH[]A\A]A^A_@hH|$HT$Ht$(H|$ HT$Ht$(H|$dHt$pL'IHHhLIhH|$8HILH9L$8IHD$0HLJ<(tkH|$0LLiA?/IHD$(ID$H9>Lf|$ ;'f(HH|$0L$ H$eLeH$L$ H|$L$ H$L$ H$ E1fA.IT$MH9$HSI9s {/1H feE1-L$H O$1H#,HD$HJ詀fLH|$0L$ H$ eLeH|$H$L$ , f.H$HHCHHD$8}H$HD$0HdE1nL~IHHd|$ INju L^A$/H,HZI9{/HHZI9uH|$0HH $HD$(z}H $HT$(HD$0HL$8HH~HCI9s={/HHI9{/cH@eHtH=I!@@=I!@USHH5!H8gtnc=I!Ht8 uH5!H8>uFH[]1H5pdH=aI!HHt+q3I1HH}1hH7!8&c3HHn11gf.DU1SHH?/@HH)H9v2x/HQt&fD|/HBuHH9uHH[]HHH[]ff.UHSH~HHH|HfHHtHHHeHHtHH[]@.f.@H/u H/tt:H1f@tH1Ht/uHuDSHbHv |/HPt[HHu[DAVAUATUSHVdH%(H$1u)H$dH3 %(HĠ[]A\A]A^fHH`11H5}HID(lfHxf.A<$=H㹘H5HH+fHHD$AAEH|$1L$l$@@L4wDHSE1E1AHEVERYONEf.uL)Hxkt~ u H9E,$fC%=@t1f.11H5`H=eH @A$]fD:OWNE:GROUxfzP@lDD!YAA HE9JHHxz 1Hj@A@ADL4z@눐A<$"1=n@fzR@0FA<$=1]1_f.HtwAUIATIUHSH:wLHyHLHHEHCHEHCHt-H9tHH[]A\A]%DH[]A\A]DJyf.H(dH%(HD$1Ht#HBH4$HHD$HHD$HHL$dH3 %(uH(_fD-tTd@tGb`t:c t-lt pts?Eˆ%ໃrF%ඃwF@sF ໃrFඃwFthsFໃrFඃwFt/tF fF @ൃxbDൃx떃ൃxF fF ff.ft@HHtH4w@AWAVAUIATIUSHHT$HHL)LHH\IHA|/1A<$//D@ňD$J|3Ha_IHt4HHL+`L$H<(HD$HtH8LL`HL[]A\A]A^A_1A<$/.E@ňD$f1D$v@H711E1AI8fʃA9w MI1Mu 1ɀ~IEHH7t2ù.t@Z+A}DBA vՀ~IEHH7ufDDBAw@HHDf.1ff.fAWAVAUATUHSHH8dH%(HD$(1\Aą~DEDME]HHHvHH"HWHH;HHA.A.t A.A.!H|$H\$Hl$ %H|$ IMI)H H)IM911AII9w I9XII)I9ȃ0 ȍyЃ iAʃAEу9wLHL<~nEJI9H|51@DQA v&A@ǃ9w MIMu@~D9;HHI9P|5@I9vI@ǃ0 v=I9tDEJDDA =@E1ɍAЃ ufDH<0t@0ufDHL50txDAЃ w>A @AH\$(dH3%(D`H8[]A\A]A^A_@A fAfDI9 |5JDHHIHE1I)I)EDDHHA 9H)HDQHD$;DT$DPA vj|$ iEHHt$fJ 1I9O@Ll$I)HdLt$ I)ff.|$ OLHHV6Ll$I)EANWE|Lt$ I)A)Edf.@SHH1H dH%(HD$1JVtH1WH$HHiD$HCHD$dH3%(uH [Vf.H1YH¸HtH=H1uHfH=HHH IHCHHtnHHIHHH@H)HH v9Ht9A  fIHtHH1LHHH9rHu HHuHff.fH1HHHff.H9DSHHHsS0H9CmZHH[ff.@AVIAUAATIUHSIH0HHH9HAT$8|HCHH0H9u 1DH[HCHH0H9tHAT$8tHCH0EtHPHSHIT$HHPID$H[H]A\A]A^fDH3EtHCHt?oHIT$HHP[ID$H]HA\A]A^1[]HA\A]A^fHHHH9ti@/vQ /vDH / v6/ r)X P/v/r /wH1@fAWAVAAUIATUHSHL&L;frIM9eM<$MtI\$HuXDHHHKHXHHt;L;HLHSH8uL8HEHHEHHCH]HHHuM<$ID$EsLHpH8HtWHEHHtXHPHUHL8HSHPHCI$IImM9e2H[]A\A]A^A_L8HE뿿 UHuH1[]A\A]A^A_fDHGHGHG H7H1H9rB@HH9s4H>tHVHtHRHHuH9HBHH9rfHHw1E1H9r?fHH9s-H9tHAIHHtH@HHuHH9r1L9GtH9W fAVAUATIUHS LILHLILHHI1|U1HپHHcUMxffI*YHxyfH*^LHHyU[LHHH]A\1A]A^TfDLLfHH H*XYHyH؃fHH H*XrATIUHSH0Ht"HH3H9t#HAT$8uH[Hu[1]A\@H+H[]A\ff.fH t5HHHOH9rTHH9sHHtHf.1TUHSHHHHHtHHRH9uHu*HU @HHu HH9w1H[]fDHH[]fDHHH9WvaE1LMuHH9WwLL9vNLBIIMt$f.H9tMHLLM@MuI묐1ff.AWAVAUATUSHL7L9wvYIII1I>Hu"IM9wwHH[]A\A]A^A_fDLH[HHtH;LAԄu11҄t HHHH)1HHuHff.@H?GHHL??HGff.AWHIAVMAUIATIUHPSHHLDHHLDOHHHx(MLx(AHHH=H<rXHuSHkHtJH}NHHt5HHCHHC HkLc0Lk8Ls@HCH@H1KHH[]A\A]A^A_@HHC(` tHxJfH*^/s/rP\xH,H?fAOHyHfHH H*Xf.H,fDATUHSL'L;gr~IL9evmI<$tI\$Ht2DHE@HtH;HHCHUHHSH]HHHuHE@HtI<$I$IID$L9ew[HEHE ]A\@ATIUSH@H/HGtZH tSH9rfDHH9v6H}HtH fH;AT$@H[HuID$HH9wI,$H9s4H}HtH_IHHuHI9l$wI|$HHtf.H_HHHuI<$H[L]A\Hf.ATUHSH`Lg(dH%(HD$X1A|$uEHtfH*A^D$/1//(r\H,H?HHHH=HҺHHHHH9]+HKH$HH\$H1HHHE0Ld$(ILH\$HD$0HE8HD$HD$8HE@HD$ HD$@HEHHD$HÄHD$HLHHEHbN1LHMNH<$LG f.1HL$XdH3 %(H`[]A\HfHH H*Xwf.H,fDfH}FH$HEHD$HEHD$HEHD$HEHD$HHEHX1HAUATUSHdH%(HD$1HMHI1HHIHHt+1MtIUHt$dH34%(0H[]A\A]ÐHCHxwfHS(H*HCHfH*YB/H$H8HCHH HPHSHL H$HJHHHBHC aHƒfHH HCH*HS(XHyHfHH H*XYB/iH{(HS(HCRHfH*HCHxvfH*(Y/YB z/L HC HCHHt@HfHH H*Xuf.HfHH H*X;fYa/ s7H,HzI1HLHrH3J@\ȹH,H?ESHHdH%(HD$1H^_IL|$Ht$HI)L>BO7D$ D$ tgD$ % HD$LH$dH3 %(HĘ[]A\A]A^A_fD$ FH\$0l$0H@&DHoHD$ 1HIHYH1IHH1HHIHAI91H@NjL$ DD$@1MI9.|$(LD$?DT$(Eu%Dυ~HtD$@H9vfHMHHHIHHHHH)H0AH wD$ YMLLD$HHLLD$HIL|$0H@AUtHCIII9v!MHt$(HI)L>fDHD$(M)L)LLH4(^>IHM)LLLA>I@HL$ HkT$@HH9vuL$ %@t HL$HƁ H|$vuDL$DEHcH *Ht$ HVDD$DEHBBHD$@@@M9H1҉II1AAAVALA9wA9@@fDH<$|$@XZl$0*H<$AXAYL$ 1E1Ƀ4=@D$ tHL$|0DHL)IHH H1<$Hl$ H|$@Q?H9:ZYl$0L9vĮHHcHAA@@@YD$ @HVFiND$ MxA@11H\$HSkHT$fI |$(D\$(E…AD!„LD$D$ uB0H|$LDM)AAt AAu1E1Ƀ|$(|ATfATV|$(@` t0rƒ?IrH 1:IMHMIIDITITLL)I)DP1҉׃M:M99r5LA@0HIDAsCAKAAHD$~E1DHLH9D$rtIA>IDžtf0uAME1@@H<$L-LcfIUL9#ID$HD$ TL4$E1DAHT$ LH4$1Ld$I@IME1L1DAWIAVAUATE1UHSHL.T$L$ LHXLHA0IHtILmDL$ HHDD$HLHt4MH9vHL[]A\A]A^A_f.LH+fDLE15+AWAVAUATL$7USHH8T$ dH%(HD$(1n,H$1L9Ll$ Lt$ D<%} <w&HL9@<_uA|@AKIDE1ACIsPA ,A;t GIF|GЃ vAy@7~ڃ wACAIPAIA9AOE1 %f$EPHD$L݈HT$@H $H$HDT$XDD$PDL$HHD$0m(HHHELAIHH9ILCL)L9HDD$PDL$HEuMH9sHIcDT$XHL$PH)L\$XL<A0bH߾ DL$HL%L\$XHL$PDL$HHt$0L\$HHHHL$0HEE#HL$0L\$HHM"E@ %HD$DELE1E1f$AEGH$QD$Hx)Ɖkd)y؃dND$P1AO @ %E1f$HD$D$LDD$HH@DEAEICPI)H@x%uLHcLL)EAIHH9ILCI9#HtlH9vCIcHL$PH)LD$HL<DL$0A0>H߾ L#HL$PLD$HDL$0HHL$0LHENHL$0HME1H$p Hp(xu HD$(8-@ʼnųD$H )lj|$02+D$HD$HD$H<)ljk<)k<)IMIsIA MLL)EAIH%HLHEI̹AEHH$D$Hp AE*H$p D$HA0A-A_AEH$D$PD$Hp@Ń1{EAEIMcMLDLL)L9 HtHL\$HttI9s3IcDT$`L)L<A0/H߾ L\$HLL\$H$L\$HHLPt$ LL$0DD$`HL$HT$@Ht$hXZL\$HILAECH$D$H0AE&H$$Ix+x4:D$H)AEAOH$D$PD$Hp@Łl1fD@OH@H|$(L\$HDEDT$XDL$PELIĸAIHI9HICL)Ht$0H9HL\$HtxI9DL$Ps>IcDT$XL\$PL)DL$HL<A06 H߾ L\L\$PDL$HL\$HLHt$(H@E L\$HLLt$0L AEH,$$IExD$0:)Ѝ)‰ЋU)|jEqHJHD$0EWH9HD$0AED$AE1Ƅ$HD$PD$CD$BH2E1AHD$HD$HE1DEILAI9AIu HD$<(AEAH|$"D$BL /D$ HD$H1H\Iu-Hv'DT$8DD$0LL$(t DT$8DD$0LL$(IL9HT$Ht$HLDT$DL\$8DD$0LL$( LL$(DD$0L\$8DT$D|$CA~H HcH>fD$ IIu HD$xAH|$Ct T$BFHt$ Htډҋu |$ 5A€|$CkD t/M9vC>'IWI9vCD>$IWI9vCD>'IAM9sC>\IHM9sC>|$AIED@|$AfD$ AAA?E1 D$ A1D$1'DD$ \$C\$Bt H|$q\\f|$BE11|$C|$ HD!CD$ 1E1qfrE1A€|$C@ D$BLEӀ|$BDEHEHt$hLLt$xjD$HT$0AH IH$dH3%(L:H[]A\A]A^A_DfA|$CiE1/n;fDD$ t@b붐af|$C! D$ ADƒ M9vC>'IOI9vCD>$IOI9vCD>'IOI9@A\ALyAq HE0L9sHD$D(D$(0<  D$BDAD$ H|$XwDT$8L\$0DD$(# DD$(L\$0HDT$8Pf%@A"T$B*AIA~wH XHcH> rA"T$CT$ QLA v1 f! n@ t@ba|$B%D$ 1$HA|$C~ HDE1\@M9vC>'IGI9vCD>'IE1AE1fA A@A~H ؀HcH>1Dl$ D$ 1D1HDl$ D$ 1t@1 AELMu T$Ch D$C w $g |$A MH|$P  Ld$PA'HAAH\$HHD$D$C$`|$CMP1H|$PBLd$PI1E1D$IԻ'$tHEL9sH\$|+?D1E1?I|$ChE11?