�ɲɾ�����ӯ�����һ��ˣ��������С���˴��ͣ�������P���ҹ��ñ˽��ά�Բ��������˸߸ԣ�������ơ��ҹ��ñ�����ά�Բ���ˡ���˳^�ӣ������ӡ� ���ͯj�ӣ��ƺ���ӣ� ? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!PKx{0]qxƳGGLC_MESSAGES/sudo.monu[t ` a!l(#5J$]6 :+,XoI!#"8F33$!'F{n7."Q e#154g*)>0&L"s& (O6DC{/),*F,q743 /?5o+4.!5W'v7-,".OC~=)&*Q+h"7&*0A2r)5>Da{ &!J>c ,M5\&1" ) ? %Q w    / !+1!']!!!!!!!$","A"^"+|" ""!"##('#P#n#%####$($A$*W$($$$"$5$5%,R%+%%%!%)%&-&<=&2z&2&6&#';' )()*:)"e))))-) *$*1=*,o*J***+N+:W++++Q+2,G,'],2,D,!,8-:X-!-$---.>.9./&/+E/q/&/,/./)04;0=p03020V1&l1-1"1*12)2eI2O2K2EK3<3@3-44=4<r4?4843(5=\5<5C586"T6w6,6H6; 7 I76j797]7U98,8&88D9(E9:n929/93 :9@:6z:?:B:!4;V;r;!;;+;%;V<Ir<!<<<=1=!G=&i=!=E=4=$->DR>->>>1>%&?L? e??/?(?2?1)@#[@@&@@-@,A4A%LA%rA:A'AA2B.NB4}B(B-B. C&8C_C$CC*CC*D20D"cD D3DHD!$E0FE3wE0E*E.F6FIFK]F<F<FP#G*tG5=ioN'{<!D0}L_QXA&\glvW4mIq>wx-d:1RpZ@a"cG#U?Yr(O~K| CB6j`P7)z .+VF 2 ;sM,%uHT 3J9[*f/t ]$ykn^ESehb8 Options: %s - edit files as another user %s - execute a command as another user %s changed labels%s is group writable%s is not a regular file%s is not a valid context%s is owned by uid %u, should be %u%s is world writable%s left unmodified%s must be only be writable by owner%s must be owned by uid %d%s must be owned by uid %d and have the setuid bit set%s unchanged%s%s: %s%s: %s%s: editing files in a writable directory is not permitted%s: editing symbolic links is not permitted%s: not a regular file%s: short writeConfigure options: %s Only one of the -e, -h, -i, -K, -l, -s, -v or -V options may be specifiedSudo version %s Unknown signalclose all file descriptors >= numcontents of edit session left in %scould not bind to default resource pool for project "%s"could not join project "%s"create SELinux security context with specified rolecreate SELinux security context with specified typedisplay help message and exitdisplay version information and exitedit files instead of running a commandeffective uid is not %d, is %s on a file system with the 'nosuid' option set or an NFS file system without root privileges?effective uid is not %d, is sudo installed setuid root?error in %s, line %d while loading plugin "%s"error in event looperror initializing I/O plugin %serror reading from signal pipeerror reading from socketpairfailed to get old_contextfailed to set new role %sfailed to set new type %sfatal error, unable to load pluginsignoring duplicate I/O plugin "%s" in %s, line %dignoring duplicate policy plugin "%s" in %s, line %dignoring policy plugin "%s" in %s, line %din list mode, display privileges for userincompatible plugin major version %d (expected %d) found in %sinternal error, %s overflowinvalid Path value "%s" in %s, line %uinvalid file descriptor number: %sinvalid max groups "%s" in %s, line %uinvalid valueinvalid value for %s "%s" in %s, line %ulist user's privileges or check a specific command; use twice for longer formatno askpass program specified, try setting SUDO_ASKPASSno resource pool accepting default bindings exists for project "%s"no tty present and no askpass program specifiednon-interactive mode, no prompts are usedonly a single policy plugin may be specifiedplugin did not return a command to executeplugin error: missing file list for sudoeditpolicy plugin %s does not include a check_policy methodpolicy plugin %s does not support listing privilegespolicy plugin %s does not support the -k/-K optionspolicy plugin %s does not support the -v optionpolicy plugin %s is missing the `check_policy' methodpolicy plugin failed session initializationpreserve group vector instead of setting to target'spreserve user environment when running commandread password from standard inputrequires at least one argumentresource control limit has been reachedrun command (or edit file) as specified user name or IDrun command as the specified group name or IDrun command in the backgroundrun command on host (if supported by plugin)run command with the specified BSD login classrun login shell as the target user; a command may also be specifiedrun shell as the target user; a command may also be specifiedsesh: internal error: odd number of pathssesh: unable to create temporary filessesh: unknown error %dset HOME variable to target user's home dirsetproject failed for project "%s"specified resource pool does not exist for project "%s"stop processing command line argumentssudoedit is not supported on this platformterminate command after the specified time limitthe `-A' and `-S' options may not be used togetherthe `-E' option is not valid in edit modethe `-U' option may only be used with the `-l' optionthe argument to -C must be a number greater than or equal to 3unable to add event to queueunable to allocate memoryunable to allocate ptyunable to change directory to %sunable to change root to %sunable to change to runas uid (%u, %u)unable to change uid to root (%u)unable to copy some of the temporary files back to their original locationunable to copy temporary files back to their original locationunable to create pipeunable to create socketsunable to determine ttyunable to dup2 stdinunable to execute %sunable to fgetfilecon %sunable to find symbol "%s" in %sunable to forkunable to get current tty context, not relabeling ttyunable to get default type for role %sunable to get group vectorunable to get new tty context, not relabeling ttyunable to initialize policy pluginunable to load %s: %sunable to open %sunable to open %s, not relabeling ttyunable to open audit systemunable to open userdbunable to read temporary fileunable to read the clockunable to remove PRIV_PROC_EXEC from PRIV_LIMITunable to restore context for %sunable to restore current working directoryunable to restore handler for signal %dunable to restore registryunable to restore stdinunable to restore tty labelunable to run %sunable to run %s as a login shellunable to save handler for signal %dunable to save stdinunable to send audit messageunable to set controlling ttyunable to set effective gid to runas gid %uunable to set exec context to %sunable to set gid to %uunable to set gid to runas gid %uunable to set handler for signal %dunable to set key creation context to %sunable to set new tty contextunable to set process priorityunable to set supplementary group IDsunable to set tty context to %sunable to set uid to %uunable to set user contextunable to stat %sunable to switch to registry "%s" for %sunable to write to %sunexpected child termination condition: %dunexpected reply type on backchannel: %dunexpected sudo mode 0x%xunknown login class %sunknown policy type %d found in %sunknown security class "chr_file", not relabeling ttyunknown uid %u: who are you?unsupported group source "%s" in %s, line %uuse a helper program for password promptinguse specified BSD authentication typeuse the specified password promptuser "%s" is not a member of project "%s"value too largevalue too smallwarning, resource control assignment failed for project "%s"you may not specify both the `-i' and `-E' optionsyou may not specify both the `-i' and `-s' optionsyou may not specify environment variables in edit modeyou must specify a role for type %sProject-Id-Version: sudo-1.8.20b1 Report-Msgid-Bugs-To: https://bugzilla.sudo.ws PO-Revision-Date: 2017-06-24 14:55+0200 Last-Translator: Fabio Tomat Language-Team: Friulian Language: fur X-Bugs: Report translation errors to the Language-Team address. MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Generator: Poedit 1.8.12 Plural-Forms: nplurals=2; plural=(n != 1); Opzions: %s - modifiche i file come altri utent %s - eseguìs un comant come altri utent %s al à modificâts lis etichetisil grup al pues scrivi su %s%s nol è un file regolâr%s nol è un contest valit%s al è dal uid %u, al varès di jessi di %uducj a puedin scrivi su %s%s lassât no modificât%s al scugne jessi scrivibil dome dal proprietari%s al scugne jessi di proprietât dal uid %d%s al scugne jessi di proprietât dal uid %d e vê stabilît il bit setuid%s no modificât%s%s: %s%s: %s%s: la modifiche dai file intune cartele cun acès in scriture no je permetude%s: la modifiche dai colegaments simbolics no je permetude%s: nol è un file regolâr.%s: scriture curteOpzions di configurazion: %s Dome une des opzions -e, -h, -i, -K, -l, -s, -v o -V e podarès jessi specificadeVersion di sudo: %s Segnâl no cognossûtsiere ducj i descritôrs di file >= numcontignûts de session di modifiche lassâts in %simpussibil vincolâ al font di risorsis predefinît pal progjet "%s"impussibil unîsi al progjet "%s"cree il contest di sigurece SELinux cul rûl specificâtcree il contest di sigurece SELinux cul gjenar specificâtmostre il messaç di jutori e jesmostre informazions di version e jesmodifiche i file invezit di eseguî un comantil uid efetîf nol è %d, %s isal suntun filesystem cun stabilide la opzion 'nosuid' o un filesystem NFS cence privileçs di root?il uid efetîf nol è %d, sudo isal instalât cun setuid root?erôr in %s, rie %d intant che si cjariave il plugin "%s"erôr tal cicli dal eventerôr tal inizializâ il plugin I/O %serôr tal lei dal condot (pipe) dal segnâlerôr tal lei dal socketpairno si è rivâts a otignî old_contextno si è rivâts a stabilî il gnûf rûl %sno si è rivâts a stabilî il gnûf gjenar %serôr fatâl, impussibil cjariâ i pluginsi ignore il plugin I/O duplicât "%s" in %s, rie %dsi ignore il plugin di politiche duplicât "%s" in %s, rie %dsi ignore il plugin di politiche "%s" in %s, rie %din modalitât liste, mostre i privileçs dal utentnumar principâl di version dal plugin %d no compatibil (si spietave %d) cjatât in %serôr interni, %s overflow (stranfât)il valôr percors "%s" no valit in %s, rie %unumar descritôr file no valit: %sgrups massims "%s" no valits in %s, rie %uvalôr no valitvalôr no valit par %s "%s" in %s, rie %uliste i privileçs dal utent o verifiche un comant specific; doprâ dôs voltis pal formât plui luncnissun program pe richieste password specificât, cîr di stabilî SUDO_ASKPASSnissun font di risorsis pal progjet "%s" che al aceti i vincui predefinîtsnissun tty presint e nissun program specificât pe richieste passwordmodalitât no interative, nissune richieste e ven presentadedome un singul plugin di politiche al podarès jessi specificâtil plugin nol à tornât un comant di eseguîerôr di plugin: e mancje la liste file par sudoeditil plugin di politiche %s nol inclût un metodi check_policyil plugin di politiche %s nol supuarte il listâ dai privileçsil plugin di politiche %s nol supuarte lis opzions -k/-Kil plugin di politiche %s nol supuarte la opzion -vil plugin di politiche %s al mancje dal metodi `check_policy'il plugin di politche nol è rivât a inizializâ la sessionpreserve il vetôr dal grup invezit di metilu a chel de destinazionpreserve l'ambient utent cuant che si eseguìs un comantlei la passwrod dal standard inputal domande almancul un argomentsi è rivâts al limit di control de risorseeseguìs il comant (o modifiche il file) come non utent o ID specificâteseguìs il comant come il ID o il non dal grup specificâteseguìs il comant in backgroundeseguìs il comant sul host (se supuartât dal plugin)eseguìs il comant cun la classe di acès BSD specificadeeseguìs une shell di acès come utent di destinazion; si podarès ancje specificâ un comanteseguìs la shell come l'utent di destinazion; si podarès ancje specificâ un comantsesh: erôr interni: strani numar di percorssesh: impussibil creâ file temporanissesh: erôr %d no cognossûtstabilìs la variabile HOME ae cartele home dal utent di destinazionsetproject al à falît pal progjet "%s"il font di risorsis specificât nol esist pal progjet "%s"ferme la elaborazion dai argoments a rie di comantsudoedit nol è supuartât su cheste plateformetermine il comant dopo il limit di timp specificâtlis opzions `-A' e `-S' no podaressin jessi dopradis adunla opzion `-E' no je valide in modalitât di modifichela opzion `-U' e podarès jessi doprade dome cun la opzion `-l'l'argoment di -C al scugne jessi un numar plui grant o compagn a 3impussibil zontâ l'event ae codeimpussibil assegnâ memorieimpussibil assegnâ ptyimpussibil passâ ae cartele a %simpussibil cambiâ root a %simpussibil passâ a un diviers uid (%u, %u)impussibil cambiâ il uid a root (%u)impussibil tornâ a copiâ cualchidun dai file temporanis te lôr posizion origjinarieimpussibil tornâ a copiâ i file temporanis te lôr posizion origjinarieimpussibil creâ il condot (pipe)impussibil creâ socketsimpussibil determinâ ttyimpussibil esguî dup2 su stdinimpussibil eseguî %simpussibil eseguî fgetfilecon %simpussibil cjatâ il simbul "%s" in %simpussibil inglovâ (fâ il fork)impussibil otignî il contest tty atuâl, no si torne a etichetâ ttyimpussibil otignî il gjenar predefinît pal rûl %simpussibil otignî il vetôr di grupimpussibil otignî il gnûf contest tty, no si torne a etichetâ ttyimpussibil inizializâ il plugin de politicheimpussibil cjariâ %s: %simpussibil vierzi %simpussibil vierzi %s, no si torne a etichetâ ttyimpussibil vierzi il sisteme di auditimpussibil vierzi userdbimpussibil lei il file temporaniimpussibil lei l'orloiimpussibil gjavâ PRIV_PROC_EXEC dal PRIV_LIMITimpussibil ripristinâ il contest par %simpussibil ripristinâ la cartele di lavôr atuâlimpussibil ripristinâ il gjestôr pal segnâl %dimpussibil ripristinâ il regjistriimpussibil ripristinâ stdinimpussibil ripristinâ la etichete ttyimpussibil eseguî %simpussibil eseguî %s come une shell di acèsimpussibil salvâ il gjestôr pal segnâl %dimpussibil salvâ stdinimpussibil inviâ il messaç di auditimpussibil stabilî il tty di controlimpussibil stabilî il gid efetîf par eseguî come gid %uimpussibil meti il contest di exec a %simpussibil stabilî il gid a %uimpussibil stabilî il gid par eseguî come gid %uimpussibil stabilî il gjestôr pal segnâl %dimpussibil meti il contest de creazion de clâf a %simpussibil stabilî un gnûf contest ttyimpussibil stabilî la prioritât dal procèsimpussibil stabilî il ID di grup suplementârimpussibil meti il contest di tty a %simpussibil stabilî il uid a %uimpussibil stabilî il contest utentimpussibil eseguî stat su %simpussibil passâ al regjistri "%s" par %simpussibil scrivi su %scondizion di jessude dal fi inspietade: %dgjenar di rispueste inspietade sul backchannel: %dmodalitât 0x%x di sudo inspietadeclasse di acès %s no cognossudegjenar di politiche %d no cognossude, cjatade in %sclasse di sigurece "chr_file" no cognossude, no si torne a etichetâ ttyuid %u no cognossût: cui sêstu?sorzint di grup "%s" no supuartade in %s, rie %uDopre un program di jutori par domandâ la passworddopre il gjenar di autenticazion BSD specificâtdopre la richieste de password specificadel'utent "%s" nol è un membri dal progjet "%s"valôr masse grantvalôr masse piçulavertiment, faliment de assegnazion dal control de risorse pal progjet "%s"no si podarès specificâ dutis dôs lis opzions `-i' e `-E'no si podarès specificâ dutis dôs lis opzions `-i' e `-s'no si podarès specificâ lis variabilis di ambient inte modalitât di modifichesi scugne specificâ un rûl pal gjenar %sPKx{0] D55LC_MESSAGES/sysstat.monu[Qm, ".1?`1!,&!HdW 7 7 1, )^ ; & -  !: \ )o  % '  $",Oc.s-B&-"T'w-3689G !' 3@H%8!: JEA{`+#.& >K$Ty1IJ?Q>%,0/?Mo=#<3\Lg BE#@#9#7$R;$-$K$%0$%U%2n%%)%.%#&)%&-O&}&&?&H&J3'~'0'!'2'9 (3Z(8((9( )#)#?)c) j),).))I)>H*H*!*@*P3+G++-{../01-2.3:M3 3330330 4M;4M4D4Y5v5y55&N@E$QO7'62#-H 01"8PD;=M JG *9>I5BL3<:+/F4K.?! A%  ,)(C Filesystems statistics [A_FS] -B Paging statistics [A_PAGE] -F [ MOUNT ] -H Hugepages utilization statistics [A_HUGE] -I { | SUM | ALL } Interrupts statistics [A_IRQ] -S Swap space utilization statistics [A_MEMORY] -W Swapping statistics [A_SWAP] -b I/O and transfer rate statistics [A_IO] -d Block devices statistics [A_DISK] -m { [,...] | ALL } Power management statistics [A_PWR_...] Keywords are: CPU CPU instantaneous clock frequency FAN Fans speed FREQ CPU average clock frequency IN Voltage inputs TEMP Devices temperature USB USB devices plugged into the system -n { [,...] | ALL } Network statistics [A_NET_...] Keywords are: DEV Network interfaces EDEV Network interfaces (errors) NFS NFS client NFSD NFS server SOCK Sockets (v4) IP IP traffic (v4) EIP IP traffic (v4) (errors) ICMP ICMP traffic (v4) EICMP ICMP traffic (v4) (errors) TCP TCP traffic (v4) ETCP TCP traffic (v4) (errors) UDP UDP traffic (v4) SOCK6 Sockets (v6) IP6 IP traffic (v6) EIP6 IP traffic (v6) (errors) ICMP6 ICMP traffic (v6) EICMP6 ICMP traffic (v6) (errors) UDP6 UDP traffic (v6) FC Fibre channel HBAs SOFT Software-based network processing -q Queue length and load average statistics [A_QUEUE] -r [ ALL ] Memory utilization statistics [A_MEMORY] -u [ ALL ] CPU utilization statistics [A_CPU] -v Kernel tables statistics [A_KTABLES] -w Task creation and system switching statistics [A_PCSW] -y TTY devices statistics [A_SERIAL] CPU activity not found in file. Aborting... File format already up-to-date Invalid data found. Aborting... [Unknown format]-f and -o options are mutually exclusive Average:Cannot append data to that file (%s) Cannot convert the format of this file Cannot find disk data Cannot find the data collector (%s) Cannot handle so many processors! Cannot open %s: %s Cannot read %s Cannot write data to system activity file: %s Cannot write system activity file header: %s Current sysstat version cannot read the format of this file (%#x) Data collector found: %s Data collector will be sought in PATH End of data collecting unexpected End of system activity file unexpected Error while reading system activity file: %s File composition: (%d,%d,%d),(%d,%d,%d),(%d,%d,%d) File created by sar/sadc from sysstat version %d.%d.%dFile date: %s File successfully converted to sysstat format version %s File time: Genuine sa datafile: %s (%x) HZ: Using current value: %lu Host: Inconsistent input data Invalid system activity file: %s Invalid type of persistent device name List of activities: Main options and reports (report name between square brackets): No tape drives with statistics found Not reading from a system activity file (use -f option) Number of activities in file: %u Options are: [ --human ] [ -h ] [ -k | -m ] [ -t ] [ -V ] Options are: [ --human ] [ -h ] [ -k | -m ] [ -t ] [ -V ] [ --debuginfo ] Options are: [ --human ] [ -k | -m ] [ -t ] [ -V ] [ -y ] [ -z ] Options are: [ -A ] [ -B ] [ -b ] [ -C ] [ -D ] [ -d ] [ -F [ MOUNT ] ] [ -H ] [ -h ] [ -p ] [ -q ] [ -r [ ALL ] ] [ -S ] [ -t ] [ -u [ ALL ] ] [ -V ] [ -v ] [ -W ] [ -w ] [ -y ] [ --help ] [ --human ] [ --sadc ] [ -I { | SUM | ALL } ] [ -P { | ALL } ] [ -m { [,...] | ALL } ] [ -n { [,...] | ALL } ] [ -j { ID | LABEL | PATH | UUID | ... } ] [ -f [ ] | -o [ ] | -[0-9]+ ] [ -i ] [ -s [ ] ] [ -e [ ] ] Options are: [ -A ] [ -n ] [ -u ] [ -V ] [ -I { SUM | CPU | SCPU | ALL } ] [ -N { | ALL } ] [ -o JSON ] [ -P { | ON | ALL } ] Options are: [ -C ] [ -D ] [ -F ] [ -L ] [ -V ] [ -S { INT | DISK | IPV6 | POWER | SNMP | XDISK | ALL | XALL } ] Options are: [ -C ] [ -c | -d | -g | -j | -p | -r | -x ] [ -H ] [ -h ] [ -T | -t | -U ] [ -V ] [ -O [,...] ] [ -P { [,...] | ALL } ] [ -s [ ] ] [ -e [ ] ] [ -- ] Options are: [ -c ] [ -d ] [ -h ] [ -k | -m ] [ -N ] [ -s ] [ -t ] [ -V ] [ -x ] [ -y ] [ -z ] [ -j { ID | LABEL | PATH | UUID | ... } ] [ --human ] [ -o JSON ] [ [ -H ] -g ] [ -p [ [,...] | ALL ] ] [ [...] | ALL ] Options are: [ -c ] [ -d ] [ -h ] [ -k | -m ] [ -N ] [ -s ] [ -t ] [ -V ] [ -x ] [ -y ] [ -z ] [ -j { ID | LABEL | PATH | UUID | ... } ] [ --human ] [ -o JSON ] [ [ -H ] -g ] [ -p [ [,...] | ALL ] ] [ [...] | ALL ] [ --debuginfo ] Options are: [ -d ] [ -H ] [ -h ] [ -I ] [ -l ] [ -R ] [ -r ] [ -s ] [ -t ] [ -U [ ] ] [ -u ] [ -V ] [ -v ] [ -w ] [ -C ] [ -G ] [ --human ] [ -p { [,...] | SELF | ALL } ] [ -T { TASK | CHILD | ALL } ] Please check if data collecting is enabled Requested activities not available Requested activities not available in file %s Size of a long int: %d Statistics: Summary:System activity data file: %s (%#x) Unknown activityUsage: %s [ options ] [ [ ] ] Usage: %s [ options ] [ [ ] ] [ -e ] Usage: %s [ options ] [ [ ] ] [ | -[0-9]+ ] Usage: %s [ options ] [ [ ] ] [ ] Using a wrong data collector from a different sysstat version nosysstat version %s yesProject-Id-Version: sysstat-11.7.2 Report-Msgid-Bugs-To: sysstat orange.fr POT-Creation-Date: 2018-02-11 08:31+0100 PO-Revision-Date: 2018-03-15 10:50+0100 Last-Translator: Fabio Tomat Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Bugs: Report translation errors to the Language-Team address. X-Generator: Poedit 2.0.6 Plural-Forms: nplurals=2; plural=(n != 1); Statistichis sui filesystem [A_FS] -B Statistichis su la pagjinazion [A_PAGE] -F [ MOUNT ] -H Statistichis sul ûs di Hugepages [A_HUGE] -I { | SUM | ALL } Statistichis sui interrupt [A_IRQ] -S Statistichis di utilizazion dal spazi di swap [A_MEMORY] -W Statistichis sul swap [A_SWAP] -b Statistichis su I/O e velocitât di trasferiment [A_IO] -d Statistichis sui dispositîfs a blocs [A_DISK] -m { [,...] | ALL } Statistichis su la gjestion de alimentazion [A_PWR_...] Lis peraulis clâf a son: CPU Frecuence di clock istantanie dal CPU FAN Velocitât svintulis FREQ Frecuence di clock medie dal CPU IN Voltaç di ingrès TEMP Temperadure dispositîfs USB Dispositîfs USB tacâts tal sisteme -n { [,...] | ALL } Statistichis rêt [A_NET_...] Lis peraulis clâf a son: DEV Interfacis rêt EDEV Interfacis rêt (erôrs) NFS Client NFS NFSD Servidôr NFS SOCK Socket (v4) IP Trafic IP (v4) EIP Trafic IP (v4) (erôrs) ICMP Trafic ICMP (v4) EICMP Trafic ICMP (v4) (erôrs) TCP Trafic TCP (v4) ETCP Trafic TCP (v4) (erôrs) UDP Trafic UDP (v4) SOCK6 Socket (v6) IP6 Trafic IP (v6) EIP6 Trafic IP (v6) (erôrs) ICMP6 Trafic ICMP (v6) EICMP6 Trafic ICMP (v6) (erôrs) UDP6 Trafic UDP (v6) FC Canâl di fibre HBAs SOFT Elaborazion rêt basade su software -q Statistichis su la lungjece de code e il caric medi [A_QUEUE] -r [ ALL ] Statistichis di utilizazion de memorie [A_MEMORY] -u [ ALL ] Statistichis di utilizazion de CPU [A_CPU] -v Statistichis su lis tabelis dal kernel [A_KTABLES] -w Statistichis su la creazion dal compit e sui cambiaments dal sisteme [A_PCSW] -y Statistichis dispositîfs TTY [A_SERIAL] No son stadis cjatadis ativitâts de CPU intal file. Daûr a interompi... Formât file za inzornât Cjatâts dâts no valits. Daûr a interompi... [Formât no cognossût]Lis opzions -f e -o si escludin un cun chel altri Medie:Impussibil zontâ dâts a chel file (%s) Impussibil convertî il formât di chest file Impussibil cjatâ i dâts dal disc Impussibil cjatâ il coletôr dâts (%s) Impussibil gjestî cussì tancj processôrs! Impussibil vierzi %s: %s Impussibil lei %s Impussibil scrivi dâts tal file des ativitâts di sisteme: %s Impussibil scrivi la intestazion dal file des ativitâts di sisteme: %s La version atuâl di sysstat no rive a lei il formât di chest file (%#x) Cjatât coletôr dâts: %s Il coletôr dâts al vignarà cirût intal PATH Fin de colezion dâts inspietade Fin inspietade dal file des ativitâts di sisteme Erôr inte leture dal file des ativitâts di sisteme: %s Composizion file: (%d,%d,%d),(%d,%d,%d),(%d,%d,%d) File creât doprant sar/sadc di sysstat version %d.