\fDH$HDŽ$HD$pIu,H|$DT$8DD$0LL$(DT$8DD$0LL$(I1H$$Lt$xHLt$pHD$8D$Hl$0L$L$L$L\$(DT$D+$LDDHhHD$0HT$(LH|$8L<HD$L)N$8L)HH2HHV|$Du|$CzHpH|$H4/JD?LDHH9K[!wH+HHtLt$xL$AHl$(V@D$ E11f.LM9fDVM9vC>'IGI9vCD>\IGI9LCD>'Ld$PT$BE1HDl$(1Dl$CH|$ LL$fAEDƃ@ t/M9vC>'IwI9vCD>$IwI9vCD>'IAM9vC>\IGI9v 0CD>IGI9v0CD>HI0H9VM9vC>A)IJD!@tM9vC>\IHH9s,M9vC>'IGI9vCD>'I1E1Dl$(L݈D$BEvkIAE10D$BMHOD$AE1AHD$PAƄ$D$CHD$HD$HCMA"E1D$AƄ$HD$PHvD$CAD$BHD$HD$HA tjH5v1D\$ bD\$ HHD$hH{vH9uH5x1D\$ -D\$ HHD$`HSH9$E1JH\$`D\$ E1HH\$HD\$ HD$D$AƄ$HD$PD$BHuD$AE1E1Ƅ$AHD$PD$CD$BHD$HD$HD$AE1E1Ƅ$HD$PD$CD$BHD$HD$H]D$AE1E1Ƅ$HD$PD$CD$BHD$HD$H D$AE1Ƅ$HD$PD$CD$BD$ D$ D$ M9vC>0HAI9vAD0Ly0KtD$B]fDl$(1HDHl$0Lt$x$L\$(D$L$L$DT$D"T$BHHHD$PE1D$AƄ$UD0E1>HpH|$CM9vC>?IWI9vCD>"IWI9vCD>"IWI9vCD>?I1E1H2HHl$0Lt$xE1D$$L$L$L\$(DT$DT$B L\$(LLHHHl$0D$$L$L$Lt$xL$DT$DL9s >u A<tHHTI9wHT$BE1HT$hM9vC>IB:uHrD$AE1E1Ƅ$HD$PD$CD$BHD$HD$HlLELEH\$HHt,t( H؄tLL)I9vA H uIM9C>{H|$`D?D\$ HD$`H|$hD#D\$ HD$hoALED$B$^HAHLt$ht$xt$8D$HT$0Ht$pH IAE1D$A1HD$PLLd$PBXHK}D$AE1E1Ƅ$HD$PD$CD$BHD$HD$HAWLcAVIAUATUHSH(Ht$oHH IŋD$ED9=' bAQEgH% IcHH9HmH HHc= D1)HHcHHrD% EIHDELL}LLLcD$$Au0LLu(AWHT$(L\$0$H L\$I9wgHpH H3I9tLHt$VHt$HHt$THLHCDEHIu0u(AWDL$ fo F dH%(HD$81fo> HG HH)$)L$)T$ HD$0H1LHHL$8dH3 %(u H@[]A\ff.@HLff.:f:"fATUSH@dH%(HD$81 HIԉ4$:HD$HD$HD$HD$HD$ HD$(HD$0 HLHHL$8dH3 %(u H@[]A\ff.AUMATIUSHHfo fo dH%(HD$81fo H HH)$)L$)T$ HD$0HLL=HL$8dH3 %(u HH[]A\A]-ff.fIPHHH1ff.IHHH1fH HH1ff.@HH1fAUAHATIUSH8dH%(H$(10!HDAHHHL H$AH¿HLuP1H$H9D$uH$H9$@H/H$(dH3%(u\H8[]A\A]@#HٿHb01fHٿHpb012YfAWAAVAUIATIUSH|$ H蹋LH讋HHHII9tH1[]A\A]A^A_fLHH2uۋ|$ HLD[L]A\A]A^A_>ff.HHJf.AWAVAUATMUHSLH(HIIH1Hk1H5kHnHHA11H58lHHpI &HsnJcH>DIȾH1H`k7rfLK8HC1LCH5>mLk0Lc(L{ LL$LsHH$LD$@HLL$HHH1AQAUATAWAVLL$0LD$8H0H([]A\A]A^A_LS@LK8H5lHCLCLk0Lc(LT$L{ LsLL$H$HLD$1LT$ARgHH5pj1H(HHH[1]A\A]A^A_LcH1H5:jFH(MHH[H]1A\A]A^A_LkLc1HH5 jH(MMHH[H]1A\A]A^A_f1LsLkH5jLcHHAVHMMHH1=XZH([]A\A]A^A_@L{ 1LsH5jLkLcHRAWfDLCLc(1L{ LsH5jL$LkHHMATAWAVLD$ HHH1H H([]A\A]A^A_LKLk01Lc(L{ H5jjLsLCLL$HL$AUATAWAVLL$(f.LS@LK8H5jHCLCLk0Lc(LT$L{ LsLL$H$HLD$fE1I8tIK<uHhE1dH%(HD$X1I#AƒMPAIKHt/II t%A/vMPIBI@IKHuDM`HD$XdH3%(uHhfDHLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$I$ HD$HD$ HD$D$0HD$dH3%(uH%DSH5f1HfH1"H5f1H XH]6H1H 1H5hHeHH[ fSHHuHu[RfHHHHx HuP(SHHuHuHHuHu[f.[1[fHHHHx HuPIHHt1HTUUUUUUU1IH9v8HHHLHIHSHt#HIHxHtP?1ҸE1IIAI f.HHt,HSUUUUUUUH9w7HHHDHHHuHHyPSH3H1H[@HHHHxHu HtH^ff.UHHSHHHHHJH[]SHH[HpfDPXH5f1HH 1H1:HXwRfAWIAVI։1AUMATIUSHdH%(HD$1H\$P2H,$L9rL9vTH@I׃KALA6LHO3ID۸D1H,$HT$dH3%(Hu@H[]A\A]A^A_fDIƃtu@KsHAQMIHH Hf.S11HHt H[D 8 uaAVAUI@ATUS1HdH%(HD$1H$"IHŐHLH4$HHLt0HAEBu.A>uHT$dH3%(HuAH[]A\A]A^DuA$vH1,DufDMvf.DAWAVAUATUSH(dH%(HD$1$IHHD$H$IMLDI]#$H0HHDN u-tdLHMHI9t\A$u<1Mt E EpIH|$dH3<%(/H([]A\A]A^A_ý"tL$MtDeEtAL1L$HtAT$/wgHE0D$HsT0LLD$zLD$Ht8A@fDABA5H cEJcH>HcHHp=Hp8HfDHcIMA8EHHHqѽHfDALL$L$HIkHxH뎾HH7uH wHcʿE1f.HHHuD <HcʿE1HHH.uƾHcʿE1DHHHYu떾HcʿE1DHHHucHcʿE1f.HHHu+HcHHpbHp]HpXH1 DHH6fH .$@1AxB@ƍt6H AHAHLAHAH^H 0b`H5L`H=]`AHAUATMUSHdH%(HD$1H wY}uCHaHcxPHH-aL,9H1MMHH11@uH}aHcyH-aT$Ll$H)D$HafAWAVAUATUSH(dH%(HD$1$IHHD$H$IMLDI]$H0HHDN u-tl1LHMHI9tbA$uB1Mt E EvIH|$dH3<%(-H([]A\A]A^A_fD"tL$MtDeEtAL1zL$HtAT$/wgHE0D$HsT0LLD$BLD$Ht8A@fDABA5H `EJcH>HcHHp=Hp8HfDHcIMA8EHHHqѽHfDALL$`L$HIeHxH뎾HH7uH wHcʿE1fHHHuD DHcʿE1HHH.uƾHcʿE1DHHHYu떾HcʿE1DHHHucHcʿE1f.HHHu+HcHHpbHp]HpXH1 LHH6nH 6,@1AxB@ƍt6H kAHAHLAHAH^H _`H5[H=-[AHStS t[fLH H=&L€uLH;=[fD#_[fDSHH[xSHH[XSHH[8AUIATIUSHHdH%(HD$1HHD$HDHHHvMu'HT$dH3%(Hu-H[]A\A]f1 uAEfPXH5}Y1HCH VHH H81Ht 8DHG8GPtHHHff.HG@GPtHHHff.ATUSHHtdHLbHLc0HHDH3HCHtFJT HH!HHkHHkHHS H@cP[]A\AH f.gPHO8LG@[ff.OPHO8LG@LOH7AV1AUATUSLoL+oHoLLHw0HH97H\dHC7H9HCHHHIIHH4ID$LHhIt$ H0ID$0It$I\HH!HAD$PuID$0HTHH!I9D$tII\$Ml$Ad$P[]A\A]A^HEHLIFHĩ fHGHt)H9vH90sH@Hu1f.fATUHSHwHHt+fH9sH9.s&LfHKPLMuH[]A\HkHkHHsHC []A\HW1HtH H)HRHHuDHtHH=$H=$@ATUSHtcIvHhHvHCHHHHt$HH{ HfCLD+ H[]A\fFHHt1HHfS[]A\fAWAVAUATUSHLf0MHIL9wHV8I9r}A<$H] }DLHtQ;uLu I9}HH\;uHEHtHX LHHu@I]0H[]A\A]A^A_H- H[]A\A]A^A_@LLxHL)HHL9s! 1@LPLx1LHvw!LLHSB;afLHEHt @HX :1tbH1D HuDeH[]A\fH} HƻuH[]A\}uH[]A\DcH[]A\ff.AUATUHSH}H} HD u1t#D#E1HD#HD[]A\A]@AAUATIUSHHtzHHIHtEHL,Ht'HHtIu2HH[]A\A]@ItL2H1[]A\A]DLufHLH[]A\A]ff.ATUSHHPdH%(HD$H1HHIHHHD$HtQHH&u HD$ItL{HD$HL$HdH3 %(HP[]A\ÐHt$H|$HtC T$0@ƅ@8txyCS3D$ 3T$$ ЋS 3T$ ЋS3T$ ЋS3T$ Ћ3T$ CVH@]HNt'~1&t _f1f.ATUHSP]HIă u#tMu08 []A\Duf.H3kHtH@Ht$1fH HHHu1HH@1Hf.H^Ht8HSHDHfDHtSH@ATUSHH߅xXDu0Hht@HD HEu<[]A\Hh1HuH[]A\DeDSHHttuH[ifHߺ1H[HHGH9Gt -DHG H9G(uHHuATAUHSHDHHt #H1[]A\ÐAWIAVIAUAATL%ԍ UH-ԍ SL)HHt1LLDAHH9uH[]A\A]A^A_ff.f.Hu 1HHXHxhXHXwwww\l''<(T&L'7x' |p\hR# 5.wc cTE:l@ dev_ino_pop     sort_filesposix-main?pcdb-lswd# Configuration file for dircolors, a utility to help you set the# LS_COLORS environment variable used by GNU ls with the --color option.# Copyright (C) 1996-2018 Free Software Foundation, Inc.# Copying and distribution of this file, with or without modification,# are permitted provided the copyright notice and this notice are preserved.# The keywords COLOR, OPTIONS, and EIGHTBIT (honored by the# slackware version of dircolors) are recognized but ignored.# Below are TERM entries, which can be a glob patterns, to match# against the TERM environment variable to determine if it is colorizable.TERM EtermTERM ansiTERM *color*TERM con[0-9]*x[0-9]*TERM cons25TERM consoleTERM cygwinTERM dttermTERM gnomeTERM hurdTERM jfbtermTERM konsoleTERM ktermTERM linuxTERM linux-cTERM mltermTERM puttyTERM rxvt*TERM screen*TERM stTERM terminatorTERM tmux*TERM vt100TERM xterm*# Below are the color init strings for the basic file types. A color init# string consists of one or more of the following numeric codes:# Attribute codes:# 00=none 01=bold 04=underscore 05=blink 07=reverse 08=concealed# Text color codes:# 30=black 31=red 32=green 33=yellow 34=blue 35=magenta 36=cyan 37=white# Background color codes:# 40=black 41=red 42=green 43=yellow 44=blue 45=magenta 46=cyan 47=white#NORMAL 00 # no color code at all#FILE 00 # regular file: use no color at allRESET 0 # reset to "normal" colorDIR 01;34 # directoryLINK 01;36 # symbolic link. (If you set this to 'target' instead of a # numerical value, the color is as for the file pointed to.)MULTIHARDLINK 00 # regular file with more than one linkFIFO 40;33 # pipeSOCK 01;35 # socketDOOR 01;35 # doorBLK 40;33;01 # block device driverCHR 40;33;01 # character device driverORPHAN 40;31;01 # symlink to nonexistent file, or non-stat'able file ...MISSING 00 # ... and the files they point toSETUID 37;41 # file that is setuid (u+s)SETGID 30;43 # file that is setgid (g+s)CAPABILITY 30;41 # file with capabilitySTICKY_OTHER_WRITABLE 30;42 # dir that is sticky and other-writable (+t,o+w)OTHER_WRITABLE 34;42 # dir that is other-writable (o+w) and not stickySTICKY 37;44 # dir with the sticky bit set (+t) and not other-writable# This is for files with execute permission:EXEC 01;32# List any file extensions like '.gz' or '.tar' that you would like ls# to colorize below. Put the extension, a space, and the color init string.# (and any comments you want to add after a '#')# If you use DOS-style suffixes, you may want to uncomment the following:#.cmd 01;32 # executables (bright green)#.exe 01;32#.com 01;32#.btm 01;32#.bat 01;32# Or if you want to colorize scripts even if they do not have the# executable bit actually set.#.sh 01;32#.csh 01;32 # archives or compressed (bright red).tar 01;31.tgz 01;31.arc 01;31.arj 01;31.taz 01;31.lha 01;31.lz4 01;31.lzh 01;31.lzma 01;31.tlz 01;31.txz 01;31.tzo 01;31.t7z 01;31.zip 01;31.z 01;31.dz 01;31.gz 01;31.lrz 01;31.lz 01;31.lzo 01;31.xz 01;31.zst 01;31.tzst 01;31.bz2 01;31.bz 01;31.tbz 01;31.tbz2 01;31.tz 01;31.deb 01;31.rpm 01;31.jar 01;31.war 01;31.ear 01;31.sar 01;31.rar 01;31.alz 01;31.ace 01;31.zoo 01;31.cpio 01;31.7z 01;31.rz 01;31.cab 01;31.wim 01;31.swm 01;31.dwm 01;31.esd 01;31# image formats.jpg 01;35.jpeg 01;35.mjpg 01;35.mjpeg 01;35.gif 01;35.bmp 01;35.pbm 01;35.pgm 01;35.ppm 01;35.tga 01;35.xbm 01;35.xpm 01;35.tif 01;35.tiff 01;35.png 01;35.svg 01;35.svgz 01;35.mng 01;35.pcx 01;35.mov 01;35.mpg 01;35.mpeg 01;35.m2v 01;35.mkv 01;35.webm 01;35.ogm 01;35.mp4 01;35.m4v 01;35.mp4v 01;35.vob 01;35.qt 01;35.nuv 01;35.wmv 01;35.asf 01;35.rm 01;35.rmvb 01;35.flc 01;35.avi 01;35.fli 01;35.flv 01;35.gl 01;35.dl 01;35.xcf 01;35.xwd 01;35.yuv 01;35.cgm 01;35.emf 01;35# https://wiki.xiph.org/MIME_Types_and_File_Extensions.ogv 01;35.ogx 01;35# audio formats.aac 00;36.au 00;36.flac 00;36.m4a 00;36.mid 00;36.midi 00;36.mka 00;36.mp3 00;36.mpc 00;36.ogg 00;36.ra 00;36.wav 00;36# https://wiki.xiph.org/MIME_Types_and_File_Extensions.oga 00;36.opus 00;36.spx 00;36.xspf 00;3600%.*s%s%s%%%02x../src/ls.csort_type != sort_version %lu%*lu ?]8;;file://%s%s%s]8;;%s %*s %*s, %*s -> error canonicalizing %scannot access %scannot read symbolic link %sunlabeledcannot open directory %sreading directory %sclosing directory %stotalvdirtest invocationMulti-call invocationsha224sumsha2 utilitiessha256sumsha384sumsha512sum %s online help: <%s> GNU coreutilsen_full-isolc/usr/share/localeQUOTING_STYLECOLUMNSTABSIZEinvalid line width%s: %s.*~invalid tab size--sort--time--format--color--hyperlink--indicator-style--quoting-styleDavid MacKenzieRichard M. StallmanLS_BLOCK_SIZE*=>@|TIME_STYLEinvalid time style format %stime styleValid arguments are: - [posix-]%s %Y-%m-%d %H:%M:%S.