%d.%dDate file: %s File convertît cun sucès al formât sysstat version %s Ore file: File di dâts sa autentic: %s (%x) HZ: si dopre il valôr atuâl: %lu Host: Dâts di jentrade inconsistents File des ativitâts di sisteme no valit: %s Gjenar di non dispositîf persistent no valit Liste des ativitâts: Opzions principâls e rapuarts (non dal rapuart tra parentesis cuadris): Nissune unitât a curdele magnetiche cun statistichis cjatade No si sta leint di un file di ativitât di sisteme (dopre la opzion -f) Numar di ativitâts tal file: %u Lis opzions a son: [ --human ] [ -h ] [ -k | -m ] [ -t ] [ -V ] Lis opzions a son: [ --human ] [ -h ] [ -k | -m ] [ -t ] [ -V ] [ --debuginfo ] Lis opzions a son: [ --human ] [ -k | -m ] [ -t ] [ -V ] [ -y ] [ -z ] Lis opzions a son: [ -A ] [ -B ] [ -b ] [ -C ] [ -D ] [ -d ] [ -F [ MOUNT ] ] [ -H ] [ -h ] [ -p ] [ -q ] [ -r [ ALL ] ] [ -S ] [ -t ] [ -u [ ALL ] ] [ -V ] [ -v ] [ -W ] [ -w ] [ -y ] [ --help ] [ --human ] [ --sadc ] [ -I { | SUM | ALL } ] [ -P { | ALL } ] [ -m { [,...] | ALL } ] [ -n { [,...] | ALL } ] [ -j { ID | LABEL | PATH | UUID | ... } ] [ -f [ ] | -o [ ] | -[0-9]+ ] [ -i ] [ -s [ ] ] [ -e [ ] ] Lis opzions a son: [ -A ] [ -n ] [ -u ] [ -V ] [ -I { SUM | CPU | SCPU | ALL } ] [ -N { | ALL } ] [ -o JSON ] [ -P { | ON | ALL } ] Lis opzions a son: [ -C ] [ -D ] [ -F ] [ -L ] [ -V ] [ -S { INT | DISK | IPV6 | POWER | SNMP | XDISK | ALL | XALL } ] Lis opzions a son: [ -C ] [ -c | -d | -g | -j | -p | -r | -x ] [ -H ] [ -h ] [ -T | -t | -U ] [ -V ] [ -O [,...] ] [ -P { [,...] | ALL } ] [ -s [ ] ] [ -e [ ] ] [ -- ] Lis opzions a son: [ -c ] [ -d ] [ -h ] [ -k | -m ] [ -N ] [ -s ] [ -t ] [ -V ] [ -x ] [ -y ] [ -z ] [ -j { ID | LABEL | PATH | UUID | ... } ] [ --human ] [ -o JSON ] [ [ -H ] -g ] [ -p [ [,...] | ALL ] ] [ [...] | ALL ] Lis opzions a son: [ -c ] [ -d ] [ -h ] [ -k | -m ] [ -N ] [ -s ] [ -t ] [ -V ] [ -x ] [ -y ] [ -z ] [ -j { ID | LABEL | PATH | UUID | ... } ] [ --human ] [ -o JSON ] [ [ -H ] -g ] [ -p [ [,...] | ALL ] ] [ [...] | ALL ] [ --debuginfo ] Lis opzions a son: [ -d ] [ -H ] [ -h ] [ -I ] [ -l ] [ -R ] [ -r ] [ -s ] [ -t ] [ -U [ ] ] [ -u ] [ -V ] [ -v ] [ -w ] [ -C ] [ -G ] [ --human ] [ -p { [,...] | SELF | ALL } ] [ -T { TASK | CHILD | ALL } ] Controle se la colezion dâts e je abilitade Lis ativitâts domandadis no son disponibilis Lis ativitâts domandadis no son disponibilis tal file %s Dimension di un intîr lunc: %d Statistichis: Sintesi:File dâts des ativitâts dal sisteme: %s (%#x) Ativitât no cognossudeÛs: %s [ opzions ] [ [ ] ] Ûs: %s [ opzions ] [ [ ] ] [ -e ] Ûs: %s [ opzions ] [ [ ] ] [ | -[0-9]+ ] Ûs: %s [ opzions ] [ [ ] ] [ ] Si sta doprant un coletôr dâts sbaliât che al ven di une version di sysstat diferente nosysstat version %s sìPKx{0]/'oLC_MESSAGES/plymouth.monu[Dl "%d%% completeDo not turn off your computerInstalling Updates...Upgrading System...Project-Id-Version: plymouth 0.9.5 Report-Msgid-Bugs-To: https://gitlab.freedesktop.org/plymouth/plymouth/issues POT-Creation-Date: 2019-06-12 11:54+0200 PO-Revision-Date: 2019-03-19 08:14+0000 Last-Translator: Fabio Tomat Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Generator: Zanata 4.6.2 Plural-Forms: nplurals=2; plural=(n != 1) %d%% completâtNo sta distudâ il computerDaûr a instalâ i inzornaments...Inzornament dal sisteme...PKx{0]^|qqLC_MESSAGES/dnf.monu[ ,:6:@:);B;b;{;;;;$;; < <<3<F<W< k< y<<<<<< < ="=2=C=a= ~=====&=C>[>!w>4> > > > >)>('?$P?'u?'?(?)?&@"?@"b@b@_@HA aAnAvA ~AA#A AAABB/B"GBjB~B?B?BCCaCoiCCC DD8DKD&^D!DDDDD DDDDNEAWEEEZEVFvFFFFF FFF GGG9?GyGGGGG G HH =H0KH|H?H HH$H I)I8IPIjI-}I2I5I5J1JJ1|J/J J JL KQmK2K%K L"L 6LALWL#lLLLL"LLMM MM M*MFM4]M7MMM M!M%N#ANeNmNNNNIN1N+(O&TO${O$O'OO O<P=PNP TP#uPUPP P Q(Q)9QcQ iQsQvQ%Q+QQQLR,[R1R0R7R8#S=\SDS.ST%T7TUT ]T jTtTTTT T%TUU0UDJU:UU;U!V>VQVhV$~VWV!VW0WLCWRWWW-X GXUX]XnXXX"XXX1Y*2Y]Y+Y) Z JZXZ"pZ:ZCZ [3[J[ f[8t[[6[[ \ \&\7\K\_\<u\)\4\].]L]c]y]]]]]].^E^^^w^)^^4^!_$_!D_f__6__8_3`M`<e`=`3`4a)Iasa(a$aa8a2bBbWb ubbbb b bbbMbj=cccccc>c8,d?ed(d dd e.%e.Te+eCeDe8fSfif~fffff0fg0g9gBg6Tgg ggggg#g" h ChNdh(hhh h iT$i yi iiiiiiiii- j8jNjdj}jjjjjjkk-kCkYkokkkk@k.l;7l)sl lllllll m$m=mDmVmkm~mm o,oSxFx%ax+x,xx xy y!y)yGy`y{yyyyCy9z>z Oz Yz"cz*zz!C{e{'{1{+{ |D~W~^~x~~~;~~)).*X ':$#+=Oր-,L%ý7&!F4h,'ʂ(9)>h ΃ڃ*:$N/s, Є ڄ/1CF$,܅#47D| #:),Vf-zKć#3>*r ƈ .2Q7p2'ۉ$+(T%]!2 O>D5Ջ-.\z+ь20Me!}Ս (B\'w# #"%#H l"$"Տ%:Ws":iP?W80$,,WYPZQ]O76Pn"Քy/oPf%ڗOZi šҚ #'Kbfo ʛ֛&!9[z$ʜ 3G$Y+~I!/6 f p z B/מ**20]73Ɵ*%%-KiygKj|* ݡ&'!:\({*TP9U kӤ/*.YmX٥P2sk, ԧܧ ,<A'\F!˨! %F _k"~ 6NPh#~ $ܪ/8F:D<3<6p!!ɬMU9<+̭+ 6Ja$wî ֮ !2Aa=}@%" )%3?Y*Ḭ̇  YAn5?2&1YAͲԲIܲ&7$=$bY *,+?kpy|*=`*E<ѵ@LOKRc;;۷ .7 KVs $ #IC?!͹P(@i&gں-BpYk$Z;׼% B+c@=-20Ga$yj{ C BRDj 3BM&<$#9"]&-##7<<t%*8C$|%+ %F:D W!XyLM&m0+*E<!  )#? c_nYm~JCA+&m I>:5yZg r*).<k ? % .Oi$|(%N5?u|v 5C Wcjs#*4,J`z,BXnH;CM6 2Hh +`+E4nz;%- DOW6seX5:>/nDO)?'i-(BN+sz3"")Laq/:;!]v'+#'l8/#AV;!AA8 GU.u46-@\ k'u !"#' 0J;@ $/J$.68e6P@F`~D -7,8d ,O6K'N2CTn":(!AZ=v (, (6)_/ 6.K dn 3 #)5M% 6HJ@$-+)$NEW  $ I*d#VRo5:#'K S`@o:;%-a2/;+7)c8dF0Cw#$8=V4( +LBl+#$D+\!&*Ep)(5(1A=s,*. +8!d,% "MkE8J8O , %aWXhh\(4!nV+#A-)*&QuC|@LM7(qwI Pa9w=rp F+uhi}<0\8 8y7lR\ A1KKS%'Y C]a`sOe"5!T*qh FB8XIA 1^o ?pT+vUgRoz$qEY6~l/ \3&BiGQ|>hi{=,}_ndDxHO4_ZW%.6E;: N-emPV5=d  4ZwYG]g[.gvQm|{3#ozCaLI>[c#7k2WMBj?XtU-,&fE:e{d*/*)ALr@sr'Vtn]}c% ~bF+m 1yN!Vy`x$"HkOS(Tz#:~)>n9ut_&WJ^?5N'U2JH( D,G)bj-Q<$"4jxf[K0s6.Z0SbPM92` ^k;DRvJ<flc3 X;@p/! Hint: [d]efault, [e]nabled, [x]disabled, [i]nstalled Hint: [d]efault, [e]nabled, [x]disabled, [i]nstalled, [a]ctive Transaction Summary %s Memory : %5s RSS (%5sB VSZ) Started: %s - %s ago State : %s * Maybe you meant: {} Built : %s at %s Installed: %s-%s at %s The application with PID %d is: %s Updated : & (from %s) Conditional Packages: Default Packages: Description: %s Environment-Id: %s Group-Id: %s Language: %s Mandatory Groups: Mandatory Packages: Optional Groups: Optional Packages: or part of a group%d file removed%d files removed%s Exactly Matched: %%s%s Matched: %%s%s is empty file%s marked as group installed.%s marked as user installed.%s removed%s second(s) (last: %s)%s unmarked as user installed.%s, alias %s="%s"%s, using original arguments.%s: has expired and will be refreshed.%s: metadata will expire after %d seconds and will be refreshed now%s: using metadata from %s.%s: will expire after %d seconds.%s: will never be expired and will not be refreshed.(%u days)(%u hours)(%u minutes)(%u seconds)---> Package %s.%s %s will be a downgrade---> Package %s.%s %s will be an upgrade---> Package %s.%s %s will be erased---> Package %s.%s %s will be installed---> Package %s.%s %s will be obsoleted---> Package %s.%s %s will be obsoleting---> Package %s.%s %s will be reinstalled---> Package %s.%s %s will be upgraded--> Finished dependency resolution--> Starting dependency resolution--destdir or --downloaddir must be used with --downloadonly or download or system-upgrade command.--enable, --set-enabled and --disable, --set-disabled must be used with config-manager command.. Failing package is: %sAbortedAction(s)Added %s repo from %sAdding packages from group '%s': %sAlias %s='%s'Alias argument has no value: %sAlias not found: %sAliases added: %sAliases are now disabledAliases are now enabledAliases contain infinite recursionAliases deleted: %sAliases resolving is disabled.All matches were filtered out by exclude filtering for argumentAll matches were filtered out by modular filtering for argumentAll matches were installed from a different repository for argumentAlteredAt least {0}MB more space needed on the {1} filesystem.At least {0}MB more space needed on the {1} filesystem.Autoremove PackagesAvailable Environment Groups:Available Groups:Available Language Groups:Available PackagesAvailable UpgradesBad id for repo: {} ({}), byte = {} {}Bad id for repo: {}, byte = {} {}Begin rpmdb :Begin time :Bugfix notice(s)BugsBuildtimeCOMMANDCVEsCache was expiredCan't convert '{}' to transaction ID. Use '', 'last', 'last-'.Cannot add local packages, because transaction job already existsCannot read file "%s": %sCannot remove %sCannot rollback transaction %s, doing so would result in an inconsistent package database.Cannot undo transaction %s, doing so would result in an inconsistent package database.Changelogs for {}Cleaning data: CleanupCommand "%s" already definedCommand Line :Command lineCommand line error: %sComment :Complete!Config error: %sConfig file "{}" does not existConfiguration file URL "{}" could not be downloaded: {}Could not find repository: %sCould not open: {}Could not run transaction.Could not set cachedir: {}Critical Security notice(s)Critical/Sec.DNSSEC extension: DNSSEC extension: Key for user Date and timeDefault profile {} not available in module {}:{}Delta RPM rebuild failedDelta RPMs reduced %.1f MB of updates to %.1f MB (%d.1%% saved)Dep-InstallDependencies resolved.Dependent packageDependent packagesDescriptionDescription : Didn't install any keysDisabling module profilesDisk Requirements:Display capabilities provided by the package.Display capabilities that the package can enhance.Display capabilities that the package can supplement.Display capabilities that the package conflicts with.Display capabilities that the package depends on.Display capabilities that the package recommends.Display capabilities that the package suggests.Display only available packages.Display only installed packages.Display only packages that are not present in any of available repositories.Display only packages that provide an upgrade for some already installed package.Display only packages that were installed by user.Display only recently edited packagesDowngradeDowngrade a packageDowngradedDownloading Packages:Enabled modules: {}.Enabling different stream for '{}'.End rpmdb :End time :Enhancement notice(s)Environment '%s' is not installed.Environment Group: %sEpochEraseErasedErasingError SummaryError downloading packages:Error parsing '%s': %sError parsing --setopt with key '%s', value '%s': %sError parsing --setopt with key '%s.%s', value '%s': %sError storing transaction: {}Error:Error: %sError: Cannot open %s for readingError: transaction check vs depsolve:Errors occurred during transaction.Errors:Excludes in dnf.conf: Excludes in repo Extra PackagesFailedFailed Delta RPMs increased %.1f MB of updates to %.1f MB (%d.1%% wasted)Failed to add groups file for repository: %s - %sFailed to execute command '%s': returned %dFailed to load expired repos cache: %sFailed to remove transaction file %sFailed to send an email via '%s': %sFailed to store expired repos cache: %sFailure:Failures:File %s is a source package and cannot be updated, ignoring.Filename : %sFilesForce the use of an architectureFound more than one transaction ID!Found more than one transaction ID. '{}' requires one transaction ID or package name.Freed space: %sFrom repoGPG Keys are configured as: %sGPG check FAILEDGPG key at %s (0x%s) is already installedGroupGroup: %sIDIgnoring repositories: %sIgnoring unnecessary profile: '{}/{}'Import of key(s) didn't help, wrong key(s)?Important Security notice(s)Important/Sec.Importing GPG key 0x%s: Userid : "%s" Fingerprint: %s From : %sInclude bugfix relevant packages, in updatesInclude enhancement relevant packages, in updatesInclude newpackage relevant packages, in updatesInclude packages needed to fix the given BZ, in updatesInclude packages needed to fix the given CVE, in updatesInclude packages needed to fix the given advisory, in updatesInclude security relevant packages matching the severity, in updatesInclude security relevant packages, in updatesIncludes in dnf.conf: Includes in repo Incorrect or unknown "{}": {}InstallInstall timeInstalledInstalled Environment Groups:Installed Groups:Installed Language Groups:Installed PackagesInstalled byInstalled package %s%s not available.Installed size: %sInstalling dependenciesInstalling group packagesInstalling module '{0}' from Fail-Safe repository {1} is not allowedInstalling module from Fail-Safe repository is not allowedInstalling module profilesInstalling newer version of '{}' than specified. Reason: {}Installing weak dependenciesInstant (last: %s)Interact with Modules.Invalid alias key: %sInvalid groups sub-command, use: %s.Invalid transaction ID range definition '{}'. Use '..'.Invalid tsflag in config file: %sIs this ok [Y/n]: Is this ok [y/N]: It could be a {PROG} plugin command, try: "{prog} install 'dnf-command(%s)'"It could be a {prog} plugin command, but loading of plugins is currently disabled.Key import failed (code %d)Key imported successfullyLast metadata expiration check: %s ago on %s.Leaving ShellLicenseLicense : %sList of Main Commands:List of Plugin Commands:List or create command aliasesLoading repository '{}' has failedLow Security notice(s)Low/Sec.Main config did not have a %s attr. before setoptMaking cache files for all metadata files.Malformed lock file found: %s. Ensure no other dnf/yum process is running and remove the lock file manually or run systemd-tmpfiles --remove dnf.conf.Marking packages as installed by the group:Marking packages as removed by the group:Matched from:Metadata cache created.Metadata cache refreshed recently.Metadata timer caching disabled when running on a battery.Metadata timer caching disabled when running on metered connection.Metadata timer caching disabled.Metadata type to cleanModerate Security notice(s)Moderate/Sec.Modular dependency problem:Modular dependency problems:Module specificationMore than one argument given as transaction file name.Never (last: %s)New Package notice(s)NewerNo Matches foundNo alias specified.No aliases defined.No aliases specified.No default profiles for module {}:{}. Available profiles: {}No duplicated packages found for removal.No group data available for configured repositories.No group marked for upgrade.No groups marked for removal.No match for alias: %sNo match for argumentNo match for argument: %sNo match for group package "{}"No match for package {}No matches found.No matching Modules to listNo matching Packages to listNo old installonly packages found for removal.No package %s available.No package %s installed.No package available.No package installed from the repository.No package installed.No packages marked for distribution synchronization.No packages marked for downgrade.No packages marked for install.No packages marked for reinstall.No packages marked for removal.No packages marked for upgrade.No profile specified for '{}', please specify profile.No profiles for module {}:{}No read/execute access in current directory, moving to /No repositories availableNo repository match: %sNo security updates needed for "{}", but {} update availableNo security updates needed for "{}", but {} updates availableNo security updates needed, but {} update availableNo security updates needed, but {} updates availableNo such command: %s. Please use %s --helpNo transaction ID givenNo transaction ID or package name given.No transaction ID, or package, givenNo transaction file name given.No transaction which manipulates package '{}' was found.No transactionsNot a valid form: %sNot a valid rpm file path: %sNot installedNot overwriting {}, exiting.Nothing to do.Nothing to show.ObsoletedObsoletingObsoleting PackagesOlderOnly module name is required. Ignoring unneeded information in argument: '{}'Only module name, stream, architecture or profile is used. Ignoring unneeded information in argument: '{}'Operation aborted.Other : %sPACKAGEPROVIDEPackagePackagesPackage "{}" from local repository "{}" has incorrect checksumPackage "{}" from repository "{}" has incorrect checksumPackage %s available, but installed for different architecture.Package %s available, but not installed.Package %s is already installed.Package %s is not installed.Package %s is not signedPackage %s not installed, cannot downgrade it.Package %s not installed, cannot reinstall it.Package %s not installed, cannot update it.Package %s of lower version already installed, cannot downgrade it.Package %s of lowest version already installed, cannot downgrade it.Package name specificationPackage specificationPackage to downgradePackage to installPackage to reinstallPackage to removePackage to synchronizePackage to upgradePackage {} belongs to multiple modules, skippingPackage {} contains no filesPackagerPackagesPackages Altered:Packages for argument %s available, but not installed.Parsing file "%s" failed: %sPreparingProblemProblem opening package %sProblem repository: %sProvide : %sProvide specification to search forPublic key for %s is not installedPublic key for %s is not trustedQuery all packages (shorthand for repoquery '*' or repoquery without argument)Query all versions of packages (default)REPOIDRPM: {}RPMDB altered outside of {prog}.Recently Added PackagesRefusing to automatically import keys when running unattended. Use "-y" to override.ReinstallReinstalledReleaseRemoveRemovedRemovingRemoving dependent packagesRemoving file %sRemoving unused dependenciesRepo : %sRepo %s did not have a %s attr. before setoptRepo-available-pkgs: Repo-baseurl : Repo-distro-tags : Repo-exclude : Repo-excluded : Repo-expire : Repo-filename : Repo-id : Repo-include : Repo-metalink : Repo-mirrors : Repo-name : Repo-pkgs : Repo-revision : Repo-size : Repo-status : Repo-tags : Repo-updated : Repository '{}' ({}) is missing name in configuration, using id.Repository '{}' ({}): Error parsing config: {}Repository '{}' is missing name in configuration, using id.Repository '{}': Error parsing config: {}Repository IDRepository specificationReturn-Code :RightsRunningRunning scriptletRunning transactionRunning transaction checkRunning transaction testSCRIPTScriptlet output:Searching Packages: Security notice(s)SeverityShell specific arguments: config set config options help print help repository (or repo) enable, disable or list repositories resolvedep resolve the transaction set transaction (or ts) list, reset or run the transaction set run resolve and run the transaction set exit (or quit) exit the shellSkipSkipping packages with broken dependencies%sSkipping packages with conflicts: (add '%s' to command line to force their upgrade)SleepingSome packages from local repository have incorrect checksumSome packages have invalid cache, but cannot be downloaded due to "--cacheonly" optionSome packages were not downloaded. Retrying.SourceStarted dnf-automatic.SuccessSystemSystem is off-line.Testing already imported keys for their validity.The GPG keys listed for the "%s" repository are already installed but they are not correct for this package. Check that the correct key URLs are configured for this repository.The downloaded packages were saved in cache until the next successful transaction.The following updates are available on '%s':The following updates have been applied on '%s':The following updates were downloaded on '%s':The key has been approved.The key has been rejected.The operation would result in switching of module '{0}' stream '{1}' to stream '{2}'The same or higher version of %s is already installed, cannot update it.The specs that will be installedThe specs that will be removedThere are following alternatives for "{0}": {1}There are no enabled repositories in "{}".There was an error calculating installed sizeThere was an error calculating total download sizeThis command has to be run with superuser privileges (under the root user on most systems).To diagnose the problem, try running: '%s'.TotalTotal download size: %sTotal size: %sTraced/StoppedTransaction ID :Transaction check succeeded.Transaction couldn't start:Transaction failedTransaction history is incomplete, after %u.Transaction history is incomplete, before %u.Transaction performed with:Transaction saved to {}.Transaction test error:Transaction test succeeded.TransactionItem not found for key: {}TransactionSWDBItem not found for key: {}TypeURLURL : %sUnable to detect release version (use '--releasever' to specify release version)Unable to find a mandatory group package.Unable to find a matchUnable to find information about the locking process (PID %d)Unable to match profile for argument {}. Available profiles for '{}:{}': {}Unable to resolve argument {}Unable to retrieve a key for a commandline package: %sUnexpected value of environment variable: DNF_DISABLE_ALIASES=%sUninterruptibleUnknownUnknown Security notice(s)Unknown configuration option: %s = %sUnknown configuration option: %s = %s in %sUnknown configuration value: %s=%s in %s; %sUnknown repo: '%s'Unknown/Sec.Unsupported key value.Update IDUpdatedUpdates Information Summary: Updates applied on '%s'.Updates available on '%s'.Updates completed at %sUpdates downloaded on '%s'.UpgradeUpgradedUpgrading module '{0}' from Fail-Safe repository {1} is not allowedUpgrading module from Fail-Safe repository is not allowedUser :User nameVerifyingWaiting for internet connection...Waiting for process with pid %d to finish.Warning: Enforcing GPG signature check globally as per active RPM security policy (see 'gpgcheck' in dnf.conf(5) for how to squelch this message)Warning: Group %s does not exist.Warning: No groups match:Warning: failed loading '%s', skipping.You can remove cached packages by executing '%s'.You don't have access to the history DB: %sYou have enabled checking of packages via GPG keys. This is a good thing. However, you do not have any GPG public keys installed. You need to download the keys for packages you wish to install and install them. You can do that by running the command: rpm --import public.gpg.key Alternatively you can specify the url to the key you would like to use for a repository in the 'gpgkey' option in a repository section and {prog} will install it for you. For more information contact your distribution or package provider.You probably have corrupted RPMDB, running '%s' might fix the issue.Zombieaction to do with aliasesadd a comment to transactionalias definitionallallow erasing of installed packages to resolve dependenciesargument for group subcommandargument {}: not allowed with argument {}automatically answer no for all questionsautomatically answer yes for all questionsavailableavailable subcommands: {} (default), {}bad format: %sbugfixcheck dependencies