%N %z%Y-%m-%d %H:%M%Y-%m-%d LS_COLORSCOLORTERMTERM unrecognized prefix: %stargetTZfound//DIRED////SUBDIRED//yesforcenevernononeautoif-ttyatimeusectimestatusextensionverboselongcommashorizontalacrossverticalsingle-columndirectorydiredfull-timegroup-directories-firsthuman-readableinodekibibytesnumeric-uid-gidno-grouphide-control-charsreversealmost-allignore-backupsclassifyfile-typesidereference-command-linehideignoredereferenceliteralquote-namerecursiveshow-control-charstabsizetime-styleblock-sizecontextauthorhelp%b %e %Y%b %e %H:%M[01;3401;3601;3501;3301;3237;4130;4337;4434;4230;4230;41rcecfidilnpibdcdmiexdosusgowtwcamhslashlong-isocannot determine device and inode of %s%s: not listing already-listed directoryTry '%s --help' for more information. Usage: %s [OPTION]... [FILE]... List information about the FILEs (the current directory by default). Sort entries alphabetically if none of -cftuvSUX nor --sort is specified. Mandatory arguments to long options are mandatory for short options too. -a, --all do not ignore entries starting with . -A, --almost-all do not list implied . and .. --author with -l, print the author of each file -b, --escape print C-style escapes for nongraphic characters --block-size=SIZE with -l, scale sizes by SIZE when printing them; e.g., '--block-size=M'; see SIZE format below -B, --ignore-backups do not list implied entries ending with ~ -c with -lt: sort by, and show, ctime (time of last modification of file status information); with -l: show ctime and sort by name; otherwise: sort by ctime, newest first -C list entries by columns --color[=WHEN] colorize the output; WHEN can be 'always' (default if omitted), 'auto', or 'never'; more info below -d, --directory list directories themselves, not their contents -D, --dired generate output designed for Emacs' dired mode -f do not sort, enable -aU, disable -ls --color -F, --classify append indicator (one of */=>@|) to entries --file-type likewise, except do not append '*' --format=WORD across -x, commas -m, horizontal -x, long -l, single-column -1, verbose -l, vertical -C --full-time like -l --time-style=full-iso -g like -l, but do not list owner --group-directories-first group directories before files; can be augmented with a --sort option, but any use of --sort=none (-U) disables grouping -G, --no-group in a long listing, don't print group names -h, --human-readable with -l and -s, print sizes like 1K 234M 2G etc. --si likewise, but use powers of 1000 not 1024 -H, --dereference-command-line follow symbolic links listed on the command line --dereference-command-line-symlink-to-dir follow each command line symbolic link that points to a directory --hide=PATTERN do not list implied entries matching shell PATTERN (overridden by -a or -A) --hyperlink[=WHEN] hyperlink file names; WHEN can be 'always' (default if omitted), 'auto', or 'never' --indicator-style=WORD append indicator with style WORD to entry names: none (default), slash (-p), file-type (--file-type), classify (-F) -i, --inode print the index number of each file -I, --ignore=PATTERN do not list implied entries matching shell PATTERN -k, --kibibytes default to 1024-byte blocks for disk usage; used only with -s and per directory totals -l use a long listing format -L, --dereference when showing file information for a symbolic link, show information for the file the link references rather than for the link itself -m fill width with a comma separated list of entries -n, --numeric-uid-gid like -l, but list numeric user and group IDs -N, --literal print entry names without quoting -o like -l, but do not list group information -p, --indicator-style=slash append / indicator to directories -q, --hide-control-chars print ? instead of nongraphic characters --show-control-chars show nongraphic characters as-is (the default, unless program is 'ls' and output is a terminal) -Q, --quote-name enclose entry names in double quotes --quoting-style=WORD use quoting style WORD for entry names: literal, locale, shell, shell-always, shell-escape, shell-escape-always, c, escape (overrides QUOTING_STYLE environment variable) -r, --reverse reverse order while sorting -R, --recursive list subdirectories recursively -s, --size print the allocated size of each file, in blocks -S sort by file size, largest first --sort=WORD sort by WORD instead of name: none (-U), size (-S), time (-t), version (-v), extension (-X) --time=WORD with -l, show time as WORD instead of default modification time: atime or access or use (-u); ctime or status (-c); also use specified time as sort key if --sort=time (newest first) --time-style=TIME_STYLE time/date format with -l; see TIME_STYLE below -t sort by modification time, newest first -T, --tabsize=COLS assume tab stops at each COLS instead of 8 -u with -lt: sort by, and show, access time; with -l: show access time and sort by name; otherwise: sort by access time, newest first -U do not sort; list entries in directory order -v natural sort of (version) numbers within text -w, --width=COLS set output width to COLS. 0 means no limit -x list entries by lines instead of by columns -X sort alphabetically by entry extension -Z, --context print any security context of each file -1 list one file per line. Avoid '\n' with -q or -b --help display this help and exit --version output version information and exit The SIZE argument is an integer and optional unit (example: 10K is 10*1024). Units are K,M,G,T,P,E,Z,Y (powers of 1024) or KB,MB,... (powers of 1000). The TIME_STYLE argument can be full-iso, long-iso, iso, locale, or +FORMAT. FORMAT is interpreted like in date(1). If FORMAT is FORMAT1FORMAT2, then FORMAT1 applies to non-recent files and FORMAT2 to recent files. TIME_STYLE prefixed with 'posix-' takes effect only outside the POSIX locale. Also the TIME_STYLE environment variable sets the default style to use. Using color to distinguish file types is disabled both by default and with --color=never. With --color=auto, ls emits color codes only when standard output is connected to a terminal. The LS_COLORS environment variable can change the settings. Use the dircolors command to set it. Exit status: 0 if OK, 1 if minor problems (e.g., cannot access subdirectory), 2 if serious trouble (e.g., cannot access command-line argument). https://www.gnu.org/software/coreutils/Report %s translation bugs to Full documentation at: <%s%s> or available locally via: info '(coreutils) %s%s' ignoring invalid value of environment variable QUOTING_STYLE: %signoring invalid width in environment variable COLUMNS: %signoring invalid tab size in environment variable TABSIZE: %sabcdfghiklmnopqrstuvw:xABCDFGHI:LNQRST:UXZ1 - +FORMAT (e.g., +%H:%M) for a 'date'-style format dev_ino_size <= obstack_object_size (&dev_ino_obstack)//DIRED-OPTIONS// --quoting-style=%s hash_get_n_entries (active_dir_set) == 0unparsable value for LS_COLORS environment variabledereference-command-line-symlink-to-dir8.30invalid argument %s for %sambiguous argument %s for %sValid arguments are: - %s, %swrite errorsystem.posix_acl_accesssystem.posix_acl_defaultOWNER@GROUP@EVERYONE@system.nfs4_acl..CPOSIX# entries: %lu # buckets: %lu max bucket length: %lu # buckets used: %lu (%.2f%%) ?L??=fff?̌??L?__Y@%.0Lf%.1LfBLOCKSIZEPOSIXLY_CORRECTeEgGkKmMpPtTyYzZ0KMGTPEZY A>@%m/%d/%y%Y-%m-%d%H:%M:%Suhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhlhhhhhhhhhhhhhhhhhhhhuhhhhhh&gm6mshss0uNuhhhiuuhuhpquqs?se r\rhhhhhh&ggeiihsghjppmmhTnqnej7jjhmeVghA NULL argv[0] was passed through an exec system call. /.libs/lt-’"e‘`shellshell-alwaysshell-escapeshell-escape-alwaysc-maybeclocaleB^|N111111d\I4t111111111111111111aaa{a~aaa{{{{{{{{{{{{{{{{aaaa~1{{{{{{{{{{{{{{{{{{{{{{{{{{a{a{a{{{{{{{{{{{{{{{{{{{{{{{{{{}a}H5555558(555555555555555555ЀЀЀЀ|ЀЀЀЀЀЀЀ|5ЀxЀЀ{Ѐ{||4}4}4}4}4}4}l|d|L|<| ||{4}4}4}4}4}4}4}4}4}4}4}4}4}4}4}4}4}4}td{d{Td{<d{zd{d{d{<<<<<<<<<<<<<<<<d{d{d{d{z4}<<<<<<<<<<<<<<<<<<<<<<<<<<d{{<d{<d{<<<<<<<<<<<<<<<<<<<<<<<<<<yd{yT %s (%s) %s %s %s (C)Written by %s. Written by %s and %s. Written by %s, %s, and %s. Report bugs to: %s bug-coreutils@gnu.org%s home page: <%s> License GPLv3+: GNU GPL version 3 or later . This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Written by %s, %s, %s, and %s. Written by %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, %s, and %s. Written by %s, %s, %s, %s, %s, %s, %s, %s, %s, and others. General help using GNU software: ܒlē\DCopyright %s %d Free Software Foundation, Inc.memory exhausted../lib/xstrtol.c0 <= strtol_base && strtol_base <= 36aeeee"eee.eeeeeee̝eeeeeeezڞeeeeee"eeeeeeel/xHۜHl/Hxstrtoulinvalid %s%s argument '%s'%s%s argument '%s' too large--invalid suffix in %s%s argument '%s'RV&R&,՟՟Ӡ՟ ՟՟՟՟_՟՟՟՟՟p՟՟՟՟> ՟՟՟՟՟՟՟x՟՟՟ ՟՟՟՟_՟՟՟՟՟՟p՟՟xstrtoumaxASCII; q< yd P X< " x"%)*)/+4,9->/C5LP$ | ܛ l |d ܟx \ ,0 BBB B(A0A8G L&"&L&f&S& 8A0A(B BBBF 5&T&V&A&0AAG L@I@t AAA ( \ADG AAG 8< BBD A(D0 (D ABBA `x BBB B(A0A8DP 8A0A(B BBBI T8F0A(B BBB OIB B(A0A8D` 8A0A(B BBBM  8A0A(B BBBE pA`U8F0A(B BBB| v 6 v $v v 6 (6 T (0 LACD@ AAD ,\ ]AC BEEM J \ BBE B(A0D8G9 8A0A(B BBBF JQI 6 F F( DF< 6P F4d mFID F ABL AAB4 mFDI G ABK AAB X  Pv v$ (8 L F` \6t 6 F F ,F8 hBAI A ABH HAB8BAD F ABH HAB4<p{FIA B ABK MGB4t{FDA G ABK MGBvlv8TJAA I ABH SAB $FIA DhHgIFBB B(A0C8GDIA WX u 8A0A(B BBBA L(FQL E(A0A8H@] 8D0A(B BBBD HFEB E(A0D8D` 8A0A(B BBBA (d{JID { DFL \8FBG E(A0I8N@ 8A0A(B BBBC D8F0A(B BBBHxFEE E(D0J8M@N 8A0A(B BBBH <<UFBB A(A0~(D BBB| sLFBH B(A0A8G 8A0A(B BBBE   , EAD @ AAA 0<peECG @ DAD DGA(pbEDD A DAE [ <+EZ A JDHFBB A(A0GB 0A(A BBBC \KJD D(D0| (D ABBJ D(A ABBFA0| ZH0L A `s HN A LFBB E(D0A8DP 8D0A(B BBBD 4xHH4RFBB B(A0D8Gp 8A0A(B BBBE $HcEL0K AA `Hu C _\h d!A_zRx  a`dHBEE D(D0 (D BBBG i (F EBBH C (A EBBC ~\pJBBE E(A0D8D@ 8F0A(B BBBI ]8C0A(B BBB<` P\ dX xT W g< FBB D(D0 (N GDBK 4 SFDD p CBE GAB HOfN_0H$ jEDG G AAG GAA|` tH xFBB B(A0A8D@j 8D0A(B BBBG  1, $HH FLE E(D0I8D@ 8D0A(B BBBE (P FAD QB(|0FDA DB4/FAD D  AABH zRx $ ^8FBA A(D@Z (A ABBB zRx @$] iEG x AK 04FFA G0J  AABF $+EDG RDA-,0;fTDXEOdXx1 FDE B(A0F8MnAgNAJnBesAv 8A0A(B BBBI 4OAPJBdtA8 FED A(G@ (A ABBF (\0!FAA ABL! FDA x ABJ } ABH S ABB VAB(d"FAA ABL" FDA x ABJ } ABH S ABB VABT#l $PHX$FBB E(A0D8Gp  8D0A(B BBBH H'FEB B(D0D8DP] 8D0A(B BBBK H(FBB B(E0A8Gp6 8A0A(B BBBG (h)'ECG IIAx)!BBB E(A0A8GpV 8A0A(B BBBD ^ 8A0A(B BBBH  8D0A(J FBBI \+($h+ABAD vAB(P+ABAD vABl|+BOB E(A0A8G  8A0A(B BBBJ :  K X A  D _ A $ DJH W(B0N(A T A HDE A <4DADF T AAG v AAH rAAttEBBE B(D0D8JJJBZd 8A0A(B BBBF  PDD[$zRx ,Wh( WBEE B(A0D8D`hbpIxBS`@hTpCxBX`L 8D0A(B BBBF zRx `(bV( X:FAA nAB X !X !X94!(YH!4Y1lP\!