exactly as given, opposite of --alldepscheck for available package upgradescheck for problems in the packagedbcheck non-explicit dependencies (files and Provides); defaultconfig file locationcontrol whether color is usedcurrentlyDowngradingcurrentlyInstallingcurrentlyReinstallingcurrentlyUpgradingdebugging output leveldebugging output level for rpmdetermining the fastest mirror (%s hosts).. disable a module with all its streamsdisable aliases resolvingdisable all pluginsdisable plugins by namedisable removal of dependencies that are no longer useddisableddisplay a helpful usage messagedisplay advisories about packagesdisplay details about a package or group of packagesdisplay the configured software repositoriesdisplay, or use, the groups informationdisplay, or use, the transaction historydo not install documentationsdonedumps detailed solving results into filesenable a module streamenable aliases resolvingenable plugins by nameenabledenabling %s repositoryenhancementerror output levelfalsefind what package provides the given valuegenerate the metadata cachehas unknown status.include optional packages from groupinstall a module profile including its packagesinstall a package or packages on your systeminstalledis valid.limit the query to installed duplicate packageslimit the query to installed installonly packageslimit the query to installed packages with unsatisfied dependencieslist a package or groups of packageslist all module streams, profiles and stateslist modular packageslist packages belonging to a moduleloading repo '{}' failure: {}longRepositorymark or unmark installed packages as installed by user.maximum command wait timennewpackagenoonly download packagesoperate on corresponding source RPMother notice(s)override the value of $releasever in config and repo filesprint detailed information about a modulequiet operationreinstall a packageremove a package or packages from your systemremove all modular packagesremove all unneeded packages that were originally installed as dependenciesremove cached dataremove duplicated packagesremove installed module profiles and their packagesremove installonly packages over the limitreplacingrepo %s: 0x%s already importedrepo %s: imported key 0x%s.repo idrepo namereset a moduleresolve depsolve problems by skipping packagesresolve to IPv4 addresses onlyresolve to IPv6 addresses onlyrun commands on top of all packages in given repositoryrun entirely from system cache, don't update cachesearch also package description and URLsearch for packages matching keywordsearch package details for the given stringsecurityset arbitrary config and repo optionsset directory to copy packages toset install rootset metadata as expired before running the commandshortReposhow N latest packages for a given name.arch (or latest but N if N is negative)show a list of all dependencies and what packages provide themshow a location from where packages can be downloadedshow all packages (default)show all problems; defaultshow all reposshow also ID of groupsshow also hidden groupsshow available tags to use with --queryformatshow changelogs before updateshow command helpshow dependency problemsshow detailed information about the packageshow disabled reposshow duplicate problemsshow duplicates, in repos, in list/search commandsshow enabled repos (default)show info of advisoriesshow list of advisoriesshow list of files in the packageshow obsoleted packagesshow only autoremove packagesshow only available groupsshow only available packagesshow only disabled modulesshow only enabled modulesshow only extras packagesshow only installed groupsshow only installed modules or packagesshow only installed packagesshow only recently changed packagesshow only results from this ARCHshow only results that conflict REQshow only results that enhance REQshow only results that obsolete REQshow only results that owns FILEshow only results that provide REQshow only results that recommend REQshow only results that suggest REQshow only results that supplement REQshow only upgrades packagesshow package source RPM nameshow problems with providesshow profile contentshow recursive tree for package(s)shows results that requires package provides and files REQshows results that requires, suggests, supplements, enhances,or recommends package provides and files REQstatussynchronize installed packages to the latest available versionsthe key to search fortruetry the best available package versions in transactions.unknownupdate packages associated with an active streamupdatesupgrade a package or packages on your systemupgrade, but only 'newest' package match which fixes a problem that affects your systemuse epoch:name-version-release.architecture format for displaying found packagesuse name-epoch:version-release.architecture format for displaying found packages (default)use name-version-release format for displaying found packages (rpm query default)used with --whatrequires, and --requires --resolve, query packages recursively.verbose operationyyes{prog} command to get help for{prog} will only download packages for the transaction.{prog} will only download packages, install gpg keys, and check the transaction.{} exit the shell{} resolve the transaction set{} run the transaction{} [command] print help{} arg list: lists the contents of the transaction reset: reset (zero-out) the transaction run: run the transaction{} arg [option] list: lists repositories and their status. option = [all | id | glob] enable: enable repositories. option = repository id disable: disable repositories. option = repository id{} arg [value] arg: debuglevel, errorlevel, obsoletes, gpgcheck, assumeyes, exclude, repo_id.gpgcheck, repo_id.exclude If no value is given it prints the current value. If value is given it sets that value.{} exists, overwrite?{} has missing requires of {}{} is a duplicate with {}{} is obsoleted by {}{} provides {} but it cannot be found{} {} {}: too few argumentsProject-Id-Version: PACKAGE VERSION Report-Msgid-Bugs-To: POT-Creation-Date: 2023-02-28 10:03+0100 PO-Revision-Date: 2020-09-25 13:29+0000 Last-Translator: Fabio Tomat Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=n != 1; X-Generator: Weblate 4.2.2 Sugjeriment: [d] predefinît, [e] abilitât, [x] disabilitât, [i] installât Sugjeriment: [d] predefinît, [e] abilitât, [x] disabilitât, [i] installât, [a] atîf Sintesi de transazion %s Memorie : %5s RSS (%5sB VSZ) Inviât: %s - %s indaûr Stât : %s * forsit si intindeve: {} Compilât : %s al/ai %s Instalât: %s-%s al/ai %s La aplicazion cun PID %d e je: %s Inzornât : , (di %s) Pachets condizionâi: Pachets predefinîts: Descrizion: %s Id-ambient: %s Id-grup: %s Lenghe: %s Grups obligatoris: Pachets obligatoris: Grups opzionâi: Pachets opzionâi: o part di un grup%d file gjavât%d files gjavâtsCorispondence esate in %s: %%sCorispondence in %s: %%s%s al è un file vueit%s segnât come grup instalât.%s segnât come instalât dal utent.%s gjavât%s secont(s) (ultin: %s)gjavât il segn di “instalât dal utent” su %s.%s, alias %s="%s"%s, si dopre i argoments origjinâi.%s: al è scjadût e al vignarà inzornât.%s: i metadâts a scjadaran dopo %d seconts e a vignaran inzornâts cumò%s: si dopre i metadâts di %s.%s: al scjadarà dopo %d seconts.%s: nol scjadarà mai e nol vignarà inzornât.(%u dîs)(%u oris)(%u minûts)(%u seconts)---> Il pachet %s.%s %s al sarà puartât a une version precedente---> Il pachet %s.%s %s al sarà un inzornament---> Il pachet %s.%s %s al sarà eliminât---> Il pachet %s.%s %s al sarà instalât---> Il pachet %s.%s %s al deventarà sorpassât---> Il pachet %s.%s %s al rindarà sorpassât un altri---> Il pachet %s.%s %s al sarà tornât a instalâ---> Il pachet %s.%s %s al sarà inzornât--> Risoluzion des dipendencis finide--> Si scomence la risoluzion des dipendencis--destdir o --downloaddir a scugnin jessi doprâts cul comant --downloadonly o download o system-upgrade.--enable, --set-enabled e --disable, --set-disabled a scugnin jessi doprâts cul comant config-manager.. Il pachet difetôs al è: %sInterotAzion(s)Zontât repo %s di %sDaûr a zontâ i pachets dal grup '%s': %sAlias %s='%s'L'argoment dal alias nol à valôr: %sAlias no cjatât: %sAlias zontâts: %sI alias a son cumò disabilitâtsI alias a son cumò abilitâtsI alias a contegnin ricorsions infinidisAlias eliminâts: %sLa risoluzion dai alias e je disabilitade.Dutis lis corispondencis a son stadis filtradis dal filtri di esclusion pal argomentDutis lis corispondencis a son stadis filtradis dal filtri modulâr pal argomentDutis lis corispondencis a son stadis instaladis di un dipuesit diferent pal argomentModificâtAl covente ancjemò almancul {0}MB di spazi sul filesystem {1}.A coventin ancjemò almancul {0}MB di spazi sul filesystem {1}.Pachets in rimozion automaticheGrups di ambient disponibii:Grups disponibii:Grups lenghe disponibii:Pachets disponibiiInzornaments disponibiiId sbaliât pal dipuesit: {} ({}), byte = {} {}Id sbaliât pal dipuesit: {}, byte = {} {}rpmdb iniziâl :Ore di inizi :Avîs di risoluzion erôrErôrsDate di compilazionCOMANTCVELa cache e jere scjadudeImpussibil convertî '{}' a ID di transazion. Dopre '', 'last', 'last-'.Impussibil zontâ pachets locâi par vie che il lavôr de transazion al esist zaImpussibil lei il file "%s": %sImpussibil gjavâ %sImpussibil tornâ indaûr de transazion %s, fâlu al podarès fâ deventâ incoerente la base di dâts dai pachets.Impussibil anulâ la transazion %s, fâlu al podarès fâ deventâ incoerente la base di dâts dai pachets.Regjistris des modifichis par {}Daûr a netâ dai dâts: NetisieComant "%s" za definîtRie di comant :Rie di comantErôr rie di comant: %sComent :Fat!Erôr di configurazion: %sIl file di configurazion "{}" nol esistIl URL dal file di configurazion "{}" nol pues jessi discjariât: {}Impussibil cjatâ il dipuesit: %sImpussibil vierzi: {}Impussibil eseguî la transazion.Impussibil stabilî cachedir: {}Avîs di sigurece criticCritic/Sig.Estension DNSSEC: Estension DNSSEC: clâf pal utent Date e oreProfîl predefinît {} no disponibil intal modul {}:{}Ricostruzion delta RPM falideI RPM Delta a àn ridot %.1f MB di inzornaments a %.1f MB (%d.1%% sparagnâts)Instalazion-dipendencisDipendencis risoltis.Pachet dipendentPachets dipendentsDescrizionDescrizion : No si à instalât nissune clâfDaûr a disabilitâ profîi di moduiRecuisîts dal disc:Mostre lis funzionalitâts furnidis dal pachet.Mostre lis funzionalitâts che il pachet al pues miorâ.Mostre lis funzionalitâts che il pachet al pues integrâ.Mostre lis funzionalitâts che cun chês al va in conflit il pachet.Mostre lis funzionalitâts che su chês il pachet al dipent.Mostre lis funzionalitâts che il pachet al consee.Mostre lis funzionalitâts che il pachet al sugjerìs.Mostre dome i pachets disponibii.Mostre dome i pachets instalâts.Mostre dome i pachets che no son presints in nissun dai dipuesits disponibii.Mostre dome i pachets che a furnissin un inzornament par cualchi pachet za instalât.Mostre dome i pachets che a son stâts instalâts dal utent.Mostre dome i pachets modificâts di resintCessâ di versionTorne a une version precedente di un pachetCessâts di versionDiscjariament pachets:Modui abilitâts: {}.Si abilite un flus diviers par '{}'.rpmdb finâl :Ore finâl :Avîs di mioramentL'ambient '%s' nol è instalât.Grup ambient: %sEpocheElimineEliminâtDaûr a eliminâSintesi erôrsErôr tal discjariâ i pachets:Erôr tal analizâ '%s': %sErôr tal analizâ --setopt cu la clâf '%s', valôr '%s': %sErôr tal analizâ --setopt cu la clâf '%s.%s', valôr '%s': %sErôr tal archiviâ la transazion: {}Erôr:Erôr: %sErôr: impussibil vierzi %s pe letureErôr: control de transazion cuintri di risoluzion dipendencis:Erôrs vignûts fûr dilunc la transazion.Erôrs:Esclusions in dnf.conf: Esclusions tal dipuesit Pachets extraFalîtsI RPM Delta falîts a àn aumentât %.1f MB di inzornaments a %.1f MB (%d.1%% straçâts)No si è rivâts a zontâ il file dai grups pal dipuesit: %s - %sNo si è rivâts a eseguî il comant '%s': tornât %dNo si è rivâts a cjariâ la cache dai dipuesits scjadûts: %sNo si è rivâts a gjavâ il file de transazion %sNo si è rivâts a inviâ une e-mail vie '%s': %sNo si è rivâts a archiviâ la cache dai dipuesits scjadûts: %sErôr:Erôrs:Il file %s al è un pachet sorzint e nol pues jessi inzornât, si ignore.Non file : %sFilesSfuarce il doprâ di une architetureCjatade plui di un ID di transazion!Cjatât plui di un ID di transazion. '{}' al domande 1 ID di transazion o non di pachet.Spazi liberât: %sDal dipuesitLis clâfs GPG a son configuradis come: %sControl GPG FALÎTLa clâf GPG su %s (0x%s) e je za instaladeGrupGrup: %sIDDipuesits ignorâts: %sSi ignore i profîi no necessaris: '{}/{}'Importazion de(s) clâf(s) no suficiente, clâf(s) sbaliadis?Avîs di sigurece impuartantImpuartant/Sig.Daûr a impuartâ la clâf GPG 0x%s: ID utent : "%s" Impronte digjitâl: %s Di : %sIntai inzornaments, inclût i pachets relatîfs a corezions di erôrsIntai inzornaments, inclût i pachets relatîfs a mioramentsIntai inzornaments, inclût i pachets relatîfs a gnûfs pachetsIntai inzornaments, inclût i pachets necessaris par justâ l'erôr indicâtIntai inzornaments, inclût i pachets necessaris par justâ il CVE indicâtIntai inzornaments, inclût i pachets necessaris par justâ il consultîf indicâtIntai inzornaments, inclût i pachets relatîfs ae sigurece che a corispuindin al nivel di sigureceIntai inzornaments, inclût i pachets relatîfs ae sigureceInclusions in dnf.conf: Inclusions tal dipuesit "{}" no just o no cognossût: {}InstalâDate di instalazionInstalâtsGrups di ambient instalâts:Grups instalâts:Grups lenghe instalâts:Pachets instalâtsInstalât diPachet instalât %s%s no disponibil.Dimension di instalât: %sDaûr a instalâ lis dipendencisDaûr a instalâ i pachets dal grupNo je permetude la instalazion dal modul '{0}' dal dipuesit Fail-Safe {1}No je permetude la instalazion dal modul dal dipuesit Fail-SafeDaûr a instalâ profîi di moduiDaûr a instalâ une version plui di '{}' rispiet a chê specificade. Motîf: {}Daûr a instalâ lis dipendencis debulisIstantani (ultin: %s)Interagjìs cui Modui.clâf di alias no valide: %sSot-comant groups no valit, dopre: %s.Definizion di interval dal ID di transazion '{}' no valit. Dopre '..'.tsflag no valit tal file di configurazion: %sIsal just [Y/n]: Isal just [s/N]: Al podarès jessi un comant di plugin di {PROG}, prove "{prog} install 'dnf-command(%s)'"Al podarès jessi un comant di plugin di {prog}, ma pal moment il cjariament di plugins al è disabilitât.Importazion clâf falide (codiç %d)Clâf impuartade cun sucèsUltin control de scjadence dai metadâts: %s indaûr ai %s.Daûr a lassâ la shellLicenceLicence : %sListe di comants principâi:Liste di comants dai plugin:Liste o cree i alias dai comantsIl cjariament dal dipuesit '{}' al è falitAvîs di sigurece basBas/Sig.La configurazion principâl no à un atribût %s prime di setoptDaûr a creâ i files de cache par ducj i files di metadâts.Cjatât file di bloc malformât: %s. Sigurâsi che nissun altri procès dnf/yum al sedi in esecuzion e gjavâ a man il file di bloc opûr eseguî systemd-tmpfiles --remove dnf.conf.Daûr a segnâ i pachets come instalâts dal grup:Daûr a segnâ i pachets come gjavâts dal grup:Corispondence cjatade in:Cache metadâts creade.Cache metadâts inzornade di resint.Memorizazion in cache dal temporizadôr dai metadâts disabilitade cuant che si è alimentâts de batarie.La memorizazion in cache dal temporizadôr dai metadâts e je disabilitade cuant che si sta doprant une conession a consum.Memorizazion in cache dal temporizadôr dai metadâts disabilitade.Gjenar di meta-dât di netâAvîs di sigurece moderâtModerât/Sig.Probleme di dipendence modulâr:Problemis di dipendence modulâr:Specificazion dal modulSi à indicât, come non di file de transazion, plui di un argoment.Mai (ultin: %s)Avîs di gnûfs pachetsPlui resintNissune corispondence cjatade.Nissun alias specificât.Nissun alias definît.Nissun alias specificât.Nissun profîl predefinît pal modul {}:{}. Profîi disponibii: {}Nissun pachet dopli cjatât di gjavâ.Nissun dât sui grups disponibil pai dipuesits configurâts.Nissun grup segnât pal inzornament.Nissun grup segnâ pe rimozion.Nissune corispondence pal alias: %sNissune corispondence pal argomentNissune corispondence pal argoment: %sNissune corispondence pal pachet di grup "{}"Nissune corispondence pal pachet {}Nissune corispondence cjatade.Nissun Modul corispondent di listâNo si à pachets disponibii che a corispuindin ae listeNissun pachet vieri di dome instalazion cjatât pe rimozion.Nissun pachet %s disponibil.Nissun pachet %s instalât.Nissun pachet disponibil.Nissun pachet instalât dal dipuesit.Nissun pachet instalât.Nissun pachet segnât pe sincronizazion de distribuzion.Nissun pachet segnât pe regression.Nissun pachet segnât pe instalazion.Nissun pachet segnât di tornâ a instalâ.Nissun pachet segnât di gjavâ.Nissun pachet segnât pal avanzament.Nissun profîl specificât par '{}', par plasê specifiche un profîl.Nissun profîl pal modul {}:{}Nissun acès in leture/esecuzion te cartele atuâl, si spostisi su /Nissun dipuesit disponibilDipuesit cence corispondence: %sNol covente nissun inzornament di sigurece par "{}", ma {} inzornament al è disponibilNol covente nissun inzornament di sigurece par "{}", ma {} inzornaments a son disponibiiNissun inzornament di sigurece necessari, ma al è disponibil {} inzornamentNissun inzornament di sigurece necessari, ma a son disponibii {} inzornamentsComant inesistent: %s. Dopre %s --helpNissun ID di transazion furnîtNissun ID di transazion o non di pachet furnît.Nissun ID di transazion, o pachet, indicâtNissun non di file di transazion indicât.No je stade cjatade nissune transazion che e manipole il pachet '{}'.Nissune transazionFormât no valit: %sPercors dal file rpm no valit: %sNo instalâtNo si sorescrîf {}, si jes.Nuie ce fâ.Nuie di mostrâ.Deventât sorpassâtDaûr a rindi obsoletDaûr a rindi sorpassâts i pachetsPlui vieliAl covente dome il non dal modul. Si ignore lis informazions che no coventin tal argoment: '{}'A vegnin doprâts dome il non, il flus, la architeture o il profîl dal modul. Si ignore lis informazions no necessaris tal argoment: '{}'Operazion interote.Altri : %sPACHETFURNÌSPachetPachetsIl pachet "{}" dal dipuesit locâl "{}" al à une sume di control sbaliadeIl pachet "{}" dal dipuesit "{}" al à une sume di control sbaliadePachet %s disponibil, ma instalât par une architeture diferente.Pachet %s disponibil, ma no instalât.Il pachet %s al è za instalât.Il pachet %s nol è instalât.Il pachet %s nol è firmâtIl pachet %s nol è instalât, impussibil cessâlu ae version precedente.Il pachet %s nol è instalât, impussibil tornâ a instalâlu.Il pachet %s nol è instalât, impussibil inzornâlu.Pachet %s, di version plui basse, za instalât, impussibil cessâlu ae version precedente.Pachet %s, de version plui basse pussibile, za instalât, impussibil cessâlu a une version precedente.Specificazion dal non dal pachetSpecificazion pachetPachet di puartâ a une version precedentePachet di instalâPachet di tornâ a instalâPachet di gjavâPachet di sincronizâPachet di inzornâIl pachet {} al aparten a plui modui, si salteIl pachet {} nol conten filesImpachetadôrPachetsPachets modificâts:A son disponibii pachets pal argoment %s, ma no son instalâts.Analisi dal file "%s" falide: %sDaûr a prontâProblemeProbleme tal vierzi il pachet %sDipuesit dal probleme: %sAl furnìs : %sIndiche la specificazion pe ricercjeLa clâf publiche par %s no je instaladeLa clâf publiche par %s no je fidadeInteroghe ducj i pachets (scurte par repoquery '*' o repoquery cence argoment)Interoghe dutis lis version dai pachets (predefinît)REPOIDRPM: {}RPMDB alterât fûr di {prog}.Pachets zontâts di resintSi refude la importazion automatiche di clâfs cuant che si è in modalitât no-interative. Doprâ "-y" par sfuarçâ.Torne instaleTornâts a instalâPublicazionGjavâGjavâtsDaûr a gjavâDaûr a gjavâ i pachets dipendentsRimozion dal file %sDaûr a gjavâ lis dipendencis no dopradisDipuesit : %sIl dipuesit %s nol à un atribût %s prime di setoptPachets-disponibii-dipuesit: Url-base-dipuesit : Etichetis-dist.