`YxFLE E(A0A8GPUXW`FhApU8A0A(B BBBh!YFLE B(D0A8GphxQCBZp_xFCGUp[8A0A(B BBB"Z(0" ZLHA zAB\"Zp"Z"Z"Z"ZHP A zRx P?T"ZHP A LT$#H[8#D[0L#P[FLD D`q  AABA #[#[#[0#[FAA D`  AABA zRx `$S8$$\FED C(Dpq (A ABBA `$|\t$x\$\$\$\$\$\8$\'BHD C(G (A ABBE \(%]FEB E(D0A8DPv 8C0A(B BBBC Z8G0D(B BBB%]%]FBB B(D0D8G`hWpBxBBBS`D 8A0A(B BBBD P hH Z 8O0C(B BBBL ^ 8J0I(D BBBE b 8M0I(D BBBN fhBp\hA`D 8A0A(B BBBE h hH rhEpBxB^`D 8A0A(B BBBA y hBpBxBQ  ~P&` &`Hp| A &8aK A 'aE},'@bES A H'Db(c\'`b p'\b>E` K H A 'xb(c'b\L' cXS'TcEV'Xc2Ka A $(|c-EGG WAA8(cELT(c>EARHt(cFEI E(D0A8DP 8A0A(B BBBG (\d%HB Z(pd/EU F D(dFBL A(A0F@s 0A(A BBBI LD)eoFBB B(A0A8D` 8A0A(B BBBA $)8iFBD A(D@L)ioFBB B(A0A8D` 8A0A(B BBBG $ *mjAL C A G Q4*8nELP*G'|7D:9};[|*{XI`Eܣ(f_k#5׃SZΚwcp9^ŴF3GI.Ts6?r:0YQ^F ;ڠYϓ1 0 OFu{W3zWԮ  e+2 !K+ {|pkM^ 3q. mٓMرOw N:03bXҍ96iB qKv]QIvܲ˺z L>|F]l/|0 t'% MdFrطCw X G:i`=>qX& O3u[ڪUP֮} d1-TPBt:˄F |$)tg#M;ceeQeZ.[6e.NOP`xP_VŔpLEre6ׇuݣi?J͊xFĘY9Q?,SA&ݝ oqдe)Gr gT?~fwX'@8_Ԝ!81GbBvZjof?dI }ղLfarȗ؃Mt~5A\ s5"`;~]t ZØcuM<ёհ2#g3f\#4G ChJVx 6*5lgr euDuuW^OLo *}WV*+ t0prFC$ǼA]\.goS xa zpN' D8ddk-ZPB>jIlmo=*&[ⓟp! ,o27^)C1OB_>M`1<ܓīaptrpbhx9Abc8qd~|w@KI>yc<=Ɠd _,zvz\NO<*, 쓙+0(GfSd]0jb̽(_݇oZ&%+7$kp-gj1t <#7K(bR漅1_fUU`XdL1D L8)}vmvI};pF wb؉)Q7mEQB7r8+?]wTU=vܶ!|I#@Ι2ݾaKc|J#aC!~㫋1@Pi6NN &0# 1!֞0=v鍥Rb%VA**LG0=mWڜ0x%zuﷹ}=+=U@62#x^ 'B@[FW^QPu27t&܈t$bQ\>a]gB],we_(i\wbáK#pe9Cc2pTtΒp+*R,ޱ)pdw]RwkA )?0g RvrVձgYZ.shstrtab.interp.note.gnu.property.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu.build.attributes.gnu_debuglink.gnu_debugdata  & 4$Go00LQ  Y((ao**no88}PB++ 5555<<CCR.rr @r@rqQ  /p!px!x!X  "  " "H `"H $bH( p$/&>usr/share/info/dir000064400000042461152525303110010117 0ustar00This is the file .../info/dir, which contains the topmost node of the Info hierarchy, called (dir)Top. The first time you invoke Info you start off looking at this node.  File: dir, Node: Top This is the top of the INFO tree This (the Directory node) gives a menu of major topics. Typing "q" exits, "H" lists all Info commands, "d" returns here, "h" gives a primer for first-timers, "mEmacs" visits the Emacs manual, etc. In Emacs, you can click mouse button 2 on a menu item or cross reference to select it. * Menu: Archiving * Tar: (tar). Making tape (or disk) archives. Basics * Bash: (bash). The GNU Bourne-Again SHell. * Common options: (coreutils)Common options. * Coreutils: (coreutils). Core GNU (file, text, shell) utilities. * Date input formats: (coreutils)Date input formats. * File permissions: (coreutils)File permissions. Access modes. * Finding files: (find). Operating on files matching certain criteria. C++ libraries * autosprintf: (autosprintf). Support for printf format strings in C++. Compression * Gzip: (gzip). General (de)compression of files (lzw). Development * libext2fs: (libext2fs). The EXT2FS library. Editors * nano: (nano). Small and friendly text editor. Emacs * IDN Library: (libidn)Emacs API. Emacs API for IDN functions. General Commands * Screen: (screen). Full-screen window manager. GNU Libraries * libgcrypt: (gcrypt). Cryptographic function library. * libgomp: (libgomp). GNU Offloading and Multi Processing Runtime Library. GNU organization * Maintaining Findutils: (find-maint). Maintaining GNU findutils * Standards: (standards). GNU coding standards. GNU Packages * Aspell: (aspell). GNU Utilities * dirmngr: (gnupg). X.509 CRL and OCSP server. * dirmngr-client: (gnupg). X.509 CRL and OCSP client. * gpg-agent: (gnupg). The secret key daemon. * gpg2: (gnupg). OpenPGP encryption and signing tool. * gpgsm: (gnupg). S/MIME encryption and signing tool. * pinentry: (pinentry). Securely ask for a passphrase or PIN. Individual utilities * aclocal-invocation: (automake)aclocal Invocation. Generating aclocal.m4. * addr2line: (binutils)addr2line. Convert addresses to file and line. * ar: (binutils)ar. Create, modify, and extract from archives. * arch: (coreutils)arch invocation. Print machine hardware name. * autoconf-invocation: (autoconf)autoconf Invocation. How to create configuration scripts * autoheader: (autoconf)autoheader Invocation. How to create configuration templates * autom4te: (autoconf)autom4te Invocation. The Autoconf executables backbone * automake-invocation: (automake)automake Invocation. Generating Makefile.in. * autoreconf: (autoconf)autoreconf Invocation. Remaking multiple `configure' scripts * autoscan: (autoconf)autoscan Invocation. Semi-automatic `configure.ac' writing * autoupdate: (autoconf)autoupdate Invocation. Automatic update of `configure.ac' * b2sum: (coreutils)b2sum invocation. Print or check BLAKE2 digests. * base32: (coreutils)base32 invocation. Base32 encode/decode data. * base64: (coreutils)base64 invocation. Base64 encode/decode data. * basename: (coreutils)basename invocation. Strip directory and suffix. * c++filt: (binutils)c++filt. Filter to demangle encoded C++ symbols. * cat: (coreutils)cat invocation. Concatenate and write files. * chcon: (coreutils)chcon invocation. Change SELinux CTX of files. * chgrp: (coreutils)chgrp invocation. Change file groups. * chmod: (coreutils)chmod invocation. Change access permissions. * chown: (coreutils)chown invocation. Change file owners and groups. * chroot: (coreutils)chroot invocation. Specify the root directory. * cksum: (coreutils)cksum invocation. Print POSIX