-dipues.: Esclusions-dipuesit: Escludûts-dipuesit : Scjadence-dipuesit : Non-file-dipuesit : ID-dipuesit : Inclusions-dipuesit: Metalink-dipuesit : Dipuesits-spieli : Non-dipuesit : Pachets-dipuesit : Revision-dipuesit : Dimension-dipuesit : Stât-dipuesit : Etichetis-dipuesit : Dipuesit-inzornât : Al dipuesit '{}' ({}) i mancje il non inte configurazion, si dopre l'id.Dipuesit '{}' ({}): Erôr tal analizâ la configurazion: {}Al dipuesit '{}' i mancje il non inte configurazion, si dopre l'id.Dipuesit '{}': Erôr tal analizâ la configurazion: {}ID dal dipuesitSpecificazion dal dipuesitCodiç di jessude :DiritsIn esecuzionEsecuzion scriptletEsecuzion transazion.Esecuzion control de transazionEsecuzion prove di transazionSCRIPTJessude dal scriptlet:Daûr a cirî i pachets: Avîs di sigureceGravitâtArgoments specifics de Shell: config stabilìs lis opzions di configurazion help stampe jutori repository (o repo) abilite, disabilite o liste i dipuesits resolvedep risolf la cumbinazion de transazion transaction (o ts) liste, azere o eseguìs la cumbinazion de transazion run risolf e eseguìs la cumbinazion de transazion exit (o quit) jes de shellSaltâSi salte i pachets cun dipendencis rotis %sSi salte i pachets cun conflits: (zonte '%s' ae rie di comant par sfuarçâ il lôr inzornament)In polseCualchi pachet dal dipuesit locâl al à une sume di control sbaliadeCualchi pachet al à la memorie cache no valide, ma nol pues jessi discjariât par vie de opzion "--cacheonly"Cualchi pachet nol è stât discjariât. Si torne a provâ.SorzintInviât dnf-automatic.CompletâtSistemeIl sisteme al è fûr rêt.Si prove lis clâfs za impuartadis pe lôr validitât.Lis clâfs GPG listadis pal dipuesit "%s" a son za instaladis ma no son justis par chest pachet. Controle che par chest dipuesit a sedin configurâts i URL des clâfs juscj.I pachets discjariâts a son stâts salvâts te cache fin ae prossime transazion eseguide cun sucès.I inzornaments chi daurman a son disponibii par '%s':I inzornaments chi daurman a son stâts aplicâts su '%s':I inzornaments chi daurman a son stâts discjariâts par '%s':La clâf e je stade aprovade.La clâf e je stade ricusade.La operazion e cambiarà il flus '{1}' dal modul '{0}' al flus '{2}'La stesse version, o superiôr, di %s e je za instalade, impussibil inzornâle.Lis specifichis che a vignaran instaladisLis specifichis che a vignaran gjavadisSi à lis alternativis chi sot par "{0}": {1}No'ndi son dipuesits abilitâts in "{}".Al è vignût fûr un erôr tal calcolâ la dimension di instalâtAl è vignût fûr un erôr tal calcolâ la dimension totâl dal discjariamentChest comant al scugne jessi eseguît cui privileçs di super-utent (sot dal utent root pe plui part dai sistemis).Par diagnosticâ il probleme prove a eseguî: '%s'.TotâlDimension totâl discjariament: %sDimension totâl: %sSegnât/FermâtID di transazion :Controi di transazion passâts.Nol è stât pussibil scomençâ la transazion:Transazion falideLa cronologjie des transazions no je complete, dopo di %u.La cronologjie des transazions no je complete, prime di %u.Transazion eseguide cun:Transazion salvade su {}.Erôr prove di transazion:Prove di transazion passade.TransactionItem no cjatât pe clâf: {}TransactionSWDBItem no cjatât pe clâf: {}GjenarURLURL : %sImpussibil rilevâ la version di publicazion (dopre '--releasever' par specificâ la version di publicazion)Impussibil cjatâ un pachet di grup obligatori.Impussibil cjatâ une corispondenceImpussibil cjatâ informazions sul procès che al bloche (PID %d)Impussibil fâ coincidi il profîl pal argoment {}. Profîi disponibii par '{}:{}': {}Impussibil risolvi l՚argoment {}Impussibil recuperâ une clâf par un pachet de rie di comant: %sValôr inspietât de variabile di ambient: DNF_DISABLE_ALIASES=%sIninterompibilNo cognossûtAvîs di sigurece no cognossûtOpzion di configurazion no cognossude: %s = %sOpzion di configurazion no cognossude: %s = %s in %sValôr di configurazion no cognossût: %s=%s in %s; %sDipuesit no cognossût: '%s'No cognossût/Sig.Valôr clâf no supuartât.ID inzornamentInzornâtSintesi informazions dai inzornaments: Inzornaments aplicâts par '%s'.Inzornaments disponibii par '%s'.Inzornaments completâts aes '%s'.Inzornaments discjariâts par '%s'.InzornâInzornâtsNol è permetût l՚inzornament dal modul '{0}' dal dipuesit Fail-Safe {1}Nol è permetût l՚inzornament dal modul dal dipuesit Fail-SafeUtent :Non utentDaûr a verificâIn spiete pe conession a internet...In spiete che il procès cun pid %d al finissi.Atenzion: si sfuarce il control globâl de firme GPG daûr de politiche di sigurece RPM ative (viôt 'gpgcheck' in dnf.conf(5) par capî cemût soprimi chest messaç)Atenzion: il grup %s nol esist.Atenzion: nissun grup al corispuint:Atenzion: cjariament di '%s' falît, si salte.Si pues gjavâ i pachets metûts in cache eseguint '%s'.No tu puedis acedi ae base di dâts de cronologjie: %sTu âs abilitât il control di pachets cu lis clâfs GPG. Cheste e je une buine usance. Dut câs no tu âs instalade nissune clâf publiche GPG. Tu scugnis discjariâ e instalâ lis clâfs pai pachets che tu desideris instalâ. Tu puedis fâlu eseguint il comant: rpm --import public.gpg.key In alternative tu puedis specificâ il url de clâf di doprâ, par un dipuesit, te opzion 'gpgkey' intune sezion dal dipuesit e {prog} le instalarà par te. Par vê plui informazions contate la tô distribuzion o il furnidôr di pachets.Forsit RPMDB al è ruvinât, fasint partî '%s' si podarès risolvi il probleme.Zombiazion di cjapâ cui aliaszonte un coment ae transaziondefinizion dal aliasducjpermet di scancelâ i pachets instalâts par risolvi lis dipendencisargoment pal sot-comant dal grupargoment {}: nol è permetût cul argoment {}rispuint no in maniere automatiche a dutis lis domandisrispuint sì in maniere automatiche a dutis lis domandisdisponibilsot-comants disponibii: {} (predefinît), {}formât sbaliât: %srisoluzion erôrcontrole lis dipendencis propite come che a son furnidis, contrari di --alldepscontrole la disponibilitât di avanzaments pai pachetsverifiche dai problemis intal packagedbcontrole lis dipendencis no esplicitis (files e pachets furnîts); predefinîtposizion file di configurazioncontrole l'ûs dal colôrDaûr a degradâDaûr a instalâDaûr a tornâ a instalâDaûr a inzornânivel di jessude dal debugnivel di jessude dal debug par rpmsi determine il servidôr-spieli plui veloç (%s hosts).. disabilite un modul cun ducj i siei flusdisabilite risoluzion dai aliasdisabilite ducj i plugindisabilite i plugin par nondisabilite il gjavâ des dipendencis che no son plui dopradisdisabilitâtmostre une utile vuide su ce mût doprâmostre avertiments sui pachetsmostre detais su un pachet o grup di pachetsmostre i dipuesits software configurâtsmostre o dopre lis informazions dai grupsmostre, o dopre, la cronologjie des transazionsno sta instalâ la documentazionfatbute jù su files i risultâts detaiâts de risoluzionabilite un flus di modulabilite risoluzion dai aliasabilite i plugin par nonabilitâtdaûr a abilitâ il dipuesit %smioramentnivel di jessude dai erôrsfalscjate cuâl pachet che al furnìs il valôr furnîtgjenere la cache dai metadâtse à un stât no cognossût.inclût pachets opzionâls dal grupinstale un profîl di modul includûts i siei pachetsinstale un o plui pachets tal sistemeinstalâte je valide.limite la interogazion ai pachets dopleâts instalâtslimite la interogazion ai pachets instalâts di gjenar “installonly”limite la interogazion ai pachets instalâts cun dipendencis no sodisfatisliste un pachet o un grup di pachetsliste ducj i flus, profîi e stâts dal modulliste i pachets modulârsliste i pachets che a apartegnin a un modulfaliment tal cjariâ il dipuesit '{}': {}Dipuesitgjave il segn o segne i pachets instalâts come instalâts dal utent.massim timp di spiete dal comantngnûf pachetnodome discjarie i pachetslavore sul RPM sorzint corispuindintaltri avîspasse sore al valôr $releasever tai files di configurazion e di dipuesitstampe informazions detaiadis suntun moduloperazion cidineTorne instale un pachetgjave un o plui pachets dal sistemegjave ducj i pachets modulârsgjave ducj i pachets che no coventin che di imprin a jerin instalâts come dipendencisgjave dâts metûts in cachegjave pachets doplisgjave i profîi dai modui instalâts e i lôr pachetsgjave i pachets di dome instalazion che a superin il limitdaûr a sostituîdipuesit %s: 0x%s za impuartâtdipuesit %s: clâf 0x%s impuartade.id reponon dipuesitazere un modulrisolf i problemis di risoluzion des dipendencis saltant pachetsrisolf dome a direzions IPv4risolf dome a direzions IPv6eseguìs i comants su ducj i pachets tal dipuesit indicâteseguìs dut de cache dal sisteme, no sta inzornâ la cachecîr ancje tal URL e te descrizion dal pachetcîr i pachets che a corispuindin ae peraule clâfcîr tai detais dai pachets la stringhe furnidesigurecestabilìs opzions arbitraris di configurazion e di dipuesitstabilìs la cartele dulà copiâ i pachetsstabilìs la lidrîs(root) di instalazionmet il metadât come scjadût prime di eseguî il comantDip.mostre i ultins N pachets par une dade cumbinazion non.architeture (o i prins N se N al è negatîf)mostre une liste di dutis lis dipendencis e cuai pachets lis furnissinmostre une posizion dulà che i pachets a puedin jessi discjariâtsmostre ducj i pachets (predefinît)mostre ducj i problemis; predefinîtmostre ducj i dipuesitsmostre ancje l'ID dai grupsmostre ancje i grups platâtsmostre lis etichetis disponibilis di doprâ cun --queryformatmostre i regjistris des modifichis prime di inzornâmostre jutori dal comantmostre problemis di dipendencismostre informazions detaiadis sul pachetmostre i dipuesits disabilitâtsmostre problemis di dopleamentsmostre i duplicâts tai dipuesits e tai comants par listâ / cirîmostre i dipuesits abilitâts (predefinît)mostre informazions dai avertimentsmostre la liste dai avertimentsmostre la liste dai files dal pachetmostre pachets obsoletsmostre dome pachets in rimozion automatichemostre dome i grups disponibiimostre dome pachets disponibiimostre dome i modui disabilitâtsmostre dome i modui abilitâtsmostre dome pachets adizionâimostre dome i grups instalâtsmostre dome i modui o i pachets instalâtsmostre dome pachets instalâtsmostre dome pachets modificâts di resintmostre dome i risultâts par cheste ARCHmostre dome i risultâts che a son in conflit cun REQmostre dome i risultât che a miorin REQmostre dome i risultâts che a rindin obsolet REQmostre dome i risultâts che a son proprietaris di chest FILEmostre dome i risultâts che a furnissin REQmostre dome i risultâts che a consein REQmostre dome i risultâts che a sugjerissin REQmostre dome i risultâts che a integrin REQmostre dome pachets di avanzamentmostre il non dal RPM dal sorzint dal pachetmostre problemis cui pachets furnîtsmostre il contignût dal profîlmostre arbul ricorsîf pai pachetsal mostre i risultâts che a domandin files REQ o pachets che a furnissin REQmostre i risultâts che i file REQ, o i pachets che a furnissin REQ, a domandin, a sugjerissin, a integrin, a miorin o a conseinstâtsincronize i pachets instalâts cun lis ultimis versions disponibilisla clâf di cirîvêrprove lis versions miôr disponibilis intes transazions.no cognossûtinzorne i pachets associâts a un flus atîfinzornamentsinzorne un o plui pachets tal sistemeinzorne, ma dome i pachets 'plui gnûfs' che a risolvin un probleme che al lambiche il to sistemedopre formât epoche:non-version-publicazion.architeture par mostrâ i pachets cjatâtsdopre il formât non-epoche:version-publicazion.architeture par mostrâ i pachets cjatâts (predefinît)dopre formât non-version-publicazion par mostrâ i pachets cjatâts (predefinide pes interogazions rpm)doprât cun --whatrequires e --requires --resolve, interoghe i pachets in maniere ricorsive.operazion prolissessìcomant di {prog} che par chel vê jutori{prog} al discjariarà dome i pachets pe transazion.{prog} al fasarà dome il discjariament dai pachets, la instalazion des clâfs pgp e il control de transazion.{} jes de shell{} risolf la cumbinazion di transazions{} eseguìs la transazion{} [comant] stampe jutori{} argoment list: al liste i contignûts de transazion reset: azere (cancele dal dut) la transazion run: eseguìs la transazion{} argoment [opzion] list: al liste i dipuesits e il lôr stât. opzion = [all | id | glob] enable: abilite i dipuesits. opzion = id dal dipuesit disable: disabilite i dipuesits. opzion = id dal dipuesit{} argoment [valôr] argoment: debuglevel, errorlevel, obsoletes, gpgcheck, assumeyes, exclude, repo_id.gpgcheck, repo_id.exclude se nissun valôr al ven furnît al stampe il valôr atuâl. se il valôr al ven furnît al met chel valôr.{} al esist, sorescrivi?{} al à dipendencis richiestis mancjantis:{}{} al è un duplicât di {}{} al è stât fat deventâ obsolet di {}{} al furnìs {} ma nol pues jessi cjatât{} {} {}: masse pôcs argomentsPKx{0]٦ܻLC_MESSAGES/p11-kit.monu[Rm<<\)s!(22N%e(22 $7 \ "m #  +    7 H $e  $ , - / P %j  ' &  # /6 f &  - 3 % ? ` ~  ' $ '#* No +$Jo!*"@Z%y+/08 iwm"%'#  15RDA!41(f4BA&Ip%!0 .B\u/)4 5?<u)1/H'x.8 !)K1i6' !;#]/$$" ?X#x !"4*7b!+'E#e.4!/+7[E LM2*B4)@R<?OJ 3 Q810=#!HD(.AG:5,>6-+ IP"&'9 F%N7;$K/ CA key is neededA read-only session existsAn administrator session existsAn error occurred on the deviceAn open session existsAnother operation is already taking placeAnother user is already logged inCannot export because the key is invalidCannot export because the key is of the wrong sizeCannot export because the key is of the wrong typeCannot export this keyCannot import a key of the wrong sizeCannot import an invalid keyCannot import because the key is invalidCannot import because the key is of the wrong sizeCannot import because the key is of the wrong typeCannot include the key in the digestCannot lock dataCertain fields have invalid valuesCertain required fields are missingInsufficient memory availableInsufficient memory available on the deviceInternal errorInvalid argumentsInvalid value for fieldNo key is neededNo operation is taking placeNo random number generator availableNo user has logged inNot enough space to store the resultThe crypto mechanism has an invalid argumentThe crypto mechanism has an invalid parameterThe crypto mechanism is invalid or unrecognizedThe data cannot be lockedThe data is not valid or unrecognizedThe data is too longThe device is invalid or unrecognizableThe device is not present or unpluggedThe device is write protectedThe device was removed or unpluggedThe encrypted data is not valid or unrecognizedThe encrypted data is too longThe field is invalid or does not existThe field is read-onlyThe field is sensitive and cannot be revealedThe information is sensitive and cannot be revealedThe key cannot be wrappedThe key is different than beforeThe key is missing or invalidThe key is of the wrong typeThe key is the wrong sizeThe module cannot create needed threadsThe module cannot lock data properlyThe module has already been initializedThe module has not been initializedThe object is missing or invalidThe operation failedThe operation was cancelledThe password or PIN has expiredThe password or PIN is incorrectThe password or PIN is invalidThe password or PIN is lockedThe password or PIN is of an invalid lengthThe request was rejected by the userThe saved state is invalidThe session is closedThe session is invalidThe session is read-onlyThe signature is bad or corruptedThe signature is unrecognized or corruptedThe specified slot ID is not validThe state cannot be savedThe user is of an invalid typeThe user's password or PIN is not setThis operation cannot be done with this keyThis operation is not supportedToo many sessions are activeToo many users of different types are logged inUnable to initialize the random number generatorUnknown errorYou are already logged inProject-Id-Version: p11-kit Report-Msgid-Bugs-To: https://bugs.freedesktop.org/enter_bug.cgi?product=p11-glue POT-Creation-Date: 2018-01-31 16:48+0100 PO-Revision-Date: 2017-12-06 15:44+0000 Last-Translator: Fabio Tomat Language-Team: Friulian (http://www.transifex.com/freedesktop/p11-kit/language/fur/) MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Language: fur Plural-Forms: nplurals=2; plural=(n != 1); E covente une clâfUne session in dome-leture e esistUne session dal aministradôr e esistAl è capitât un erôr sul dispositîfUne session vierte e esistUne altre operazion e je za in voreUn altri utent al è za jentrâtImpussibil espuartâ parcè che la clâf no je valideImpussibil espuartâ par vie che la clâf e je de dimension sbaliadeImpussibil espuartâ parcè che la clâf e je dal gjenar sbaliâtImpussibil espuartâ cheste clâfImpussibil impuartâ une clâf di dimension sbaliadeImpussibil impuartâ une clâf no valideImpussibil impuartâ parce che la clâf no je valideImpussibil impuartâ parce che la clâf e je di dimension sbaliadeImpussibil impuartâ par vie che la clâf e je di gjenar sbaliâtImpussibil includi la clâf tal digestImpussibil blocâ i dâtsCualchi cjamp al à valôrs no valitsAl mancje cualchi cjamp necessariNo vonde memorie disponibileMemorie disponibile insuficiente sul dispositîfErôr interniArgoments no valitsValôr no valit pal cjampNo covente nissune clâfNissune operazion e je in voreNissun gjeneradôr di numars casuâi disponibilNissun utent al è jentrâtNo vonde spazi par archiviâ il risultâtIl mecanisim di cifradure al à un argoment no valitIl mecanisim di cifradure al à un parametri no valitIl mecanisim di cifradure nol è valit o nol è ricognossûtI dâts no puedi jessi blocâtsLa date no je valide o no je ricognossudeLa date e je masse lungjeIl dispositîf nol è valit o nol è ricognossûtIl dispositîf nol è presint o al è distacâtIl dispositîf al è protet de scritureIl dispositîf al è stât gjavât o distacâtIl dât cifrât nol è valit o nol è stât ricognossûtIl dât cifrât al è masse luncIl cjamp nol è valit o nol esistIl cjamp al è di dome-letureIl cjamp al è sensibil e nol pues jessi rivelâtLa informazion e je sensibile e no pues jessi riveladeLa clâf no pues jessi fate sùLa clâf e je diferente rispiet a primeLa clâf e mancje o no je valideLa clâf e je dal gjenar sbaliâtLa clâf e je de dimension sbaliadeIl modul nol pues creâ i thread che a coventinIl modul nol pues blocâ i dâts benIl modul al è za stât inizializâtIl modul nol è stât inizializâtL'ogjet al mancje o nol è valitLa operazion e à falîtLa operazion e je stade anuladeLa password o il PIN al è scjadûtLa password o il PIN nol è justLa password o il PIN nol è valitLa password o il PIN al è blocâtLa password o il PIN al è di une lungjece no valideLa richieste e je stade refudade dal utentIl stât salvât nol è valitLa session e je sieradeLa session no je valideLa session e je in dome-letureLa firme e je sbaliade o ruvinadeLa firme no je ricognossude o e je ruvinadeIl ID dal slot specificât nol è valitIl stât nol pues jessi salvâtL'utent al è di un gjenar no valitLa passord dal utent o il PIN nol è stabilîtCheste operazion no pues jessi fate cun cheste clâfCheste operazion no je supuartadeA son ativis masse sessionsA son jentrâts masse utents di gjenar diferentImpussibil inizializâ il gjeneradôr di numars casuâiErôr no cognossûtTu sês za jentrâtPKx{0]2 2 LC_MESSAGES/iso_3166-1.monu[5Gl      (.6=ELT\bjpv }     + DNV Wck r }         ' 0 8 > F M T \ j s ~             * +( 1*-0.5' )/%! $#" 32 ,4 &AfghanistanAlbaniaAndorraArgentinaAustraliaAustriaBangladeshBelarusBelgiumBrazilBulgariaCanadaChileColombiaCroatiaCyprusCzech RepublicDenmarkEgyptFinlandFranceGermanyGreeceHungaryIcelandIndiaIrelandItalyJapanLatviaLiechtensteinLithuaniaLuxembourgMaltaMexicoMoldovaNetherlandsPolandPortugalRomaniaSlovakiaSloveniaSpainSwedenSwitzerlandThailandTurkeyUkraineUnited KingdomUnited States of AmericaVenezuelaVietnamProject-Id-Version: iso_3166-1 Report-Msgid-Bugs-To: https://salsa.debian.org/iso-codes-team/iso-codes/issues POT-Creation-Date: 2018-01-17 22:10+0100 PO-Revision-Date: 2017-12-29 06:46+0000 Last-Translator: Chris Leonard Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=n != 1; X-Generator: Weblate 2.19-dev AfghanistanAlbanieAndoreArgjentineAustralieAustrieBangladeshBielorussieBelgjoBrasîlBulgarieCanadàCileColombieCravuazieCipriRepubliche CecheDanimarcjeEgjitFinlandeFranceGjermanieGrecieOngjarieIslandeIndieIrlandeItalieGjaponLetonieLiechtensteinLituanieLussemburcMalteMessicMoldaviePaîs BasPoloniePortugalRomanieSlovachieSlovenieSpagneSvezieSvuizareTailandieTurchieUcraineReam UnîtStâts Unîts di AmericheVenezuelaVietnamPKx{0]sœ**LC_MESSAGES/chkconfig.monu[gTh ( - <  - G 9f " $ %  +* (V  2 J h w   4  6 > &P "w    B 3&</c-*(L!Mn).=Sp;!#91]I$&,%Rk;  7Xo! ''8? x A9=!W y  &`&#Ae0,>Oduac+'E-m89$!^#$-*> )"L\o 86*0)[%G@1B:t5(& cE d 2!7A!8y!%!!!";"Y"#y"""3"A"I6# #2#2# $.($(W$Q$5$(%!1%,S%%,%!%/%+& J&3T&4&N&) '$6' ['f'Il'T' (#((L([(k(%(x()0=)n)).)))*F*X*o**<C=FW0.6bU'!\O75`9] IeZ J V;KR1(*HDA:?32YacE/%)@_"G4B>NS+8M#LXf T^d&-Qg,[ P$ Note: This output shows SysV services only and does not include native systemd services. SysV configuration data might be overridden by native systemd configuration. error reading choice [--family ] [--initscript ] --altdir --admindir %s --add %s --del %s --override %s [--level ] [--type ] %s alternatives --auto alternatives --config alternatives --display alternatives --list alternatives --remove alternatives --set If you want to list systemd services use 'systemctl list-unit-files'. To see services enabled on particular target use 'systemctl list-dependencies [target]'. Selection Command link currently points to %s slave %s: %s %s - status is auto. %s - status is manual. %s already exists %s empty! %s has not been configured as an alternative for %s %s version %s %s version %s - Copyright (C) 1997-2000 Red Hat, Inc. (would remove %s --family can't contain the symbol '@' --type must be 'sysv' or 'xinetd' BackCancelCurrent `best' version is %s. Enter to keep the current selection[+], or type selection number: Failed to forward service request to systemctl: %m No services may be managed by ntsysv! Note: Forwarding request to 'systemctl %s %s'. OkPress for more information on a service.ServicesThere are %d programs which provide '%s'. There is %d program that provides '%s'. This may be freely redistributed under the terms of the GNU Public License. This may be freely redistributed under the terms of the GNU Public License. Unable to set selinux context for %s: %s What services should be automatically started?You do not have enough privileges to perform this operation. You must be root to run %s. admindir %s invalid altdir %s invalid alternatives version %s alternatives version %s - Copyright (C) 2001 Red Hat, Inc. bad argument to --levels bad mode on line 1 of %s bad primary link in %s cannot determine current run level closing '@' missing or the family is empty in %s common options: --verbose --test --help --usage --version --keep-missing error reading from directory %s: %s error reading info for service %s: %s error reading information on service %s: %s failed to create %s: %s failed to glob pattern %s: %s failed to link %s -> %s: %s failed to link %s -> %s: %s exists and it is not a symlink failed to make symlink %s: %s failed to open %s/init.d: %s failed to open %s: %s failed to open directory %s: %s failed to read %s: %s failed to read link %s: %s failed to remove %s: %s failed to remove link %s: %s failed to replace %s with %s: %s family %s link %s incorrect for slave %s (%s %s) link changed -- setting mode to manual link points to no alternative -- setting mode to manual missing path for slave %s in %s numeric priority expected in %s offononly one of --list, --add, --del, or --override may be specified only one runlevel may be specified for a chkconfig query path %s unexpected in %s path to alternate expected in %s priority %d reading %s running %s service %s does not support chkconfig service %s supports chkconfig, but is not referenced in any runlevel (run 'chkconfig --add %s') slave path expected in %s the primary link for %s must be %s unexpected end of file in %s unexpected line in %s: %s usage: %s [name] usage: %s [--list] [--type ] [name] usage: %s [name] usage: alternatives --install would link %s -> %s would remove %s xinetd based services: Project-Id-Version: PACKAGE VERSION Report-Msgid-Bugs-To: POT-Creation-Date: 2017-07-25 13:31+0200 PO-Revision-Date: 2020-05-18 22:40+0000 Last-Translator: Allan Nordhøy Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=n != 1; X-Generator: Weblate 4.0.4 Note: cheste jessude e mostre dome i servizis SysV e no inclût i servizis systemd natîfs. I dâts di configurazion SysV a puedin jessi sorpassâts de configurazion native di systemd. erôr tal lei la sielte [--family ] [--initscript ] --altdir --admindir %s --add %s --del %s --override %s [--level ] [--type ] %s alternatives --auto alternatives --config alternatives --display alternatives --list alternatives --remove alternatives --set Se si desidere listâ i servizis di systemd dopre 'systemctl list-unit-files'. Par viodi i servizis abilitâts su un particolâr obietîf dopre 'systemctl list-dependencies [obietîf]'. Selezion Comant il colegament atualmentri al ponte a %s sclâf %s: %s %s - stât: auto. %s - stât: manuâl. %s al esist za %s vueit! %s nol è stât configurât come une alternative par %s %s version %s %s version %s - Copyright (C) 1997-2000 Red Hat, Inc. (al gjavarà %s --family nol pues contignî il simbul '@' --type al scugne jessi 'sysv' o 'xinetd' IndaûrAnulePal moment la version miôr e je %s. Jentre par tignî la selezion atuâl[+] o scrîf il numar de selezion: No si è rivâts a mandâ indenant la richieste a systemctl: %m Nissun servizi al pues jessi gjestît di ntsysv! Note: si mande indenant la richieste a 'systemctl %s %s'. Va benFrache par vê plui informazions suntun servizi.ServizisA son %d programs che a furnissin '%s'. Al è %d program che al furnìs '%s'. Chest al pues jessi tornât a distribuî in maniere libare sot i tiermins de licence publiche GNU. Chest al pues jessi tornât a distribuî in maniere libare sot i tiermins de licence publiche GNU. Impussibil stabilî il contest SELinux par %s: %s Cuai servizis varessino di jessi inviâts in automatic?No si à vonde privileçs par eseguî cheste operazion. Si scugne jessi root par eseguî %s. admindir %s no valide altdir %s no valide alternatives version %s alternatives version %s - Copyright (C) 2001 Red Hat, Inc. argoment sbaliât par --levels modalitât sbaliade ae rie 1 di %s colegament primari sbaliât in %s impussibil determinâ il nivel di esecuzion atuâl al mancje il caiut '@' di sieradure o la famee e je vueide in %s opzions comuns: --verbose --test --help --usage --version --keep-missing erôr tal lei de cartele %s: %s erôr tal lei lis informazions pal servizi %s: %s erôr tal lei lis informazions sul servizi %s: %s no si è rivâts a creâ %s: %s no si è rivâts a incorporâ il model %s: %s no si è rivâts a colegâ %s -> %s: %s no si è rivâts a colegâ %s -> %s: %s al esist e nol è un colegament simbolic no si è rivâts a fâ il colegament simbolic %s: %s no si è rivâts a vierzi %s/init.d: %s no si è rivâts a vierzi %s: %s no si è rivâts a vierzi la cartele %s: %s no si è rivâts a lei %s: %s no si è rivâts a lei il colegament %s: %s no si è rivâts a gjavâ %s: %s no si è rivâts a gjavâ il colegament %s: %s no si è rivâts a sostituî %s cun %s: %s famee %s il colegament %s nol è just pal sclâf %s (%s %s) colegament cambiât -- modalitât metude su manuâl il colegament nol ponte a nissune alternative -- modalitât metude su manuâl al mancje il percors pal sclâf %s in %s prioritât numeriche spietade in %s disativâtatîfdome un tra --list, --add, --del, o --override al pues jessi specificât dome un nivel di esecuzion al pues jessi specificât par une interogazion chkconfig percors %s inspietât in %s percors alternatîf spietât in %s prioritât %d daûr a lei %s daûr a eseguî %s il servizi %s nol supuarte chkconfig il servizi %s al supuarte chkconfig, ma no à riferiments su nissun nivel di esecuzion (eseguìs 'chkconfig --add %s') percors sclâf spietât in %s il colegament primari par %s al scugne jessi %s fin dal file inspietade in %s rie inspietade in %s: %s ûs: %s [non ] ûs: %s [--list] [--type ] [non] ûs: %s [non] ûs: alternatives --install si colegarà %s -> %s si gjavarà %s servizis basâts su xinetd: PKx{0]LC_MESSAGES/glib20.monu[|!,,&,,,- ---&-/-8-@-I-R-Z-b-k-t-|-----------:- #./.7.P._.@p.*.!../ /$/ 4/ >/I/5\/)/O/8 0E0?Z0+0 00 0 1 1((1=Q1,11^1a82g2B3/E3u3$3"3%334444;i4#484-5305/d5%5"5 5 575*7I7d7~7C747680N88288828+*9V9i9}99 99 99%9:(*:!S:u::::A:,;$2;$W;|;;;>;;)</.<^<u<<<<%<% =+0=\=?x=H==>H?>x>??4?,T?,?0???@9@!U@w@@@!@@ A<&AcA~A&A9AAB +B"6B(YB%BB%B*B.C$GC$lC'C$C$C'D+D4GDM|D$DDE E EE(E1E.F%KF?qF.F"FG*GTIG+GG5G*H@HSHiHH H HH&HH H"I =I!^I1I2IIJ&J%JJJ%K-=K(kK(K(KK)L0LZ?LLL7LL M-MBM#^MMWMMM4N!HNEjNNNN3N;ONO#mOEOO)OP;1P;mPP"P3P9 QCQ@`QDQVQE=R@R1RRS.!S)PS<zSS)SS&T'@ThT3TTTTT2U%;UaUvUUUU~UYV+pVHVVVW#W=W#OWsWWWW'WXX-6X?dX8XX'XY .Y@8Y6yY4Y?YL%Z rZ|Z Z Z"Z#ZZ["[@[[[ u[[ [[[[[[ [%\A4\av\]\6]U=]!]]F]/^I^^^x^ ^!^^ ^^H_\_#|______ `!&`H`b`&x`` ``'`-a+Ja-va2a#aaVbeb"ybbbb$b%c .c?Oc.cc8cd!$d0Fd"wd<d!dde95e0oe8eee>f"Af dfqfyf2ffffffg10gbghg|gRgLg_;hh h h h hhhi!i/k+-ǐ,":;Wv(Α )ʒ@@59v>P/@,p!2]9P5,Օ 4=@!C3e"–!I'4qq',ݘ. >96x00$/6fhvߚH Sk."ڛ%Y#}2,ΜLHN`7zA!"Q90؞DE5 {(5;!RAJkߠUK<@ޡ6;H7h%,>k#*٣C3%7-];,-FcI3dP"<_%p$٧+=U.q?@!-*X wECǩ9 EEU  '(Gp!$ӫ1BYw2)ѬJoFk"_*'FҮD^"|$%ٯ##5SM (°$ )JQ(q.ɱݱ0%/?o#6,.7F(~[(7`p*'ϴ?.WB,6%*\?)Ƕ(!F<8;E1,w ¸;̸!*IN%T!z8չܹ']Qxhʺ3 P Zd myĻȻ̻лԻػܻ :.W 5׼; 'I&q-1ܽ$,37<BFOV_flu}ľ̾Ҿھ j!d07.?"N q} !4 *K&T!{#'%0:DOd<Q`2Y|D` }I,SUN1'Jk9>3(nHvI lCXe[b>j% #Fs H PG"h0 lOxpmZ~ya#2c3s|5A@g6TJ=wtS{$ef86E5p)\T^/tu=rgoz,_ K8 hu^ 9\KkX/!-!cYz7 Q) AL(R:'% wqo]iU{+&P*n djRB.-F y~_MiCVL;*W E?xq W.$+V7r ;[M@a?v]"G&Zm4N1B4fb<} (invalid encoding) and --strict was specified; exiting. %.1f EB%.1f Eb%.1f EiB%.1f Eib%.1f GB%.1f Gb%.1f GiB%.1f Gib%.1f KB%.1f KiB%.1f Kib%.1f MB%.1f Mb%.1f MiB%.1f Mib%.1f PB%.1f Pb%.1f PiB%.1f Pib%.1f TB%.1f Tb%.1f TiB%.1f Tib%.1f kB%.1f kb%s bit%s bits%s byte%s bytes%s command requires an application id to directly follow %s filetype%s type%s: overwrite “%s”? %u bit%u bits%u byte%u bytes(Additionally, releasing the lock for “%s” also failed: %s) (Type any character to close this window) --strict was specified; exiting. ACTIONAPPIDAPPID ACTION [PARAMETER]APPID [FILE…]ATTRIBUTEATTRIBUTESActivate an actionAddress element “%s” does not contain a colon (:)Address has bits set beyond prefix lengthAddress “%s” is invalid (need exactly one of path, tmpdir or abstract keys)An object is already exported for the interface %s at %sApplication Options:Application identifier in D-Bus format (eg: org.example.viewer)Application information lacks an identifierArguments: Attribute not specifiedAttribute value must be non-NULLBad HTTP proxy replyCOMMANDCancellable initialization not supportedCancelled via GDBusAuthObserver::authorize-authenticated-peerCannot autolaunch D-Bus without X11 $DISPLAYCannot deserialize message: Cannot determine bus address because the DBUS_STARTER_BUS_TYPE environment variable is not setCannot determine bus address from DBUS_STARTER_BUS_TYPE environment variable - unknown value '%s'Cannot determine bus address from DBUS_STARTER_BUS_TYPE environment variable — unknown value “%s”Cannot determine session bus address (not implemented for this OS)Cannot listen on unsupported transport “%s”Cannot serialize message: Cannot truncate GBufferedInputStreamCannot truncate GMemoryInputStreamCan’t copy directory over directoryCan’t copy over directoryCan’t copy special fileCan’t create user MIME configuration folder %s: %sCan’t create user application configuration folder %s: %sCan’t create user desktop file %sCan’t handle the supplied version of the icon encodingCan’t handle version %d of GEmblem encodingCan’t handle version %d of GEmblemedIcon encodingCan’t handle version %d of GFileIcon encodingCan’t move directory over directoryCan’t recursively copy directoryCommands:Commands: Commands: help Shows this information introspect Introspect a remote object monitor Monitor a remote object call Invoke a method on a remote object emit Emit a signal wait Wait for a bus name to appear Use “%s COMMAND --help” to get help on each command. Connect to given D-Bus addressConnect to the session busConnect to the system busContaining mount does not existConversion from character set “%s” to “%s” is not supportedCopy (reflink/clone) between mounts is not supportedCopy (reflink/clone) is not supported or didn’t workCopy (reflink/clone) is not supported or invalidCopy one or more filesCopy one or more files from SOURCE to DESTINATION.Copy with fileCould not get network status: Could not open converter from “%s” to “%s”Could not parse “%s” as IP address maskCreate directoriesCreate directories.Create parent directoriesCustom definition for %sDESTINATIONDEVICEDIRECTORYDTLS support is not availableDefault application for “%s”: %s Delete one or more filesDesktop file didn’t specify Exec fieldDestination %s is not a directoryDestination name to monitorDidn’t find cookie with id %d in the keyring at “%s”Don’t follow symbolic linksERROR message: REPLY_SERIAL or ERROR_NAME header field is missingEjectElement <%s> not allowed at toplevelElement <%s> not allowed inside <%s>Emit a signal.Empty path given. Empty the trashEnter GApplication service mode (use from D-Bus service files)Error auto-launching: Error calling StartServiceByName for %s: Error closing (unlinked) lock file “%s”: %sError closing file: %sError compressing file %sError connecting: %s Error creating backup copy: %sError creating directory %s: %sError creating directory “%s”: %sError creating lock file “%s”: %sError deleting stale lock file “%s”: %sError during conversion: %sError in address “%s” — the family attribute is malformedError in address “%s” — the host attribute is missing or malformedError in address “%s” — the port attribute is malformedError in address “%s” — the port attribute is missing or malformedError in address “%s” — the unix transport requires exactly one of the keys “path” or “abstract” to be setError moving file %s: %sError opening file %s: %sError opening file “%s”: %sError opening keyring “%s” for reading: Error opening keyring “%s” for writing: Error parsing parameter %d of type “%s”: %s Error parsing parameter %d: %s Error reading file %s: %sError reading file “%s”: %sError reading from file: %sError reading from standard inputError removing file %s: %sError removing old file: %sError removing target file: %sError renaming temporary file: %sError resolving “%s”: %sError seeking in file: %sError setting property '%s': Expected type '%s' but got '%s'Error trashing file %s: %sError truncating file: %sError unlinking lock file “%s”: %sError when getting information for directory “%s”: %sError writing to file: %sError writing to stdoutError: %s Error: %s is not a valid bus name Error: %s is not a valid interface name Error: %s is not a valid member name Error: %s is not a valid name Error: %s is not a valid object path Error: %s is not a valid unique bus name. Error: %s is not a valid well-known bus name. Error: Destination is not specified Error: Method name is not specified Error: Method name “%s” is invalid Error: Object path is not specified Error: Signal name is not specified Error: Signal name “%s” is invalid Error: Too many arguments. Error: can’t monitor a non-message-bus connection Exhausted all available authentication mechanisms (tried: %s) (available: %s)Expected a GEmblem for GEmblemedIconExpected valid UTF-8 string but found invalid bytes at byte offset %d (length of string is %d). The valid UTF-8 string up until that point was “%s”FILEFILE PATHFILE [PATH]Failed to create temp file: %sFailed to load info for handler “%s”Failed to locate “%s” in any source directoryFailed to locate “%s” in current directoryFailed to resize memory output streamFailed to set “%s” as the default handler for “%s”: %s File %s appears multiple times in the resourceFile names cannot contain “%c”File “%s” is too largeFilesystem does not support symbolic linksFirst token of line %d of the keyring at “%s” with content “%s” is malformedFollow symbolic links, mounts and shortcutsGApplication optionsGCredentials does not contain a process ID on this OSGCredentials is not implemented on this OSGDateTime%H:%M:%SGDateTime%I:%M:%S %pGDateTime%a %b %e %H:%M:%S %YGDateTime%m/%d/%yGDateTimeAMGDateTimePMGet file system infoGet or set the handler for a mimetype.HANDLERHTTP proxy authentication failedHTTP proxy authentication requiredHTTP proxy connection failed: %iHTTP proxy connection not allowedHTTP proxy server closed connection unexpectedly.Hostname “%s” contains “[” but not “]”If no handler is given, lists registered and recommended applications for the mimetype. If a handler is given, it is set as the default handler for the mimetype.Ignoring this file. Incomplete multibyte sequence in inputInput stream doesn’t implement readInternal error: %sInvalid GSeekType suppliedInvalid GVariant type string “%s”Invalid attribute type (byte string expected)Invalid attribute type (string expected)Invalid attribute type (uint32 expected)Invalid attribute type (uint64 expected)Invalid attribute type “%s”Invalid byte sequence in conversion inputInvalid domainInvalid endianness value. Expected 0x6c (“l”) or 0x42 (“B”) but found value 0x%02xInvalid filename %sInvalid hostnameInvalid major protocol version. Expected 1 but found %dInvalid numeric valueInvalid object, not initializedInvalid seek requestInvalid symlink value givenInvoke an action on the applicationKeep with file when movedKey/Value pair %d, “%s”, in address element “%s” does not contain an equal signLOCATIONLaunch an applicationLaunch the application (with optional files to open)Length %u is too long for addressLine %d of the keyring at “%s” with content “%s” is malformedListList applicationsList available actionsList contents of directories in a tree-like format.List static actions for an application (from .desktop file)List the contents of locationsList the contents of the locations.List the installed D-Bus activatable applications (by .desktop files)List writable attributesLists the contents of locations in a treeLocation not specifiedMETHOD_CALL message: PATH or MEMBER header field is missingMETHOD_RETURN message: REPLY_SERIAL header field is missingMIMETYPEMalformed input data for GFileIconMalformed number of tokens (%d) in GEmblem encodingMalformed number of tokens (%d) in GEmblemedIcon encodingMalformed version number: %sMeaningless key/value pair combination in address entry “%s”Message body has signature “%s” but there is no signature headerMessage body has type signature “%s” but signature in the header field is “%s”Message body is empty but signature in the header field is “(%s)”Method '%s' on interface '%s' with signature '%s' does not existMethod '%s' returned type '%s', but expected '%s'Method and interface nameMissing argumentMonitor a directory (default: depends on type)Monitor a file (default: depends on type)Monitor a file directly (notices changes made via hardlinks)Monitor a remote object.Monitor files and directories for changesMount or unmount the locationsMove files or directories to the trashMove files or directories to the trash.Move one or more filesMust specify a single mimetype, and maybe a handlerNAMENetworkManager version too oldNever follow symbolic linksNo address specifiedNo application is registered as handling this fileNo default applications for “%s” No destination givenNo locations givenNo recommended applications No registered applications No schema files found: No signature header in message but the message body is %u byteNo signature header in message but the message body is %u bytesNo such interface '%s'No such interface '%s' on object at path %sNo such interface 'org.freedesktop.DBus.Properties' on object at path %sNo such method '%s'No such property '%s'No target directoryNo type for class name %sNot enough memoryNot enough space for socket addressNot enough space in destinationObject path to emit signal onObject path to monitorOnly print propertiesOpen files with the default applicationOperation not supportedOperation was cancelledOptional destination for signal (unique name)Optional parameter to the action invocation, in GVariant formatOptional relative or absolute filenames, or URIs to openOptions:Output stream doesn’t implement writeOverride the application’s IDPARAMETERParsed value “%s” for variant is not a valid D-Bus signatureParsed value “%s” is not a valid D-Bus object pathParsed value “%s” is not a valid D-Bus signatureParsed value “%s” is not a valid D-Bus signature (for body)Permissions on directory “%s” are malformed. Expected mode 0700, got 0%oPrint XMLPrint full URIsPrint helpPrint versionPrint version information and exitPrint version information and exit.Prompt before overwriteProperty '%s' is not readableProperty '%s' is not writableRecommended applications: Registered applications: Rename a fileRename a file.SCHEMA[:PATH]SCHEMA[:PATH] KEYSCHEMA[:PATH] KEY VALUESCHEMA[:PATH] [KEY]SCHEMESECTIONSELinux context must be non-NULLSELinux is not enabled on this systemSIGNAL message: PATH, INTERFACE or MEMBER header field is missingSIGNAL message: The INTERFACE header field is using the reserved value org.freedesktop.DBus.LocalSIGNAL message: The PATH header field is using the reserved value /org/freedesktop/DBus/LocalSOURCESecond token of line %d of the keyring at “%s” with content “%s” is malformedSeek not supported on base streamSeek not supported on streamService to activate before waiting for the other one (well-known name)Session dbus not running, and autolaunch failedSet a file attributeShow GApplication optionsShow hidden filesShow information about locationsShow information about locations.Show program version and exitShow progressSignal and interface nameSignature header with signature “%s” found but message body is emptySource stream is already closedStream doesn’t support query_infoStream is already closedSymbolic links not supportedTLS support is not availableTYPETarget file existsTarget file is a directoryTarget file is not a regular fileThe action name to invokeThe attributes to getThe command to print detailed help forThe connection is closedThe file was externally modifiedThe given address is emptyThe resource at “%s” does not existThe resource at “%s” failed to decompressThe resource at “%s” is not a directoryThe string “%s” is not a valid D-Bus GUIDThere is no GCredentials support for your platformThis entire file has been ignored. Timeout in secondsTimeout to wait for before exiting with an error (seconds); 0 for no timeout (default)Timeout was reachedToo large count value passed to %sToo many argumentsTransferred %s out of %s (%s/s)Trash not supportedTruncate not allowed on input streamTruncate not supported on base streamTruncate not supported on streamType %s does not implement from_tokens() on the GIcon interfaceType %s does not implement the GIcon interfaceType %s is not classedType of message, '%s', does not match expected type '%s'Type of the attributeUnable to create trash dir %s: %sUnable to find terminal required for applicationUnable to get Hardware profile: %sUnable to load /var/lib/dbus/machine-id or /etc/machine-id: Unable to retrieve property %s.%sUnable to set property %s.%sUnexpected early end-of-streamUnexpected lack of content trying to (safely) read a lineUnexpected lack of content trying to read a lineUnexpected reply %d from StartServiceByName("%s") methodUnknown bus type %dUnknown command %s Unknown or unsupported transport “%s” for address “%s”Unknown processing option “%s”Unknown typeUnmountUnnamedUnsupported key “%s” in address entry “%s”Unsupported socket addressUnsupported socket familyUsage:Usage: Use %s to get detailed help. Use a long listing formatUse “%s help COMMAND” to get detailed help. VALUEValue not specifiedWait for a bus name to appear.Wanted to read %lu byte but only got %luWanted to read %lu bytes but only got %luWarning: According to introspection data, interface “%s” does not exist Warning: According to introspection data, method “%s” does not exist on interface “%s” Wrong number of tokens (%d)[ARGS...][ARGS…][COMMAND][OPTION…][OPTION…] BUS-NAME[SCHEMA[:PATH]]abbreviated month nameAprabbreviated month nameAugabbreviated month nameDecabbreviated month nameFebabbreviated month nameJanabbreviated month nameJulabbreviated month nameJunabbreviated month nameMarabbreviated month nameMayabbreviated month nameNovabbreviated month nameOctabbreviated month nameSepabbreviated month name with dayAprabbreviated month name with dayAugabbreviated month name with dayDecabbreviated month name with dayFebabbreviated month name with dayJanabbreviated month name with dayJulabbreviated month name with dayJunabbreviated month name with dayMarabbreviated month name with dayMayabbreviated month name with dayNovabbreviated month name with dayOctabbreviated month name with daySepabbreviated weekday nameFriabbreviated weekday nameMonabbreviated weekday nameSatabbreviated weekday nameSunabbreviated weekday nameThuabbreviated weekday nameTueabbreviated weekday nameWedaction name must be given after application id actions accept a maximum of one parameter attributes: display name: %s doing nothing. drive doesn’t implement ejectdrive doesn’t implement eject or eject_with_operationdrive doesn’t implement polling for mediadrive doesn’t implement startdrive doesn’t implement stopedit name: %s error parsing action parameter: %s error sending %s message to application: %s full month nameAprilfull month nameAugustfull month nameDecemberfull month nameFebruaryfull month nameJanuaryfull month nameJulyfull month nameJunefull month nameMarchfull month nameMayfull month nameNovemberfull month nameOctoberfull month nameSeptemberfull month name with dayAprilfull month name with dayAugustfull month name with dayDecemberfull month name with dayFebruaryfull month name with dayJanuaryfull month name with dayJulyfull month name with dayJunefull month name with dayMarchfull month name with dayMayfull month name with dayNovemberfull month name with dayOctoberfull month name with daySeptemberfull weekday nameFridayfull weekday nameMondayfull weekday nameSaturdayfull weekday nameSundayfull weekday nameThursdayfull weekday nameTuesdayfull weekday nameWednesdayhidden internal errorinvalid action name: “%s” action names must consist of only alphanumerics, “-” and “.” invalid application id: “%s” l10n requested, but no gettext domain givenlist-actions command takes only the application idname of the output filename: %s nick must be a minimum of 2 charactersout of memoryremoved existing output file. size: type is INVALIDtype: %s unable to connect to D-Bus: %s unable to find desktop file for application %s unknown errorunrecognised command: %s unsupported l10n category: %suri: %s volume doesn’t implement mount“%s” is not a signed number“%s” is not an unsigned number“%s” takes no arguments “version” takes no argumentsProject-Id-Version: glib master Report-Msgid-Bugs-To: https://bugzilla.gnome.org/enter_bug.cgi?product=glib&keywords=I18N+L10N&component=general POT-Creation-Date: 2018-02-16 15:50+0000 PO-Revision-Date: 2018-02-16 21:42+0100 Last-Translator: Fabio Tomat Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=(n != 1); X-Generator: Poedit 2.0.3 (codifiche no valide) e --strict al jere specificât; si jes. %.1f EB%.1f Eb%.1f EiB%.1f Eib%.1f GB%.1f Gb%.1f GiB%.1f Gib%.1f KB%.1f KiB%.1f Kib%.1f MB%.1f Mb%.1f MiB%.1f Mib%.1f PB%.1f Pb%.1f PiB%.1f Pib%.1f TB%.1f Tb%.1f TiB%.1f Tib%.1f kB%.1f kb%s bit%s bit%s byte%s byteIl comant %s al domande un id di aplicazion di seguî in maniere direte gjenar di file %sgjenar %s%s: sorescrivi “%s”? %u bit%u bit%u byte%u byte(In plui no si è rivâts ancje a molâ il bloc par “%s”: %s) (Scrîf cualsisei caratar par