CRC checksum. * comm: (coreutils)comm invocation. Compare sorted files by line. * config.status: (autoconf)config.status Invocation. Recreating configurations. * configure: (autoconf)configure Invocation. Configuring a package. * cp: (coreutils)cp invocation. Copy files. * csplit: (coreutils)csplit invocation. Split by context. * cut: (coreutils)cut invocation. Print selected parts of lines. * cxxfilt: (binutils)c++filt. MS-DOS name for c++filt. * date: (coreutils)date invocation. Print/set system date and time. * dd: (coreutils)dd invocation. Copy and convert a file. * df: (coreutils)df invocation. Report file system disk usage. * dir: (coreutils)dir invocation. List directories briefly. * dircolors: (coreutils)dircolors invocation. Color setup for ls. * dirname: (coreutils)dirname invocation. Strip last file name component. * dlltool: (binutils)dlltool. Create files needed to build and use DLLs. * du: (coreutils)du invocation. Report on disk usage. * echo: (coreutils)echo invocation. Print a line of text. * elfedit: (binutils)elfedit. Update the ELF header of ELF files. * env: (coreutils)env invocation. Modify the environment. * expand: (coreutils)expand invocation. Convert tabs to spaces. * expr: (coreutils)expr invocation. Evaluate expressions. * factor: (coreutils)factor invocation. Print prime factors * false: (coreutils)false invocation. Do nothing, unsuccessfully. * find: (find)Invoking find. Finding and acting on files. * fmt: (coreutils)fmt invocation. Reformat paragraph text. * fold: (coreutils)fold invocation. Wrap long input lines. * groups: (coreutils)groups invocation. Print group names a user is in. * gunzip: (gzip)Overview. Decompression. * gzexe: (gzip)Overview. Compress executables. * head: (coreutils)head invocation. Output the first part of files. * hostid: (coreutils)hostid invocation. Print numeric host identifier. * hostname: (coreutils)hostname invocation. Print or set system name. * id: (coreutils)id invocation. Print user identity. * ifnames: (autoconf)ifnames Invocation. Listing conditionals in source. * install: (coreutils)install invocation. Copy files and set attributes. * join: (coreutils)join invocation. Join lines on a common field. * kill: (coreutils)kill invocation. Send a signal to processes. * libtool-invocation: (libtool)Invoking libtool. Running the 'libtool' script. * libtoolize: (libtool)Invoking libtoolize. Adding libtool support. * link: (coreutils)link invocation. Make hard links between files. * ln: (coreutils)ln invocation. Make links between files. * locate: (find)Invoking locate. Finding files in a database. * logname: (coreutils)logname invocation. Print current login name. * ls: (coreutils)ls invocation. List directory contents. * md5sum: (coreutils)md5sum invocation. Print or check MD5 digests. * mkdir: (coreutils)mkdir invocation. Create directories. * mkfifo: (coreutils)mkfifo invocation. Create FIFOs (named pipes). * mknod: (coreutils)mknod invocation. Create special files. * mktemp: (coreutils)mktemp invocation. Create temporary files. * mv: (coreutils)mv invocation. Rename files. * nice: (coreutils)nice invocation. Modify niceness. * nl: (coreutils)nl invocation. Number lines and write files. * nlmconv: (binutils)nlmconv. Converts object code into an NLM. * nm: (binutils)nm. List symbols from object files. * nohup: (coreutils)nohup invocation. Immunize to hangups. * nproc: (coreutils)nproc invocation. Print the number of processors. * numfmt: (coreutils)numfmt invocation. Reformat numbers. * objcopy: (binutils)objcopy. Copy and translate object files. * objdump: (binutils)objdump. Display information from object files. * od: (coreutils)od invocation. Dump files in octal, etc. * paste: (coreutils)paste invocation. Merge lines of files. * pathchk: (coreutils)pathchk invocation. Check file name portability. * pr: (coreutils)pr invocation. Paginate or columnate files. * printenv: (coreutils)printenv invocation. Print environment variables. * printf: (coreutils)printf invocation. Format and print data. * ptx: (coreutils)ptx invocation. Produce permuted indexes. * pwd: (coreutils)pwd invocation. Print working directory. * ranlib: (binutils)ranlib. Generate index to archive contents. * readelf: (binutils)readelf. Display the contents of ELF format files. * readlink: (coreutils)readlink invocation. Print referent of a symlink. * realpath: (coreutils)realpath invocation. Print resolved file names. * rm: (coreutils)rm invocation. Remove files. * rmdir: (coreutils)rmdir invocation. Remove empty directories. * runcon: (coreutils)runcon invocation. Run in specified SELinux CTX. * seq: (coreutils)seq invocation. Print numeric sequences * sha1sum: (coreutils)sha1sum invocation. Print or check SHA-1 digests. * sha2: (coreutils)sha2 utilities. Print or check SHA-2 digests. * shred: (coreutils)shred invocation. Remove files more securely. * shuf: (coreutils)shuf invocation. Shuffling text files. * size: (binutils)size. List section sizes and total size. * sleep: (coreutils)sleep invocation. Delay for a