sierâ chest barcon) --strict al jere specificât; si jes. AZIONAPPIDAPPID AZION [PARAMETRI]APPID [FILE…]ATRIBÛTATRIBÛTSAtive une azionL'element direzion “%s” nol conten un doi ponts (:)La direzion e presente cualchi bit plui in là de lungjece dal prefìsDirezion “%s” no valide (e covente juste une clâf astrate, tmpdir o di percors)Un ogjet al è za espuartât pe interface %s su %sOpzions aplicazion:Identificadôr aplicazion tal formât D-Bus (p.e. org.esempli.visualizadôr)La informazion de aplicazion e mancje di un identificadôrArgoments: Atribût no specificâtIl valôr dal atribût al scugne jessi diviers di NULLRispueste dal proxy HTTP sbaliadeCOMANTInizializazion anulabile no supuartadeAnulât vie GDBusAuthObserver::authorize-authenticated-peerImpussibil inviâ in automatic D-Bus cence $DISPLAY X11Impussibil deserializâ il messaç: Impussibil determinâ la direzion dal bus parcè che la variabile di ambient DBUS_STARTER_BUS_TYPE no je stabilideImpussibil determinâ la direzion dal bus de variabile di ambient DBUS_STARTER_BUS_TYPE — valôr '%s' no cognossûtImpussibil determinâ la direzion dal bus de variabile di ambient DBUS_STARTER_BUS_TYPE — valôr “%s” no cognossûtImpussibil determinâ la direzion dal bus di session (no implementade par chest SO)Impussibil scoltâ o traspuart “%s” no supuartâtImpussibil serializâ il messaç: Impussibil cjonçâ GBufferedInputStreamImpussibil cjonçâ GMemoryInputStreamImpussibil copiâ la cartele sore de carteleImpussibil copiâ sore de carteleImpussibil copiâ il file speciâlImpussibil creâ la cartele dal utent pe configurazion MIME %s: %sImpussibil creâ la cartele dal utent pe configurazion de aplicazion %s: %sImpussibil creâ il file .desktop %s dal utentImpussibil gjestî la version furnide de codifiche de iconeImpussibil gjestî la version %d de codifiche GEmblemImpussibil gjestî la version %d de codifiche GEmblemedIconImpussibil gjestî la version %d de codifiche GFileIconImpussibil spostâ la cartele sore de carteleImpussibil copiâ in maniere ricorsive la carteleComants:Comants: Comants: help Mostre chestis informazions introspect Introspezion di un ogjet rimot monitor Monitorâ un ogjet rimot call Invocâ un metodi suntun ogjet rimot emit Emet un segnâl wait Spiete che un non di bus al vegni fûr Dopre “%s COMANT --help” par vê jutori su ogni comant. Conet ae direzion D-Bus furnideConet al bus di sessionConet al bus di sistemeIl montaç contignût nol esistConversion de cumbinazion di caratars “%s” a “%s” no je supuartadeLa copie (reflink/clone) tra i montaçs no je supuartadeLa copie (reflink/clone) no je supuartade o no à funzionâtLa copie (reflink/clone) no je supuartade o no je valideCopie un o plui fileCopie un o plui file de SORZINT ae DESTINAZION.Copie cul fileImpussibil otignî il stât de rêt: Impussibil vierzi il convertidôr di “%s” a “%s”Impussibil analizâ “%s” come mascare de direzion IPCree cartelisCree cartelis.Cree cartelis superiôrsDefinizion personalizade par %sDESTINAZIONDISPOSITÎFCARTELEIl supuart DTLS nol è disponibilAplicazion predefinide par “%s”: %s Elimine un o plui fileIl file .desktop nol specifiche il cjamp ExecLa destinazion %s no je une carteleNon di destinazion di monitorâNo si à cjatât il cookie cul id %d intal puarteclâfs su “%s”No sta lâ daûr ai colegaments simbolicsMessaç di ERÔR: il cjamp di intestazion REPLY_SERIAL o ERROR_NAME al mancjePare fûrL'element <%s> nol è permetût a nivel primariL'element <%s> nol è permetût dentri di <%s>Emet un segnâl.Percors vueit furnît. Disvuede la scovacereJentre in modalitât servizi GApplication (doprâ dai file di servizi D-Bus)Erôr tal inviâ in automatic: Erôr tal clamâ StartServiceByName par %s: Erôr tal sierâ il file di bloc (cence colegament) “%s”: %sErôr tal sierâ il file: %sErôr tal comprimi il file %sErôr tal coneti: %s Erôr tal creâ une copie di backup: %sErôr tal creâ la cartele %s: %sErôr tal creâ la cartele “%s”: %sErôr tal creâ il file di bloc “%s”: %sErôr tal eliminâ il file di bloc passât “%s”: %sErôr dilunc la conversion: %sErôr inte direzion “%s” — l'atribût famee al è malformâtErôr inte direzion “%s” — l'atribût host al mancje o al è malformâtErôr inte direzion “%s” — l'atribût puarte al è malformâtErôr inte direzion “%s” — l'atribût puarte al mancje o al è malformâtErôr inte direzion “%s” — il traspuart unix al domande di stabilî juste une des clâfs tra “path” o “abstract”Erôr tal spostâ il file %s: %sErôr tal vierzi il file %s: %sErôr tal vierzi il file “%s”: %sErôr tal lei il puarteclâfs “%s” pe leture: Erôr tal vierzi il puarteclâfs “%s” pe scriture:Erôr tal analizâ il parametri %d di gjenar “%s”: %s Erôr tal analizâ il parametri %d: %s Erôr tal lei il file %s: %sErôr tal lei il file “%s”: %sErôr tal lei dal file: %sErôr tal lei dal standard inputErôr tal gjavâ il file %s: %sErôr tal gjavâ il file vecjo: %sErôr tal gjavâ il file di destinazion: %sErôr tal cambiâ non al file temporani: %sErôr tal risolvi “%s”: %sErôr tal cirî tal file: %sErôr tal configurâ la proprietât '%s': si spietave gjenar '%s' ma si à vût '%s'Erôr tal butâ te scovacere il file %s: %sErôr tal cjonçâ il file: %sErôr tal discolegâ il file di bloc “%s”: %sErôr tal vê informazions pe cartele “%s”: %sErôr tal scrivi sul file: %sErôr tal scrivi su stdoutErôr: %s Erôr: %s nol è un non bus valit Erôr: %s nol è un non interface valit Erôr: %s nol è un non membri valit Erôr: %s nol è un non valit Erôr: %s nol è un percors ogjet valit Erôr: %s nol è un non bus univoc valit. Erôr: %s nol è un non di bus ben-cognossût valit Erôr: Destinazion no specificade Erôr: il non dal metodi nol è specificât Erôr: il non dal metodi “%s” nol è valit Erôr: il percors ogjet nol è specificât Erôr: il non dal segnâl nol è specificât Erôr: il non segnâl “%s” nol è valit Erôr: masse argoments. Erôr: impussibil monitorâ une conession non-message-bus Esaurîts ducj i mecanisims di autenticazion disponibii (provâts: %s) (disponibii: %s)Si spietave un GEmblem par GEmblemedIconSi spietave une stringhe UTF-8 valide ma si à cjatât byte no valits al byte offset %d (la lungjece de stringhe e je %d). La stringhe UTF-8 valide fin chel pont e jere “%s”FILEPERCORS FILEFILE [PERCORS]No si è rivâts a creâ il file temp: %sNo si è rivâts a cjariâ lis informazion pal gjestôr “%s”No si è rivâts a localizâ “%s” in nissune cartele sorzintNo si è rivâts a localizâ “%s” inte cartele atuâlNo si è rivâts a ridimensionâ il flus di jessude de memorieNo si è rivâts a stabilî “%s” come gjestôr predefinît par “%s”: %s Il file %s al ven fûr plui voltis inte risorseI nons dai file no puedin contignî “%c”Il file “%s” al è masse larcIl filesystem nol supuarte i colegaments simbolicsIl prin token de rie %d dal puarteclâfs su “%s” cul contignût “%s” al è malformâtSeguìs i colegaments simbolics, i montaçs e lis scurtisOpzions GApplicationGCredentials nol conten un ID di procès su chest SOGCredentials nol è implementât in chest SO%H:%M:%S%I:%M:%S %p%a %H:%M:%S, %e di %B dal %Y%d/%m/%yAMPMOten informazions sul file-systemOten o stabilìs il gjestôr par un gjenar di mime.GJESTÔRAutenticazion proxy HTTP falideDomandade autenticazion proxy HTTPConession proxy HTTP falide: %iConession proxy HTTP no permetudeIl servidôr proxy HTTP al à sierât la conession in maniere inspietade.Il non host “%s” al conten “[” ma no “]”Se nissun gjestôr al è furnît, al liste lis aplicazions regjistradis e conseadis par un gjenar di mime. Se un gjestôr al ven furnît, chel al ven stabilît come gjestôr predefinît pal gjenar mime.Si ignore chest file. Secuence multibyte incomplete tal inputIl flus di jentrade nol implemente la letureErôr interni: %sFurnît GSeekType no valitStringhe di gjenar GVariant “%s” no valideGjenar di atribût no valit (si spietave une stringhe di byte)Gjenar di atribût no valit (si spietave une stringhe)Gjenar di atribût no valit (si spietave uint32)Gjenar di atribût no valit (si spietave uint64)Gjenar di atribût “%s” no valitSecuence byte no valide tal input di conversionDomini no valitValôr di endian no valit. Si spietave 0x6c (“l”) o 0x42 (“B”) ma si à cjatât il valôr 0x%02xNon file %s no valitNon dal host no valitVersion maiôr dal protocol no valide. Si spietave 1 ma si à cjatât %dValôr numeric no valitOgjet no valit, no inizializâtRichieste di ricercje no valideFurnît valôr di colegament simbolic no valitInvoche une azion su la aplicazionTen adun cul file cuant che si sposteCubie clâf/valôr %d, “%s”, intal element direzion “%s” no conten un segn uguâlPOSIZIONInvie une aplicazionInvie la aplicazion (cun file opzionâi di vierzi)La lungjece %u e je masse lungje pe direzionRie %d dal puarteclâfs su “%s” cun contignût “%s” e je malformade ListeListe aplicazionsListe azions disponibilisListe i contignûts des cartelis intun formât a arbul.Liste lis azions statichis par une aplicazion (dal file .desktop)Liste i contignûts des posizionsListe i contignûts des posizions.Liste lis aplicazion instaladis che si puedin ativâ di D-Bus (par file .desktop)Liste i atribûts scrivibiiAl liste intun arbul i contignûts des posizionsPosizion no specificadeMessaç METHOD_CALL: il cjamp di intestazion PATH o MEMBER al mancjeMessaç METHOD_RETURN: il cjamp di intestazion REPLY_SERIAL al mancjeGJENARMIMEDâts di input malformâts par GFileIconNumar di token malformât (%d) inte codifiche GEmblemNumar di token malformât (%d) inte codifiche GEmblemedIconNumar di version malformât: %sCumbinazion de cubie clâf/valôr cence significât inte vôs di direzion “%s”Il cuarp dal messaç al à firme “%s” ma no je la intestazion de firmeIl cuarp dal messaç al à une firme di gjenar “%s”, ma la firme tal cjamp de intestazion e je “%s”Il cuarp dal messaç al è vueit ma la firme tal cjamp de intestazion e je “(%s)”Il metodi '%s' su la interface '%s' cun firme '%s' nol esistIl metodi '%s' al à tornât il gjenar '%s', ma si spietave '%s'Metodi e non interfaceArgoment mancjantTen di voli une cartele (predefinît: al dipent dal gjenar)Ten di voli un file (predefinît: al dipent dal gjenar)Ten di voli un file in maniere direte (si vise des modifichis fatis par mieç di colegaments permanents)Monitore un ogjet rimot.Ten di voli lis modifichis a file e cartelisMonte o dismonte lis posizionsSposte te scovacere file o cartelisSposte i file o lis cartelis te scovacere.Sposte un o plui fileSi scugne specificâ un singul gjenar mime e se si vûl un gjestôrNONVersion di NetworkManager masse vecjeNo sta mai lâ daûr ai colegaments simbolicsNissune direzion specificadeNo je regjistrade nissune aplicazion par gjestî chest fileNissune aplicazion predefinide par “%s” Nissune destinazion furnideNissune posizion furnideNissune aplicazion conseade Nissune aplicazion regjistrade Nissun file di scheme cjatât: Nissune intestazion di firme tal messaç, ma il cuarp dal messaç al è di %u byteNissune intestazion di firme tal messaç, ma il cuarp dal messaç al è di %u byteInterface '%s' inesistenteInterface '%s' inesistente sul ogjet tal percors %sInterface 'org.freedesktop.DBus.Properties' inesistente sul ogjet tal percors %sMetodi '%s' inesistentProprietât '%s' inesistenteNissune cartele di destinazionNissun gjenar pal non de classe %sNo vonde memorieNo vonde spazi pe direzion dal socketNo vonde spazi te destinazionPercors ogjet dulà emeti il segnâlPercors dal ogjet di monitorâDome stampe proprietâtsVierç i file cun la aplicazion predefinideOperazion no supuartadeLa operazion e jere anuladeDestinazion opzionâl pal segnâl (non univoc)Parametri opzionâl pe invocazion de azion, in formât GVariantNons di file assolûts o relatîfs opzionâi opûr URI di vierziOpzions:Il flus di jessude nol implemente la scriturePasse sore al ID de aplicazionPARAMETRIIl valôr “%s” analizât pal variant no je une firme D-Bus valideIl valôr “%s” analizât nol è un percors di ogjet D-Bus valitIl valôr “%s” analizât no je une firme D-Bus valideIl valôr “%s” analizât no je une firme D-Bus valide (pal cuarp)I permès su pe cartele “%s” no son valits. Si spietave modalitât 0700, vût 0%oStampe XMLStampe i URI completsStampe jutoriStampe versionStampe informazions su la version e jesStampe informazions su la version e jes.Domande prime di sorescriviLa proprietât '%s' no je leibileLa proprietât '%s' no je scrivibileAplicazions conseadis: Aplicazions regjistradis: Cambie non a un fileCambie non a un file.SCHEME[:PERCORS]SCHEME[:PERCORS] CLÂFSCHEME[:PERCORS] CLÂF VALÔRSCHEME[:PERCORS] [CLÂF]SCHEMESEZIONIl contest SELinux al scugne jessi diviers di NULLSELinux nol è abilitât su chest sistemeMessaç SIGNAL: il cjamp di intestazion PATH, INTERFACE o MEMBER al mancjeMessaç SIGNAL: il cjamp di intestazion INTERFACE al sta doprant il valôr riservât org.freedesktop.DBus.LocalMessaç SIGNAL: il cjamp di intestazion PATH al sta doprant il valôr riservât /org/freedesktop/DBus/LocalSORZINTIl secont token de rie %d dal puarteclâfs su “%s” cul contignût “%s” al è malformâtRicercje no supuartade sul flus di baseRicercje no supuartade sul flusServizi di ativâ prime di spietâ par chel altri (non ben-cognossût)Session dbus no je in esecuzion e l'inviament automatic al è falîtStabilìs un atribût di fileMostre lis opzions di GApplicationMostre file platâtsMostre informazions su lis posizionsMostre informazions su lis posizions.Mostre la version dal program e jesMostre avanzamentSegnâl e non interfaceCjatade intestazion di firme cun firme “%s” ma il cuarp dal messaç al è vueitIl flus sorzint al è za sierâtIl flus nol supuarte la azion query_infoIl flus al è za sierâtColegaments simbolics no supuartâtsIl supuart TLS nol è disponibilGJENARIl file di destinazion al esistIl file di destinazion al è une carteleIl file di destinazion nol è un file regolârLa azion di invocâI atribûts di otignîIl comant che di chel stampâ il jutori detaiâtLa conession e je sieradeIl file al è stât modificât di difûr di chiLa direzion furnide e je vueideLa risorse lì di “%s” no esistLa risorse lì di “%s” no je rivade a decomprimisiLa risorse lì di “%s” no je une carteleLa stringhe “%s” no je un valit GUID D-BusNol esist il supuart par GCredentials pe tô plateformeChest file intîr al è stât ignorât. Timp massim in secontsTimp di spietâ prime di jessi cuntun erôr (seconts); 0 par no vê scjadince (predefinît)Si à passât il timp massimValôr di conte passât a %s masse grantMasse argomentsTrasferîts %s di %s (%s/s)Scovacere no supuartadeCjonçâ no permetût sul flus di jentradeCjonçâ no supuartât sul flus di baseCjonçâ no supuartât sul flusIl gjenar %s nol implemente from_tokens() su la interface GIconIl gjenar %s nol implemente la interface GIconIl Gjenar %s nol à classeIl gjenar di messaç, '%s', nol corispuint il gjenar spietât '%s'Gjenar dal atribûtImpussibil creâ la cartele scovacere %s: %sImpussibil cjatâ il terminâl necessari pe aplicazionImpussibil otignî il profîl Hardware: %sImpussibil cjariâ /var/lib/dbus/machine-id o /etc/machine-id: Impussibil recuperâ la proprietât %s.%sImpussibil stabilî la proprietât %s.%sFin-dal-flus premadûr inspietâtMancjance di contignût inspietade cirint di lei (in sigurece) une rieMancjance di contignût inspietade cirint di lei une rieRispueste %d inspietade dal metodi StartServiceByName("%s")Gjenar di bus %d no cognossûtComant no cognossût %s Traspuart “%s” no cognossût o no supuartât pe direzion “%s”Opzion di elaborazion “%s” no cognossudeGjenar no cognossûtDismonteCence nonClâf “%s” no supuartade inte vôs di direzion “%s”Direzion dal socket no supuartadeFamee dal socket no supuartadeÛs:Ûs: Dopre %s par vê un jutori detaiât. Dopre un formât di liste prolìsDopre “%s help COMANT” par vê un jutori detaiât. VALÔRValôr no specificâtSpiete che al vegni fûr un non di bus.Si voleve lei %lu byte, ma si à vût dome %luSi voleve lei %lu byte, ma si à vût dome %luAvertiment: In acuardi cui dâts di introspezion, la interface “%s” no esist Avertiment: In acuardi cui dâts di introspezion, il metodi “%s” nol esist su pe interface “%s” Numar di token sbaliât (%d)[ARGS...][ARGS…][COMANT][OPZION…][OPZION…] NON-BUS[SCHEME[:PERCORS]]AvrAvoDicFevZenLuiJugMarMaiNovOtuSetAvrAvoDicFevZenLuiJugMarMaiNovOtuSetVinLunSabDomJoiMarMiesi scugne furnî il non de azion dopo il id de aplicazion lis azions a acetin un massim di un parametri atribûts: non di mostrâ: %s no si fâs nuie. la unitât no implemente ejectla unitât no implemente eject o eject_with_operationla unitât no implemente il control sistematic dai supuartsla unitât no implemente la azion startla unitât no implemente la azion stopnon di modificâ: %s erôr tal analizâ il parametri de azion: %s erôr tal inviâ il messaç %s ae aplicazion: %s AvrîlAvostDicembarFevrârZenârLuiJugnMarçMaiNovembarOtubarSetembarAvrîlAvostDicembarFevrârZenârLuiJugnMarçMaiNovembarOtubarSetembarVinarsLunisSabideDomenieJoibeMartarsMiercusplatât erôr interninon azion no valit: “%s” i nons des azions a scugnin consisti nome di alfanumerics, “-” e “.” id aplicazion no valit: “%s” l10n domandât, ma nissun domini gettext furnîtil comant list-actions al vûl dome il id de aplicazionnon dal file di jessudenon: %s il nick al scugne jessi di almancul 2 caratarsmemorie finidefile di jessude esistent gjavât. dimension: il gjenar al è NO VALITgjenar: %s impussibil conetisi al D-Bus: %s impussibil cjatâ il file scritori pe aplicazion %s erôr no cognossûtcomant no ricognossût: %s categorie l10n no supuartade: %suri: %s il volum nol implemente la azion mount“%s” nol è un numar cun segn“%s” nol è un numar cence segn“%s” no si spiete nissun argoment “version” no vûl nissun argomentPKx{0]EN^'6'6LC_MESSAGES/xkeyboard-config.monu[id#FH^I^q^^_^!0_R_i_____ _ __`-`C`-b`$``` ` `` a%a$;a%`aaaaaaCa"b(b)@b&jbb bb b bbbbbccc6cLcFbc cccccc dd -d;dMd]dsdddWdYe[ede}eeeee4e f)f8fGfNfVf ^fjffff f ff f f f+f )gT3gggg"ggggh1h Bh MhXhkhhhhhhh"hi1i Ni[ili}ii(ii,i#&j#Jjnjj#j"jjjk$k7k$Kk?pk%kkkk l l&l ?l`lhlwllll l m ,mJ6m>mEmnn+nDn9Zn.n@n@oGEoTo"opp!p:pZpqpppppppq qq$q 4q AqLqaqvqqqqq qqr2rPrjrr%r$r!rr+s-As os}s sss"ss"s t+tGtdtltstt tttttuu&uEuZuru u uuuuuuuvv)vDvXv*av#vvvvv$vA w;bw.w(wwxx'6x^x|xxxxxxy/yIy[yly yyy)yyy%z>z#]z zzzzz3z@-{#n{{({{%{ |4(|]|m| }|||3|||}$&}K} c} m} w} }}}}}}}$}!}(~%<~b~~~~~~ ~+=Oo'~%"$22WԀ)&6I]n""܁( ( 6D`!|#)؂4Ebgj}ƃ&ڃ-? Hizф$ 1?^ n{ ҅ !"Ad"( ͆ ن(<0R ‡ׇ' 0: O] s Ј݈&(Ol"ω/L co  NJ&ъ)$"'G&o)$'& )4$^'&)Ҍ$'!I\uƍ֍  4>QgŽɎ /C"Z} Əԏݏ'<M%c&ʐѐ /!Egő͑ґّ(EWs֒7Ki#̓ ԓ( 5I"hϔ)-)Wg8!ە 4-bwD ϖږe7bǗ ۗ(.B(qɘ  $#E!i( +ՙ%'9Ok'|ɚٚ%) HVm  › ̛4ڛ& 6"W%z%"Ɯ&. EO)cŝߝ ) J]x ߞ *&D"k)"ҟ# * = G&Sz*#$#> b n z ##֡=M8#M^Wp%ƣ ܣ ##G`uS1 <AI O] ft!zåեۥ"( 0Qov,4Ħ+;Qp (֧,,!H!j$*Ȩ$,F`ԩ f!!% Ъ۪ % 1;fUū ث%8Ws  ¬Ԭ"!2T!h"#ѭ(, Cdu!ٮ+-Y m{̯ "&?f ǰ0*$>c9{űα"8KR#b &²  7$X&},ѳ$;7Xƴܴ 9H*bʵݵ )Fe׶"" 0G]y ˷ѷ-(?h"}$Ÿٸ߸&:B,`++;%daƺں +=Tt»߻.*+V] xǼڼ - NNӽ ++Iu ɾ ׾Bc?( ֿ̿& K2e~uoZJoJ  #&)047:QTWZ]`cfilorx|  #'+.258;>ADGKNQTWZ]`dgjmpsvy}G/9Wm 3,8*e  --!&OvX2 <1T*   +$9^d{E'8K ] kx TX5* BP`p%w    & 1+; gtq ( 5So!  "; M[w (8a-## $&? f!.L:k )1@^| " TRTJ ?H]?Q^8Yq&c *HYiy -Hb {$$Di 5,  -9?(Nw# +&>e{*  $@ \ iv';,D'q$C =N0* )(Ro8J\ r(&-%L r6C!%e*'! =+iy =( >_ { $"(2&[ (?Yp* + *) Tu~,: 1!L,n'!F'h)#%B2a47%<bz& (9 K#W{&(:c!s(1C[o!"') %$3Xo6)0AWj    ")Lfu!& ")Ll   6AU g+q1(.+'1S(.+1 (;.d+1(.I\y  =GZ$p   8@Rf"}!  3DZp+, 5=Xai}* $,1#9]t2IZv)* 1<R%f"!2*R/}# #N-` F6ZQ #Jy $,FUe(|" / O#p!) ++-Yk' %* )P z         M -b ' ) . + )= ,g     )   8 I O j o ~   ,  "  / L  _     & " )/Y"s  .-4+b&$  # / ;G`-i-Ba!jI[2L-f * 8Rim3@3ty !,@Gag p,4>']!! (=)Z-"(*2,]$!9U[u "-Y, # .":]&)?R#c  !4Vu!"-I_~ (1*Z    % E 'K &s $     !2,!_!/s!!;!! ""."7"W"&^""""+""#"#"&#I#i#r##"#(#.#0$K$`$x$$$$@$$%D%a%x%%%%%%.&0&F&]&m&&&'&'&%'+'J'R'f'w'''"'#''(&/(V(n(w( ((((((.(%.)T)#i)%)))))) ) *"*<*E*/a*.*.**++E/+uu+++,%,,,3, B,M,`, v,,,,,,-4"-0W-------- . .8./T.\...//,/=/S/?d/C//0 00%0?0 P0[0Gu0t0)21 \1f1x1~111(1L1a2ut2r2O]3r3N 4o4r4u4y4~4444444444444444444444444444444555 5 55555!5$5'5*5-505356595<5?5B5F5I5L5O5V5Y5\5_5b5e5h5k5n5r5u5x5{5~55555555555555555555555555555555555555555666 6666666!6$6Xvm$f}6O1N<\jodJ[DE? ?+&2- K!~yF+-@'q]cecmt;R3&oikWLudM[O[zTz k(,kZ :!G2v>HPZ){s^"$1x&p/)L".l'.^Q '78j tY+7?TW)#* CwS5HF"a=).,BNn]!Mz@P  _~L> {C _S5-bdc pKCg4LPeY3W(e!s`-}b?^!hTb}iK"h*GH;7i\aw#,;  (,Bf4?[2RI90 PW-wdD9Mx3:JX%uS=fA$@ RA$GS' <v}MUr G*$H B6 JflEc@&%IH5VJ*% JOo8Q<:RX.Z+xN\]*ksh5%y9</  g0OjV|I2n=i6Et7891a5 bp64PuyY/46U<8G{7Vg;3#v(= IYo0p|;ZZUq"s_~F2B~(:D\]gEdrCKe0YA[Vy1MrKDt0B>L3RV'c_1>zq FQ#`+n\IUmf mD/|rbET4U@u,)S ^XjQhxw`n9QalO>NC:NT] _.%`e&Fq8Xa^| =i`Al/g{W#Ah<Less/Greater><Less/Greater> chooses 5th level; acts as onetime lock when pressed together with another 5th level chooser<Less/Greater>; acts as onetime lock when pressed together with another 3rd level chooser3rd level of <Less/Greater>3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right WinA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLAPL Keyboard Symbols: APLX Unified APL LayoutAPL Keyboard Symbols: IBM APL2APL Keyboard Symbols: Manugistics APL*PLUS IIAPL Keyboard Symbols: Unified LayoutAPL Keyboard Symbols: saxATM/phone-styleAcer AirKey VAcer C300Acer Ferrari 4000Acer laptopAdd the standard behavior to Menu keyAdding Esperanto supersigned lettersAdding currency signs to certain keysAdvance Scorpius KIAfghaniAkanAlbanianAlbanian (Plisi)Allow breaking grabs with keyboard actions (warning: security risk)Allow grab and window tree loggingAlt and Meta are on AltAlt is mapped to Right Win, Super to MenuAlt is mapped to Win and the usual AltAlt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAlt/Win key behaviorAmharicAny AltAny WinAny Win (while pressed)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium: emulate PC keys (PrtSc, Scroll Lock, Pause, Num Lock)Apple laptopArabicArabic (AZERTY)Arabic (AZERTY/digits)Arabic (Algeria)Arabic (Buckwalter)Arabic (Macintosh)Arabic (Morocco)Arabic (OLPC)Arabic (Pakistan)Arabic (QWERTY)Arabic (Sun Type 6/7)Arabic (Syria)Arabic (digits)Arabic (qwerty/digits)Arabic (with extensions for Arabic-written other languages and Arabic digits preferred)Arabic (with extensions for Arabic-written other languages and European digits preferred)ArmenianArmenian (OLPC phonetic)Armenian (alt. eastern)Armenian (alt. phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and bottom-dot L)Asus laptopAt bottom leftAt left of 'A'AtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash; acts as onetime lock when pressed together with another 3rd level chooserBambaraBanglaBangla (India)Bangla (India, Baishakhi Inscript)Bangla (India, Baishakhi)Bangla (India, Bornona)Bangla (India, Probhat)Bangla (India, Uni Gitanjali)Bangla (Probhat)BashkirianBelarusianBelarusian (Latin)Belarusian (legacy)BelgianBelgian (Sun Type 6/7)Belgian (Wang 724 AZERTY)Belgian (alt. ISO)Belgian (alt.)Belgian (alt., Latin-9 only)Belgian (alt., with Sun dead keys)Belgian (no dead keys)Belgian (with Sun dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berber (Algeria, Latin)Berber (Algeria, Tifinagh)Berber (Morocco, Tifinagh alt. phonetic)Berber (Morocco, Tifinagh alt.)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh)BosnianBosnian (US, with Bosnian digraphs)Bosnian (US, with Bosnian letters)Bosnian (with Bosnian digraphs)Bosnian (with guillemets)Both Alt togetherBoth Ctrl togetherBoth Shift togetherBoth Shift together enable Caps LockBoth Shift together enable Caps Lock; one Shift key disables itBoth Shift together enable Shift LockBrailleBraille (left-handed)Braille (right-handed)Brother InternetBulgarianBulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseBurmese ZawgyiCameroon Multilingual (AZERTY)Cameroon Multilingual (Dvorak)Cameroon Multilingual (QWERTY)Canadian MultilingualCanadian Multilingual (1st part)Canadian Multilingual (2nd part)Caps LockCaps Lock (while pressed), Alt+Caps Lock for the original Caps Lock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift does not affect Caps LockCaps Lock as CtrlCaps Lock behaviorCaps Lock is also a CtrlCaps Lock is disabledCaps Lock to first layout; Shift+Caps Lock to last layoutCaps Lock toggles ShiftLock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift does not affect Caps LockCaps Lock; acts as onetime lock when pressed together with another 3rd-level chooserCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (alt.)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChurch SlavonicChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Armada laptopCompaq Easy AccessCompaq Internet (13 keys)Compaq Internet (18 keys)Compaq Internet (7 keys)Compaq Presario laptopCompaq iPaqCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US, with Croatian digraphs)Croatian (US, with Croatian letters)Croatian (with Croatian digraphs)Croatian (with guillemets)Ctrl is mapped to Alt; Alt is mapped to WinCtrl is mapped to Win and the usual Ctrl keysCtrl positionCtrl+Alt+BackspaceCtrl+ShiftCzechCzech (QWERTY)Czech (QWERTY, extended backslash)Czech (Sun Type 6/7)Czech (UCW, only accented letters)Czech (US, Dvorak, UCW support)Czech (with <\|> key)Czech Slovak and German (US)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, no dead keys)Danish (Sun Type 6/7)Danish (Win keys)Danish (no dead keys)Default numeric keypad keysDellDell 101-key PCDell Inspiron 6000/8000 laptopDell Latitude laptopDell Precision M laptopDell Precision M65 laptopDell SK-8125Dell SK-8135Dell USB MultimediaDexxa Wireless DesktopDhivehiDiamond 9801/9802DutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (standard)Dutch (with Sun dead keys)Dyalog APL completeDzongkhaElfdalian (Swedish, with combining ogonek)Enable extra typographic charactersEnglish (Australian)English (Cameroon)English (Canada)English (Carpalx)English (Carpalx, full optimization)English (Carpalx, full optimization, intl., with AltGr dead keys)English (Carpalx, full optimization, intl., with dead keys)English (Carpalx, intl., with AltGr dead keys)English (Carpalx, intl., with dead keys)English (Colemak)English (Dvorak)English (Dvorak, alt. intl.)English (Dvorak, intl., with dead keys)English (Dvorak, left-handed)English (Dvorak, right-handed)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with rupee)English (Macintosh)English (Mali, US, Macintosh)English (Mali, US, intl.)English (Nigeria)English (Norman)English (South Africa)English (UK)English (UK, Colemak)English (UK, Dvorak)English (UK, Dvorak, with UK punctuation)English (UK, Macintosh)English (UK, Sun Type 6/7)English (UK, extended, with Win keys)English (UK, intl., Macintosh)English (UK, intl., with dead keys)English (US)English (US, IBM Arabic 238_L)English (US, Sun Type 6/7)English (US, alt. intl.)English (US, euro on 5)English (US, international AltGr Unicode combining)English (US, international AltGr Unicode combining, alternative)English (US, intl., with dead keys)English (Workman)English (Workman, intl., with dead keys)English (classic Dvorak)English (intl., with AltGr dead keys)English (programmer Dvorak)English (the divide/multiply keys toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Brazil, Nativo)Esperanto (Portugal, Nativo)Esperanto (displaced semicolon and quote, obsolete)EstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US, with Estonian letters)Estonian (no dead keys)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (no dead keys)FilipinoFilipino (Capewell-Dvorak, Baybayin)Filipino (Capewell-Dvorak, Latin)Filipino (Capewell-QWERF 2006, Baybayin)Filipino (Capewell-QWERF 2006, Latin)Filipino (Colemak, Baybayin)Filipino (Colemak, Latin)Filipino (Dvorak, Baybayin)Filipino (Dvorak, Latin)Filipino (QWERTY, Baybayin)FinnishFinnish (DAS)Finnish (Macintosh)Finnish (Sun Type 6/7)Finnish (Winkeys)Finnish (classic)Finnish (classic, no dead keys)Finnish DvorakFour-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (AZERTY)French (Bepo, ergonomic, Dvorak way)French (Bepo, ergonomic, Dvorak way, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Guinea)French (Macintosh)French (Mali, alt.)French (Morocco)French (Sun Type 6/7)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, no dead keys)French (Switzerland, with Sun dead keys)French (Togo)French (alt.)French (alt., Latin-9 only)French (alt., no dead keys)French (alt., with Sun dead keys)French (legacy, alt.)French (legacy, alt., no dead keys)French (legacy, alt., with Sun dead keys)French (no dead keys)French (with Sun dead keys)Friulian (Italy)Fujitsu-Siemens Amilo laptopFulaGaGeneric 101-key PCGeneric 102-key PC (intl.)Generic 104-key PCGeneric 105-key PC (intl.)Genius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Aus der Neo-Welt)German (Austria)German (Austria, Macintosh)German (Austria, no dead keys)German (Austria, with Sun dead keys)German (Bone)German (Bone, eszett home row)German (Dvorak)German (KOY)German (Macintosh)German (Macintosh, no dead keys)German (Neo 2)German (Neo qwerty)German (Neo qwertz)German (QWERTY)German (Sun Type 6/7)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, legacy)German (Switzerland, no dead keys)German (Switzerland, with Sun dead keys)German (T3)German (US, with German letters)German (dead acute)German (dead grave acute)German (dead tilde)German (no dead keys)German (with Hungarian letters and no dead keys)German (with Sun dead keys)German LadinGreekGreek (Colemak)Greek (Sun Type 6/7)Greek (extended)Greek (no dead keys)Greek (polytonic)Greek (simple)GujaratiGyrationHTC DreamHanyu Pinyin (altgr)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigeria)HebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard InternetHewlett-Packard Mini 110 laptopHewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa phonetic)Hindi (Wx)Honeywell EuroboardHtc Dream phoneHungarianHungarian (101/QWERTY/comma/dead keys)Hungarian (101/QWERTY/comma/no dead keys)Hungarian (101/QWERTY/dot/dead keys)Hungarian (101/QWERTY/dot/no dead keys)Hungarian (101/QWERTZ/comma/dead keys)Hungarian (101/QWERTZ/comma/no dead keys)Hungarian (101/QWERTZ/dot/dead keys)Hungarian (101/QWERTZ/dot/no dead keys)Hungarian (102/QWERTY/comma/dead keys)Hungarian (102/QWERTY/comma/no dead keys)Hungarian (102/QWERTY/dot/dead keys)Hungarian (102/QWERTY/dot/no dead keys)Hungarian (102/QWERTZ/comma/dead keys)Hungarian (102/QWERTZ/comma/no dead keys)Hungarian (102/QWERTZ/dot/dead keys)Hungarian (102/QWERTZ/dot/no dead keys)Hungarian (QWERTY)Hungarian (no dead keys)Hungarian (standard)Hyper is mapped to WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Macintosh, legacy)Icelandic (no dead keys)Icelandic (with Sun dead keys)IgboIndianInternational Phonetic AlphabetInuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (IBM 142)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US, with Italian letters)Italian (Winkeys)Italian (intl., with dead keys)Italian (no dead keys)Italian LadinJapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98)Japanese (Sun Type 6)Japanese (Sun Type 7 - pc compatible)Japanese (Sun Type 7 - sun compatible)Japanese keyboard optionsKalmykKana Lock key is lockingKannadaKannada (KaGaPa phonetic)KashubianKazakhKazakh (extended)Kazakh (with Russian)Key sequence to kill the X serverKey to choose 5th levelKey to choose the 3rd levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104 key compatible)Korean (Sun Type 6/7)Korean Hangul/Hanja keysKurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA proposed standard layout)LatvianLatvian (F)Latvian (Sun Type 6/7)Latvian (US Colemak)Latvian (US Colemak, apostrophe variant)Latvian (US Dvorak)Latvian (US Dvorak, Y variant)Latvian (US Dvorak, minus variant)Latvian (adapted)Latvian (apostrophe)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer US Dvorak)Latvian (programmer US Dvorak, Y variant)Latvian (programmer US Dvorak, minus variant)Latvian (tilde)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt as Ctrl, Left Ctrl as Win, Left Win as Left AltLeft Alt is swapped with Left WinLeft Alt+Left ShiftLeft CtrlLeft Ctrl as MetaLeft Ctrl to first layout; Right Ctrl to last layoutLeft Ctrl+Left ShiftLeft Ctrl+Left WinLeft Ctrl+Left Win to first layout; Right Ctrl+Menu to second layoutLeft ShiftLeft WinLeft Win (while pressed)Left Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserLeft Win to first layout; Right Win/Menu to last layoutLegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Sun Type 6/7)Lithuanian (US Dvorak with Lithuanian letters)Lithuanian (US, with Lithuanian letters)Lithuanian (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2nd alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBLower SorbianLower Sorbian (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedonianMacedonian (no dead keys)MacintoshMacintosh OldMaintain key compatibility with old Solaris keycodesMake Caps Lock an additional BackspaceMake Caps Lock an additional EscMake Caps Lock an additional HyperMake Caps Lock an additional Menu keyMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional EscMalay (Jawi, Arabic Keyboard)Malay (Jawi, phonetic)MalayalamMalayalam (Lalitha)Malayalam (enhanced Inscript, with rupee)MalteseMaltese (with US layout)Manipuri (Eeyek)MaoriMarathi (KaGaPa phonetic)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenuMenu (while pressed), Shift+Menu for MenuMenu as Right CtrlMeta is mapped to Left WinMeta is mapped to WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Swedish)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft Wireless Multimedia 1.0AMiscellaneous compatibility optionsMmuockMoldavianMoldavian (Gagauz)MongolianMontenegrinMontenegrin (Cyrillic with guillemets)Montenegrin (Cyrillic)Montenegrin (Cyrillic, ZE and ZHE swapped)Montenegrin (Latin with guillemets)Montenegrin (Latin, QWERTY)Montenegrin (Latin, Unicode)Montenegrin (Latin, Unicode, QWERTY)Multilingual (Canada, Sun Type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100NICOLA-F style BackspaceNepaliNon-breaking space at the 2nd levelNon-breaking space at the 3rd levelNon-breaking space at the 3rd level, nothing at the 4th levelNon-breaking space at the 3rd level, thin non-breaking space at the 4th levelNon-breaking space at the 4th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th levelNon-breaking space at the 4th level, thin non-breaking space at the 6th level (via Ctrl+Shift)Northern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, no dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, no dead keys)Norwegian (Sun Type 6/7)Norwegian (Win keys)Norwegian (no dead keys)Num LockNum Lock on: digits; Shift for arrow keys. Num Lock off: arrow keys (as in Windows)Numeric keypad Delete behaviorNumeric keypad always enters digits (as in macOS)OLPCOccitanOghamOgham (IS434)Ol ChikiOld HungarianOriyaOrtek Multimedia/Internet MCK-800Ossetian (Georgia)Ossetian (Win keys)Ossetian (legacy)PC-98Pannonian RusynParentheses positionPashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian keypad)PolishPolish (Colemak)Polish (Dvorak)Polish (Dvorak, with Polish quotes on key 1)Polish (Dvorak, with Polish quotes on quotemark key)Polish (Germany, no dead keys)Polish (Glagolica)Polish (QWERTZ)Polish (Sun Type 6/7)Polish (intl., with dead keys)Polish (legacy)Polish (programmer Dvorak)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, IBM/Lenovo ThinkPad)Portuguese (Brazil, Nativo for US keyboards)Portuguese (Brazil, Nativo)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, no dead keys)Portuguese (Macintosh)Portuguese (Macintosh, no dead keys)Portuguese (Macintosh, with Sun dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (no dead keys)Portuguese (with Sun dead keys)Position of Compose keyPropeller Voyager KTEZ-1000PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRight Alt never chooses 3rd levelRight Alt; Shift+Right Alt as ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win (while pressed)Right Win chooses 5th level; acts as onetime lock when pressed together with another 5th level chooserRomanianRomanian (Germany)Romanian (Germany, no dead keys)Romanian (Sun Type 6/7)Romanian (Win keys)Romanian (cedilla)Romanian (ergonomic Touchtype)Romanian (standard cedilla)Romanian (standard)Rupee on 4RussianRussian (Czech, phonetic)Russian (DOS)Russian (Georgia)Russian (Germany, phonetic)Russian (Germany, recommended)Russian (Germany, transliteration)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Polyglot and Reactionary)Russian (Rulemak, phonetic Colemak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, no dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic)Russian (phonetic, AZERTY)Russian (phonetic, Dvorak)Russian (phonetic, French)Russian (phonetic, with Win keys)Russian (typewriter)Russian (typewriter, legacy)Russian (with Ukrainian-Belorussian layout)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)Samsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa phonetic)Sanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic with guillemets)Serbian (Cyrillic, ZE and ZHE swapped)Serbian (Latin with guillemets)Serbian (Latin)Serbian (Latin, QWERTY)Serbian (Latin, Unicode)Serbian (Latin, Unicode, QWERTY)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + Num Lock enables PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift+Caps LockSicilianSicilian (US keyboard)SilesianSilvercrest Multimedia WirelessSindhiSinhala (US, with Sinhala letters)Sinhala (phonetic)SlovakSlovak (QWERTY)Slovak (QWERTY, extended backslash)Slovak (Sun Type 6/7)Slovak (extended backslash)SlovenianSlovenian (US, with Slovenian letters)Slovenian (with guillemets)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Dvorak)Spanish (Latin American, dead tilde)Spanish (Latin American, no dead keys)Spanish (Latin American, with Sun dead keys)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Win keys)Spanish (dead tilde)Spanish (no dead keys)Spanish (with Sun dead keys)Special keys (Ctrl+Alt+<key>) handled in a serverSteelSeries Apex 300 (Apex RAW)Sun Key compatibilitySun Type 6 (Japanese)Sun Type 6 USB (Japanese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (European)Sun Type 7 USBSun Type 7 USB (European)Sun Type 7 USB (Japanese)/Japanese 106-keySun Type 7 USB (Unix)Super Power MultimediaSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap ESC and Caps LockSwap Left Alt with Left CtrlSwap Left Win with Left CtrlSwap Right Win with Right CtrlSwap with square bracketsSwedishSwedish (Dvorak A5)Swedish (Dvorak)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (US, with Swedish letters)Swedish (based on US Intl. Dvorak)Swedish (no dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook tabletSyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)Tamil (Inscript)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, TAB encoding)Tamil (TamilNet '99 with Tamil numerals)Tamil (TamilNet '99)Tamil (TamilNet '99, TAB encoding)Tamil (TamilNet '99, TSCII encoding)Targa Visionary 811TatarTeluguTelugu (KaGaPa phonetic)Telugu (Sarala)ThaiThai (Pattachote)Thai (TIS-820.2538)TibetanTibetan (with ASCII numerals)To the corresponding key in a Colemak layoutTo the corresponding key in a Dvorak layoutTo the corresponding key in a QWERTY layoutToshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Truly Ergonomic Computer Keyboard Model 227 (Wide Alt keys)Truly Ergonomic Computer Keyboard Model 229 (Standard sized Alt keys, additional Super and Menu key)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Germany)Turkish (Sun Type 6/7)Turkish (intl., with dead keys)Turkish (with Sun dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUgaritic instead of ArabicUkrainianUkrainian (Sun Type 6/7)Ukrainian (Win keys)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode additions (arrows and math operators)Unicode additions (arrows and math operators; math operators on default level)Unitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (Win keys)Urdu (alt. phonetic)Urdu (phonetic)Use keyboard LED to show alternative layoutUsing space key to input non-breaking spaceUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseViewSonic KU-306 InternetWang 724 keypad with Unicode additions (arrows and math operators)Wang 724 keypad with Unicode additions (arrows and math operators; math operators on default level)Win is mapped to PrtSc and the usual WinWin+SpaceWinbook Model XP5WolofYahoo! InternetYakutYorubaZero-width non-joiner at the 2nd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, nothing at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, thin non-breaking space at the 4th levelZero-width non-joiner at the 2nd level, non-breaking space at the 3rd level, zero-width joiner at the 4th levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd levelZero-width non-joiner at the 2nd level, zero-width joiner at the 3rd level, non-breaking space at the 4th levelZero-width non-joiner at the 3rd level, zero-width joiner at the 4th levelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzeMachines m6800 laptopeeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjakakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzhProject-Id-Version: xkeyboard-config-2.23.99 Report-Msgid-Bugs-To: svu@users.sourceforge.net POT-Creation-Date: 2019-10-19 21:52+0100 PO-Revision-Date: 2018-06-14 09:13+0200 Last-Translator: Fabio Tomat Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Bugs: Report translation errors to the Language-Team address. X-Generator: Poedit 2.0.7 Plural-Forms: nplurals=2; plural=(n != 1); <Mancul di/Plui grant di><Mancul di/Plui grant di> al sielç il cuint nivel; al agjìs come un bloc par une volte sole cuant che si frache adun cuntun altri seletôr di cuint nivel<Mancul di/Plui grant di>; al agjìs come bloc par une volte sole cuant che si frache adun cuntun altri seletôr di tierç nivelTierç nivel di <Mancul di/Plui grant di>Tierç nivel dal BlocMaiuscTierç nivel dal Ctrl a çampeTierç nivel dal Win a çampeTierç nivel di MenùTierç nivel dal Ctrl diestriTierç nivel dal Win diestriA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APLSimbui tastiere APL: disposizion APL unificade APLXSimbui tastiere APL: IBM APL2Simbui tastiere APL: Manugistics APL*PLUS IISimbui tastiere APL: disposizion unificadeSimbui tastiere APL: saxATM/stîl-telefonAcer AirKey VAcer C300Acer Ferrari 4000Portatil AcerZonte il compuartament standard al tast MenùZonte des letaris supersegnadis dal EsperantoZontâ simbui di valude a cualchi tastAdvance Scorpius KIAfganeAkanAlbaneseAlbanese (Plisi)Permet di interompi la cature cun lis azions di tastiere (atenzion: pericul di sigurece)Permet di caturâ e regjistrâ l'arbul dai barconsAlt e Meta a son su AltAlt al è aplicât al Win diestri, Super al MenùAlt al è aplicât a Win e ai Alt abituâiAlt al è scambiât cun WinAlt+BlocMaiuscAlt+CtrlAlt+MaiuscAlt+SpaziCompuartament tast Alt/WinAmharicCualsisei AltCualsisei WinCualsisei Win (intant che si frache)AppleApple Aluminium (ANSI)Apple Aluminium (ISO)Apple Aluminium (JIS)Apple Aluminium: emulazion tascj PC (Stamp, BlocScor, Pause, BlocNum)Portatil AppleArabeArabe (AZERTY)Arabe (AZERTY/cifris)Arabe (Algjerie)Arabe (Buckwalter)Arabe (Macintosh)Arabe (Maroc)Arabe (OLPC)Arabe (Pakistan)Arabe (QWERTY)Arabe (Sun Type 6/7)Arabe (Sirie)Arabe (cifris)Arabe (qwerty/cifris)Arabe (cun estensions par altris lenghis e cifris arabis preferidis scritis in arap)Arabe (cun estensions par altris lenghis e cifris europeanis preferidis scritis in arap)ArmeneArmene (OLPC fonetiche)Armene (alt. orientâl)Armene (alt. fonetiche)Armene (orientâl)Armene (fonetiche)Armene (ocidentâl)Asturiane (Spagne, cun H e L cun pont bas)Portatil AsusIn bas a çampeA çampe di 'A'AtsinaFrancese (vecje maniere, alternative)AvesticheAzereAzere (ciriliche)Azona RF2300 wireless InternetBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashSbare invierse; cuant che e ven fracade adun cuntun altri seletôr di tierç nivel, e agjìs come bloc par une volteBambaraBangladeshBangladesh (Indie)Bangladesh (Indie, inscrizion Baishakhi)Bangladesh (Indie, Baishakhi)Bangladesh (Indie, Bornona)Bangladesh (Indie, Probhat)Bangladesh (Indie, Uni Gitanjali)Bangladesh (Probhat)BaschireBielorusseBielorusse (latine)Bielorusse (vecje maniere)BelgheBelghe (Sun Type 6/7)Belghe (Wang 724 AZERTY)Belghe (alt. ISO)Belghe (alt.)Belghe (alt., dome latin-9)Belghe (alt., tascj muarts Sun)Belghe (cence tascj muarts)Belghe (cun tascj muarts Sun)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berbare (Algjerie, latine)Berbare (Algjerie, Tifinagh)Berbare (Maroc, alt. fonetiche Tifinagh)Berbare (Maroc, alt. Tifinagh)Berbare (Maroc, Tifinagh fonetiche slargjade)Berbare (Maroc, Tifinagh slargjade)Berbare (Maroc, fonetiche Tifinagh)Berbare (Maroc, Tifinagh)BosgnacheBosgnache (US, cun digrafs bosgnacs)Bosgnache (US, cun letaris bosgnachis)Bosgnache (cun digrafs bosgnacs)Bosgnache (cun virgulutis bassis)Ducj i doi i Alt adunDucj i doi i Ctrl adunDucj i doi i Maiusc adunDucj i doi i Maiusc adun a abilitin BlocMaiuscDucj i doi i Maiusc adun a abilitin BlocMaiusc; un tast Maiusc lu disabiliteDucj i doi i Maiusc adun a abilitin il stât di BlocMaiuscBrailleBraille (çampine)Braille (man drete)Brother InternetBulgareBulgare (fonetiche gnove)Bulgare (fonetiche tradizionâl)BirmaneBirmane ZawgyiCamerun plurilengâl (AZERTY)Camerun plurilengâl (Dvorak)Camerun plurilengâl (QWERTY)Canadese plurilengâlCanadese plurilengâl (prin toc)Canadese plurilengâl (secont toc)BlocMaiuscBlocMaiusc (intant che si frache), Alt+BlocMaiusc pe azion origjinarie di BlocMaiuscBlocMaiusc al agjìs come Maiusc cul bloc; Maiusc al met in “pause” BlocMaiuscBlocMaiusc al agjìs come Maiusc cul bloc; Maiusc nol influence BlocMaiuscBlocMaiusc come CtrlCompuartament BlocMaiuscBlocMaiusc al è ancje un CtrlBlocMaiusc al è disabilitâtBlocMaiusc ae prime disposizion; Maiusc+BlocMaiusc ae ultime disposizionBlocMaiusc al comute Maiusc cussì di vê efiet su ducj i tascjBlocMaiusc al comute l'ûs normâl des letaris maiusculis dai caratars alfabeticsBlocMaiusc al fâs ûs interni des letaris maiusculis. Maiusc al met in “pause” BlocMaiuscBlocMaiusc al fâs ûs des letaris maiusculis internis; Maiusc nol à efiet su BlocMaiuscBlocMaiusc; al agjìs come bloc par une volte sole cuant che si frache adun cuntun altri seletôr di tierç nivelCatalane (Spagne, cun L cun pont medi)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (alt.)