specified time. * sort: (coreutils)sort invocation. Sort text files. * split: (coreutils)split invocation. Split into pieces. * stat: (coreutils)stat invocation. Report file(system) status. * stdbuf: (coreutils)stdbuf invocation. Modify stdio buffering. * strings: (binutils)strings. List printable strings from files. * strip: (binutils)strip. Discard symbols. * stty: (coreutils)stty invocation. Print/change terminal settings. * sum: (coreutils)sum invocation. Print traditional checksum. * sync: (coreutils)sync invocation. Synchronize memory to disk. * tac: (coreutils)tac invocation. Reverse files. * tail: (coreutils)tail invocation. Output the last part of files. * tar: (tar)tar invocation. Invoking GNU 'tar'. * tee: (coreutils)tee invocation. Redirect to multiple files. * test: (coreutils)test invocation. File/string tests. * testsuite: (autoconf)testsuite Invocation. Running an Autotest test suite. * timeout: (coreutils)timeout invocation. Run with time limit. * touch: (coreutils)touch invocation. Change file timestamps. * tr: (coreutils)tr invocation. Translate characters. * true: (coreutils)true invocation. Do nothing, successfully. * truncate: (coreutils)truncate invocation. Shrink/extend size of a file. * tsort: (coreutils)tsort invocation. Topological sort. * tty: (coreutils)tty invocation. Print terminal name. * uname: (coreutils)uname invocation. Print system information. * unexpand: (coreutils)unexpand invocation. Convert spaces to tabs. * uniq: (coreutils)uniq invocation. Uniquify files. * unlink: (coreutils)unlink invocation. Removal via unlink(2). * updatedb: (find)Invoking updatedb. Building the locate database. * uptime: (coreutils)uptime invocation. Print uptime and load. * users: (coreutils)users invocation. Print current user names. * vdir: (coreutils)vdir invocation. List directories verbosely. * wc: (coreutils)wc invocation. Line, word, and byte counts. * who: (coreutils)who invocation. Print who is logged in. * whoami: (coreutils)whoami invocation. Print effective user ID. * windmc: (binutils)windmc. Generator for Windows message resources. * windres: (binutils)windres. Manipulate Windows resources. * xargs: (find)Invoking xargs. Operating on many files. * yes: (coreutils)yes invocation. Print a string indefinitely. * zcat: (gzip)Overview. Decompression to stdout. * zdiff: (gzip)Overview. Compare compressed files. * zforce: (gzip)Overview. Force .gz extension on files. * zgrep: (gzip)Overview. Search compressed files. * zmore: (gzip)Overview. Decompression output by pages. Kernel * grub2-dev: (grub2-dev). The GRand Unified Bootloader Dev * grub2-install: (grub2)Invoking grub2-install. Install GRUB on your drive * grub2-mkconfig: (grub2)Invoking grub2-mkconfig. Generate GRUB configuration * grub2-mkpasswd-pbkdf2: (grub2)Invoking grub2-mkpasswd-pbkdf2. * grub2-mkrelpath: (grub2)Invoking grub2-mkrelpath. * grub2-mkrescue: (grub2)Invoking grub2-mkrescue. Make a GRUB rescue image * grub2-mount: (grub2)Invoking grub2-mount. Mount a file system using GRUB * grub2-probe: (grub2)Invoking grub2-probe. Probe device information * grub2-script-check: (grub2)Invoking grub2-script-check. * GRUB2: (grub2). The GRand Unified Bootloader Libraries * libgpg-error: (gnupg). Error codes and common code for GnuPG. Localization * idn: (libidn)Invoking idn. Internationalized Domain Name (IDN) string conversion. Miscellaneous * bc: (bc). The GNU calculator language. * dc: (dc). The GNU RPN calculator. Network applications * Wget: (wget). Non-interactive network downloader. Programming * flex: (flex). Fast lexical analyzer generator (lex replacement). Programming & development tools * gdbm: (gdbm). The GNU Database. Software development * As: (as). The GNU assembler. * Autoconf: (autoconf). Create source code configuration scripts. * Automake: (automake). Making GNU standards-compliant Makefiles. * Bfd: (bfd). The Binary File Descriptor library. * Binutils: (binutils). The GNU binary utilities. * Cpp: (cpp). The GNU C preprocessor. * Cpplib: (cppinternals). Cpplib internals. * Gas: (as). The GNU assembler. * Ld: (ld). The GNU linker. * Libtool: (libtool). Generic shared library support script. * Make: (make). The GNU make utility. * annobin: (annobin). Annotating a compiled program * bison: (bison). The GNU parser generator. * g++: (gcc). The GNU C++ compiler. * gcc: (gcc). The GNU Compiler Collection. * gccinstall: (gccinstall). Installing the GNU Compiler Collection. * gccint: (gccint). Internals of the GNU Compiler Collection. * gcov: (gcc) Gcov. 'gcov'--a test coverage program. * gcov-dump: (gcc) Gcov-dump. 'gcov-dump'--an offline gcda and gcno profile dump tool. * gcov-tool: (gcc) Gcov-tool. 'gcov-tool'--an offline gcda profile processing program. * gprof: (gprof). Profiling your program's execution Software libraries * libidn: (libidn). Internationalized string processing library. System administration * Which: (which). Show full path of commands. Text creation and manipulation * M4: (m4). A powerful macro processor. * sed: (sed). Stream EDitor.