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony InternetChicony KB-9885Chicony KU-0108Chicony KU-0420CineseSlâf eclesiasticChuvashChuvash (latine)Classmate PCCloGaelachCoeur d'Alene SalishPortatil Compaq ArmadaCompaq Easy AccessCompaq Internet (13 tascj)Compaq Internet (18 tascj)Compaq Internet (7 tascj)Portatil Compaq PresarioCompaq iPaqCreative Desktop Wireless 7000Tatare de Crimee (Dobruze Q)Tatare de Crimee (Alt-Q Turche)Tatare de Crimee (F Turche)Tatare de Crimee (Q Turche)CravuateCravuate (cun digrafs cravuats)Cravuate (US, cun letaris cravuatis)Cravuate (cun digafs cravuats)Cravuate (cun virgulutis bassis)Ctrl al è aplicât ai Alt; Alt al è aplicât ai WinCtrl al è aplicât ai Win e i Ctrl abituâiPosizion CtrlCtrl+Alt+BackspaceCtrl+MaiuscCecheCeche (QWERTY)Ceche (QWERTY, sbare invierse estindude)Ceche (Sun Type 6/7)Ceche (UCW, nome letaris acentadis)Ceche (US, Dvorak, supuart UCW)Ceche (cun tascj <\|>)Ceche Slovache e Todescje (US)DTK2000DaneseDanese (Dvorak)Danese (Macintosh)Danese (Macintosh, cence tascj muarts)Danese (Sun Type 6/7)Danese (tascj Win)Danese (cence tascj muarts)Tascj predefinîts de tastierute numericheDellDell 101-tascj PCPortatil Dell Inspiron 6000/8000Portatil Dell LatitudePortatil Dell Precision M65Portatil Dell Precision M65Dell SK-8125Dell SK-8135Dell USB multimediâlDexxa Wireless DesktopDhivehiDiamond 9801/9802OlandeseOlandese (Macintosh)Olandese (Sun Type 6/7)Olandese (standard)Olandese (cun tascj muarts Sun)Dyalog APL completeDzongkhaElfdaliane (Svedese, cun combinazion ogonek)Abilite caratars tipografics adizionâiInglese (Australiane)Inglese (Camerun)Inglese (Canadà)Inglese (Carpalx)Inglese (Carpalx, otimizazion plene)Inglese (Carpalx, otimizazion plene, intl., cun tascj muarts AltGr)Inglese (Carpalx, otimizazion plene, intl., cun tascj muarts)Inglese (Carpalx, intl., cun tascj muarts AltGr)Inglese (Carpalx, intl., cun tascj muarts)Inglese (Colemak)Inglese (Dvorak)Inglese (Dvorak, alt. intl.)Inglese (Dvorak, intl. ,cun tascj muarts)Inglese (Dvorak, man çampe)Inglese (Dvorak, man drete)Inglese (Ghana)Inglese (Ghana, GILLBT)Inglese (Ghana, plurilengâl)Inglese (Indie, cun rupie)Inglese (Macintosh)Inglese (Mali, US, Macintosh)Inglese (Mali, US, intl.)Inglese (Nigerie)Inglese (Normane)Inglese (Sud Afriche)Inglese (UK)Inglese (UK, Colemak)Inglese (UK, Dvorak)Inglese (UK, Dvorak, cun puntuazions UK)Inglese (UK, Macintosh)Inglese (UK, Sun Type 6/7)Inglese (UK, estindude, cun tascj Win)Inglese (UK, intl., Macintosh)Inglese (UK, intl., cun tascj muarts)Inglês (US)Inglese (US, IBM Arabe 238_L)Inglese (US, Sun Type 6/7)Inglese (UK, alt. intl.)Inglese (US, euro sul 5)Inglese (US, internazionâl cumbinazion AltGr Unicode)Inglese (US, internazionâl cumbinazion AltGr Unicode, alternative)Inglese (US, intl., cun tascj muarts)Inglese (operari)Inglese (operari, intl., cun tascj muarts)Inglese (Dvorak classic)Inglese (intl., cun tascj muarts AltGr)Inglese (Dvorak par programadôr)Inglese (i tascj divît/moltipliche a cambiin la disposizion)Ennyah DKB-1008Invie su la tastieruteEsperantoEsperanto (Brasîl, natîf)Esperanto (Portugal, natîf)Esperanto (pont e virgule e virgulutis spostadis, sorpassade)EstoneEstone (Dvorak)Estone (Sun Type 6/7)Estone (US, cun letaris estonis)Estone (cence tascj muarts)Euro su 2Euro su 4Euro su 5Euro su EEverex STEPnoteEweFL90FaroeseFaroese (cence tascj muarts)FilipineFilipine (Capewell-Dvorak, Baybayin)Filipine (Capewell-Dvorak, Latine)Filipine (Capewell-QWERF 2006, Baybayin)Filipine (Capewell-QWERF 2006, Latine)Filipine (Colemak, Baybayin)Filipine (Colemak, Latine)Filipine (Dvorak, Baybayin)Filipine (Dvorak, Latine)Filipine (QWERTY, Baybayin)FinlandeseFinlandese (DAS)Finlandese (Macintosh)Finlandese (Sun Type 6/7)Finlandese (tascj Win)Finlandese (classiche)Finlandese (classiche, cence tascj muarts)Danese DvorakTast di cuart nivel cun separadôrs astratsTast di cuart nivel cun virguleTast di cuart nivel cun pontTast di cuart nivel cun pont, dome Latin-9Tast di cuart nivel cun momayyezFranceseFrancese (AZERTY)Francese (Bepo, ergonomiche, maniere Dvorak)Francese (Bepo, ergonomiche, maniere Dvorak, dome latin-9)Francese (Bretone)Francese (Camerun)Francese (Canadà)Francese (Canadà, Dvorak)Francese (Canadà, vecje maniere)Francese (Republiche democratiche dal Congo)Francese (Dvorak)Francese (Guinee)Francese (Macintosh)Francese (Mali, alt.)Francese (Maroc)Francese (Sun Type 6/7)Francese (Svuizare)Francese (Svuizare, Macintosh)Francese (Svuizare, Sun Type 6/7)Francese (Svuizare, cence tascj muarts)Francese (Svuizare, cun tascj muarts Sun)Francese (Togo)Francese (alt.)Francese (alt., dome latin-9)Francese (alt., cence tascj muarts)Francese (alt., cun tascj muarts Sun)Francese (vecje maniere, alt.)Francese (vecje maniere, alt., cence tascj muarts)Francese (vecje maniere, alt., cun tascj muarts Sun)Francese (cence tascj muarts)Francese (cun tascj muarts Sun)Furlane (Italie)Portatil Amilo Fujitsu-SiemensFulaFrancese (vecje maniere, alternative)Gjeneriche 101-tascj PCGjeneriche 102-tascj PC (intl.)Gjeneriche 104-tascj PCGjeneriche 105-tascj PC (Intl.)Genius Comfy KB-12eGenius Comfy KB-16M/Multimedia KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGjeorgjianeGjeorgjiane (France, AZERTY Tskapo)Gjeorgjiane (Italie)Gjeorgjiane (MESS)Gjeorgjiane (ergonomiche)TodescjeTodescje (Aus der Neo-Welt)Todescje (Austrie)Todescje (Austrie, Macintosh)Todescje (Austrie, cence tascj muarts)Todescje (Austrie, cun tascj muarts Sun)Todescje (Bone)Todescje (Bone, rie inizi eszett)Todescje (Dvorak)Todescje (KOY)Todescje (Macintosh)Todescje (Macintosh, cence tascj muarts)Todescje (Neo 2)Todescje (Neo qwerty)Todescje (Neo qwertz)Todescje (QWERTY)Todescje (Sun Type 6/7)Todescje (Svuizare)Todescje (Svuizare, Macintosh)Todescje (Svuizare, Sun Type 6/7)Todescje (Svuizare, vecje maniere)Todescje (Svuizare, cence tascj muarts)Todescje (Svuizare, cun tascj muarts Sun)Todescje (T3)Todescje (US, cun letaris todescjis)Todescje (acût muart)Todescje (acût grâf muart)Todescje (tilde muarte)Todescje (cence tascj muarts)Todescje (cun letaris Ongjaresis e cence tascj muarts)Todescje (cun tascj muarts Sun)Todescje ladineGrecheGreche (Colemak)Greche (Sun Type 6/7)Greche (slargjade)Greche (cence tascj muarts)Greche (politoniche)Greche (semplice)GujaratiGyrationHTC DreamHanyu Pinyin (altgr)Happy HackingHappy Hacking for MacHausa (Ghana)Hausa (Nigerie)EbraicheEbraiche (Bibliche, SIL fonetiche)Ebraiche (bibliche, Tiro)Ebraiche (lyx)Ebraiche (fonetiche)Hewlett-Packard InternetPortatil Hewlett-Packard Mini 110Hewlett-Packard NEC SK-2500 MultimediaHewlett-Packard Omnibook 500Hewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT1100Hewlett-Packard Pavilion dv5Hewlett-Packard nx9020EsadecimâlHindi (Bolnagri)Hindi (KaGaPa fonetiche)Hindi (Wx)Honeywell EuroboardTelefon Htc DreamOngjareseOngjarese (101/QWERTY/virgule/tascj muarts)Ongjarese (101/QWERTY/virgule/cence tascj muarts)Ongjarese (101/QWERTY/pont/tascj muarts)Ongjarese (101/QWERTY/pont/cence tascj muarts)Ongjarese (101/QWERTZ/virgule/tascj muarts)Ongjarese (101/QWERTZ/virgule/cence tascj muarts)Ongjarese (101/QWERTZ/pont/tascj muarts)Ongjarese (101/QWERTZ/pont/cence tascj muarts)Ongjarese (102/QWERTY/virgule/tascj muarts)Ongjarese (102/QWERTY/virgule/cence tascj muarts)Ongjarese (102/QWERTY/pont/tascj muarts)Ongjarese (102/QWERTY/pont/cence tascj muarts)Ongjarese (102/QWERTZ/virgule/tascj muarts)Ongjarese (102/QWERTZ/virgule/cence tascj muarts)Ongjarese (102/QWERTZ/pont/tascj muarts)Ongjarese (102/QWERTZ/pont/cence tascj muarts)Ongjarese (QWERTY)Ongjarese (cun tascj muarts)Ongjarese (standard)Hyper al è aplicât ai WinIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIslandeseIslandese (Dvorak)Islandese (Macintosh)Islandese (Macintosh, vecje maniere)Islandese (cence tascj muarts)Islandese (cun tascj muarts Sun)IgboIndianeAlfabet fonetic internazionâlInuktitutIrakianeIrlandeseIrlandese (UnicodeEspert)TalianeTaliane (IBM 142)Taliane (Macintosh)Taliane (Sun Type 6/7)Taliane (US, cun letaris talianis)Taliane (tascj Win)Taliane (intl., cun tascj muarts)Taliane (cence tascj muarts)Taliane LadineGjaponeseGjaponese (Dvorak)Gjaponese (Kana 86)Gjaponese (Kana)Gjaponese (Macintosh)Gjaponese (OADG 109A)Gjaponese (PC-98)Gjaponese (Sun Type 6)Gjaponese (Sun Type 7 - compatibile cun pc)Gjaponese (Sun Type 7 - compatibile cun sun)Opzions tastiere gjaponeseKalmykIl tast Kana Lock al sta blocantKannadaKannada (KaGaPa fonetiche)CassubieKazakheKazakhe (slargjade)Kazakhe (cun russe)Secuence di tascj par copâ il servidôr XTast par sielzi il cuint nivelTast par sielzi il tierç nivelKeytronic FlexProKhmer (Camboze)KikuyuKinesisKomiCoreaneCoreane (compatibile 101/104 tascj)Coreane (Sun Type 6/7)Tascj Hangul/Hanja coreansCurde (Iran, arabe-latine)Curde (Iran, F)Curde (Iran, latine Alt-Q)Curde (Iran, latine Q)Curde (Irak, arabe-latine)Curde (Irak, F)Curde (Irak, latine Alt-Q)Curde (Irak, latine Q)Curde (Sirie, F)Curde (Sirie, latine Alt-Q)Curde (Sirie, latine Q)Curde (Iran, F)Curde (Turchie, latine Alt-Q)Curde (Turchie, latine Q)KutenaiKirghizeKirghize (fonetiche)LaoLao (disposizion standard proponude STEA)LetoneLetone (F)Letone (Sun Type 6/7)Letone (US Colemak)Letone (US Colemak, variant apostrof)Letone (US Dvorak)Letone (US Dvorak, variant Y)Letone (US Dvorak, variant mancul)Letone (adatade)Letone (apostrof)Letone (ergonomiche, ŪGJRMV)Letone (moderne)Letone (programadôr US Dvorak)Letone (programadôr US Dvorak, variant Y)Letone (programadôr US Dvorak, variant mancul)Letone (tilde)Disposizion de tastierute numericheAlt a çampeAlt a çampe (intant che si frache)Alt a çampe come Ctrl, Ctrl a çampe come Win, Win a çampe come Alt a çampeAlt a çampe al è scambiât cun Win a çampeAlt a çampe+Maiusc a çampeCtrl a çampeMeta come Ctrl a çampeCtrl a çampe ae prime disposizion, Ctrl diestri ae ultime disposizionCtrl a çampe+Maiusc a çampeCtrl a çampe+Win a çampeCtrl a çampe+Win a çampe ae prime disposizion; Ctrl diestri+Menù ae seconde disposizionMaiusc a çampeWin a çampeWin a çampe (intant che si frache)Win a çampe al sielç il cuint nivel; al agjìs come bloc par une volte cuant che al ven fracât adun cuntun altri seletôr di cuint nivelWin a çampe ae prime disposizion; Win diestri/Menù ae ultime disposizionVecje maniereWang 724 vecje maniereTast vecje maniere cun virguleTast vecje maniere cun pontLituaneLituane (IBM LST 1205-92)Lituane (LEKP)Lituane (LEKPa)Lituane (Sun Type 6/7)Lituane (Dvorak US cun letaris lituanis)Lituane (US, cun letaris lituanis)Lituane (standard)LogitechLogitech AccessLogitech Cordless DesktopLogitech Cordless Desktop (alt.)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (2ᵉ alt.)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorTascj adizionâi Logitech G15 vie G15daemonLogitech InternetLogitech Internet 350Logitech Internet NavigatorLogitech Ultra-XLogitech Ultra-X Cordless Media DesktopLogitech diNovoLogitech diNovo EdgeLogitech iTouchLogitech iTouch Cordless Y-RB6Logitech iTouch Internet Navigator SELogitech iTouch Internet Navigator SE USBSorabe inferiôrSorabe inferiôr (QWERTZ)MacBook/MacBook ProMacBook/MacBook Pro (intl.)MacedoneMacedone (cence tascj muarts)MacintoshMacintosh OldManten la compatibilitât dai tascj cun i vecjos codiçs dai tascj di SolarisFâs deventâ BlocMaiusc un Backspace in pluiFâs deventâ BlocMaiusc un Esc in pluiFâs deventâ BlocMaiusc un Hyper in pluiFâs deventâ BlocMaiusc un tast Menù in pluiFâs deventâ BlocMaiusc un BlocNum in pluiFâs deventâ BlocMaiusc un Super in pluiFâs deventâ Zenkaku Hankaku un Esc in pluiMalese (Jawi, tastiere arabe)Malese (Jawi, fonetiche)MalayalamMalayalam (Lalitha)Malayalam (Inscrizion miorade, cun rupie)MalteseMaltese (cun disposizion US)Manipuri (Eeyek)MaoriMarathi (KaGaPa fonetiche)MariMemorex MX1998Memorex MX2500 EZ-AccessMemorex MX2750MenùTast Menù (fracât), Maiusc+Menù par MenùMenù come Ctrl diestriMeta al è aplicât a Win a çampeMeta al è aplicât ai WinMicrosoft Comfort Curve 2000Microsoft InternetMicrosoft Internet Pro (Svedese)Microsoft NaturalMicrosoft Natural EliteMicrosoft Natural Ergonomic 4000Microsoft Natural Pro OEMMicrosoft Natural Pro USB/Internet ProMicrosoft Natural Pro/Internet ProMicrosoft Natural Wireless Ergonomic 7000Microsoft Office KeyboardMicrosoft Wireless Multimedia 1.0AOpzions varis di compatibilitâtMmuockMoldaveMoldave (Gagauz)MonguleMontenegrineMontenegrine (Ciriliche cun virgulutis bassis)Montenegrine (Ciriliche)Montenegrine (Ciriliche, ZE e ZHE scambiadis)Montenegrine (Latine cun virgulutis bassis)Montenegrine (Latine, QWERTY)Montenegrine (Latine, Unicode)Montenegrine (Latine, Unicode, QWERTY)Plurilengâl (Canadà, Sun Type 6/7)NEC SK-1300NEC SK-2500NEC SK-6200NEC SK-7100Backspace stîl NICOLA-FNepaleseCaratar di spazi no separabil al secont nivelCaratar di spazi no separabil al tierç nivelCaratar di spazi no separabil al tierç nivel, nuie al cuart nivelCaratar di spazi no separabil al tierç nivel, caratar di spazi stret no separabil al cuart nivelSpazi no separabil al cuart nivelSpazi no separabil al cuart nivel, spazi stret no separabil al sest nivelSpazi no separabil al cuart nivel, spazi stret no separabil al sest nivel (vie Ctrl+Maiusc)Saami dal nord (Finlande)Saami dal nord (Norvegje)Saami dal nord (Norvegje, cence tascj muarts)Saami dal nord (Svezie)Northgate OmniKey 101NorvegjeseNorvegjese (Colemak)Norvegjese (Dvorak)Norvegjese (Macintosh)Norvegjese (Macintosh, cence tascj muarts)Norvegjese (Sun Type 6/7)Norvegjese (tascj Win)Norvegjese (cence tascj muarts)BlocNumBlocNum impiât: cifris; Maiusc pai tascj di direzion. BlocNum distudât: tascj di direzion (come in Windows)Compuartament dal tast canc de tastierute numericheLa tastierute numeriche e inserìs simpri cifris (come in macOS)OLPCOcitaneOghamOgham (IS434)Ol ChikiOngjarese vecjeOriyaOrtek Multimedia/Internet MCK-800Ossete (Gjeorgjie)Ossete (tascj Win)Ossete (vecje maniere)PC-98Rutenie pannonichePosizion parentesisPashtoPashto (Afganistan, OLPC)PausePersianePersiane (Afganistan, Dari OLPC)Persiane (cun tastierute numeriche persiane)PolachePolache (Colemak)Polache (Dvorak)Polache (Dvorak, cun virgulutis polachis sul tast 1)Polache (Dvorak, cun virgulutis polachis sul tast di citazion)Polache (Gjermanie, cence tascj muarts)Polache (Glagolica)Polache (QWERTZ)Polache (Sun Type 6/7)Polache (intl., cun tascj muarts)Polache (vecje maniere)Polache (Dvorak par programadôr)PortughesePortughese (Brasîl)Portughese (Brasîl, Dvorak)Portughese (Brasîl, IBM/Lenovo ThinkPad)Portughese (Brasîl, natîf par tastieris US)Portughese (Brasîl, natîf)Portughese (Brasîl, Sun Type 6/7)Portughese (Brasîl, cence tascj muarts)Portughese (Macintosh)Portughese (Macintosh, cence tascj muarts)Portughese (Macintosh, cun tascj muarts Sun)Portughese (natîf par tastieris US)Portughese (natîf)Portughese (Sun Type 6/7)Portughese (cence tascj muarts)Portughese (cun tascj muarts Sun)Posizion dal tast ComponiPropeller Voyager KTEZ-1000StampPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Alt diestriAlt diestri (intant che si frache)Alt diestri al sielç il cuint nivel; cuant che al ven fracât adun cuntun altri seletôr di cuint nivel, al agjìs come bloc par une volteIl Alt diestri nol sielç mai il tierç nivelAlt diestri, Maiusc+Alt diestri come ComponiCtrl diestriCtrl diestri (intant che si frache)Ctrl diestri come Alt diestriCtrl diestri+Maiusc diestriMaiusc diestriWin diestriWin diestri (intant che si frache)Win diestri al sielç il cuint nivel; al agjìs come bloc par une volte cuant che al ven fracât adun cuntun altri seletôr di cuint nivelRumeneRumene (Gjermanie)Rumene (Gjermanie, cence tascj muarts)Rumene (Sun Type 6/7)Rumene (tascj Win)Rumene (cedilie)Rumene (gjenar di contat ergonomic)Rumene (standard cedilie)Rumene (standard)Rupie su 4RusseRusse (Ceche, fonetiche)Russe (DOS)Russe (Gjeorgjie)Russe (Gjermanie, fonetiche)Russe (Gjermanie, conseade)Russe (Gjermanie, trasliterazion)Russe (Kazakhstan, cun Kazakh)Russe (Macintosh)Russe (Polonie, fonetiche Dvorak)Russe (Poliglote e reazionarie)Russe (Rulemak, fonetiche Colemak)Russe (Sun Type 6/7)Russe (Svezie, fonetiche)Russe (Svezie, fonetiche, cence tascj muarts)Russe (US, fonetiche)Russe (Ucraine, standard RSTU)Russe (vecje maniere)Russe (fonetiche)Russe (fonetiche, AZERTY)Russe (fonetiche, Dvorak)Russe (fonetiche, francese)Russe (fonetiche, cun tascj Win)Russe (machine di scrivi)Russe (machine di scrivi, vecje maniere)Russe (cun disposizion Ucraine-Bielorusse)SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)Samsung SDM 4500PSamsung SDM 4510PSanscrit (KaGaPa fonetiche)Sanwa Supply SKB-KG3BlocScorSecwepemctsinPont e virgule sul tierç nivelSerbeSerbe (Ciriliche cun virgulutis bassis)Serbe (Ciriliche, ZE e ZHE scambiadis)Serbe (Latine cun virgulutis bassis)Serbe (latine)Serbe (latine, QWERTY)Serbe (latine, Unicode)Serbe (latine, Unicode, QWERTY)Serbe (Russie)Serbe (cumbinazion acents invezit di tascj muarts)Serbe-Cravuate (US)Maiusc + BlocNum al abilite i tascj di direzionMaiusc al anule BlocMaiuscMaiusc nol anule BlocNum, invezit al sielç il tierç nivelMaiusc+BlocMaiuscSicilianeSiciliane (tastiere US)SlesianeSilvercrest Multimedia WirelessSindhiCingalese (US, cun letaris cingalesis)Cingalese (fonetiche)SlovacheSlovache (QWERTY)Slovache (QWERTY, sbare invierse estindude)Slovache (Sun Type 6/7)Slovache (sbare invierse estindude)SloveneSlovene (US, cun letaris slovenis)Slovene (cun virgulutis bassis)SpagnoleSpagnole (Dvorak)Spagnole (Americhe latine)Spagnole (Americhe latine, Dvorak)Spagnole (Americhe latine, tilde muarte)Spagnole (Americhe latine, cence tascj muarts)Spagnole (Americhe latine, cun tascj muarts Sun)Spagnole (Macintosh)Spagnole (Sun Type 6/7)Spagnole (tascj Win)Spagnole (tilde muarte)Spagnole (cence tascj muarts)Spagnole (cun tascj muarts Sun)Tascj speciâi (Ctrl+Alt+<tast>) gjestîts intun servidôrSteelSeries Apex 300 (Apex RAW)Compatibilitât cun tast SunSun Type 6 (gjaponese)Sun Type 6 USB (gjaponese)Sun Type 6 USB (Unix)Sun Type 6/7 USBSun Type 6/7 USB (europeane)Sun Type 7 USBSun Type 7 USB (europeane)Sun Type 7 USB (gjaponese)/Gjaponese 106-tascjSun Type 7 USB (Unix)Super Power MultimediaSwahili (Kenya)Swahili (Tanzanie)Scambiâ Ctrl e BlocMaiuscScambiâ ESC e BlocMaiuscScambiâ Alt a çampe cun Ctrl a çampeScambiâ Win a çampe cun Ctrl a çampeScambiâ Win diestri cun Ctrl diestriScambie cun parentesis cuadrisSvedeseSvedese (Dvorak A5)Svedese (Dvorak)Svedese (Macintosh)Svedese (Sun Type 6/7)Svedese (Svdvorak)Svedese (US, cun letaris svedesis)Svedese (basade su US Dvorak Intl.)Svedese (cence tascj muarts)Lengaç segns svedêsDaûr a passâ a une altre disposizionSymplon PaceBook tabletSiriacheSiriache (fonetiche)TaiwaneseTaiwanese (indigjene)TazicheTaziche (vecje maniere)Tamil (Inscrizion)Tamil (Sri Lanka, TamilNet '99)Tamil (Sri Lanka, TamilNet '99, codifiche TAB)Tamil (TamilNet '99 cun numars Tamil)Tamil (TamilNet '99)Tamil (TamilNet '99, codifiche TAB)Tamil (TamilNet '99, codifiche TSCII)Targa Visionary 811TatareTeluguTelugu (KaGaPa fonetiche)Telugu (Sarala)TailandeseTailandese (Pattachote)Tailandese (TIS-820.2538)TibetaneTibetane (cun numars ASCII)Al tast corispondent intune disposizion ColemakAl tast corispondent intune disposizion DvorakAl tast corispondent intune disposizion QWERTYToshiba Satellite S3000Truly Ergonomic 227Truly Ergonomic 229Tastiere di computer pardabon ergonomiche Model 227 (tascj Alt larcs)Tastiere di computer pardabon ergonomiche Model 229 (tascj Alt di dimension standard, tascj Super e Menù adizionâi)Trust Direct AccessTrust SlimlineTrust Wireless ClassicTswanaTurcheTurche (Alt-Q)Turche (F)Turche (Gjermanie)Turche (Sun Type 6/7)Turche (intl., cun tascj muarts)Turche (cun tascj muarts Sun)TurkmeneTurkmene (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (modalitât 102/105:EU)TypeMatrix EZ-Reach 2030 USB (modalitât 106:JP)UdmurtUgaritiche al puest de arabeUcraineUcraine (Sun Type 6/7)Ucraine (tascj Win)Ucraine (omofoniche)Ucraine (vecje maniere)Ucraine (fonetiche)Ucraine (standard RSTU)Ucraine (machine di scrivi)Zontis Unicode (frecis e operadôrs matematics)Zontis Unicode (frecis e operadôrs matematics; operadôrs matematics sul nivel predefinît)Unitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (tascj Win)Urdu (alt. fonetiche)Urdu (fonetiche)Doprâ i LED de tastiere par mostrâ la disposizion alternativeSi dopre il tast spazi par inserî il caratar di spazi no separabilSolit spazi a ogni nivelUyghureUzbecheUzbeke (Afganistan)Uzbeke (Afganistan, OLPC)Uzbeche (Latine)VietnamiteViewSonic KU-306 InternetTastierute Wang 724 cun zontis Unicode (frecis e operadôrs matematics)Tastierute Wang 724 cun zontis Unicode (frecis e operadôrs matematics; operadôrs matematics sul nivel predefinît)Win al è aplicât a Stamp i Win abituâiWin+SpaziWinbook Model XP5WolofYahoo! InternetJakuteYorubaNo-union a largjece nule al secont nivelNo-union a largjece nule al secont nivel, spazi no separabil al tierç nivelNo-union a largjece nule al secont nivel, spazi no separabil al tierç nivel, nuie al cuart nivelNo-union a largjece nule al secont nivel, spazi no separabil al tierç nivel, spazi stret no separabil al cuart nivelNo-union a largjece nule al secont nivel, spazi no separabil al tierç nivel, union a largjece nule al cuart nivelNo-union a largjece nule al secont nivel, union a largjece nule al tierç nivelNo-union a largjece nule al secont nivel, union a largjece nule al tierç nivel, spazi no separabil al cuart nivelNo-union a largjece nule al tierç nivel, union a largjece nule al cuart nivelakamaplapl2aplIIaplxarastavnazbeberbgbmbnbrlbsbycachrcmcrhcsdadede_llddlgdvdzPortatil eMachines m6800eeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyidieigikeinisitit_lldjakakikkkmknkokukutlaloltlvmdmimkmlmnmrmsmtmynenlnooldhunorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozgzhPKx{0]p rrLC_MESSAGES/libpwquality.monu[3GLhLi0*' R ]k$%B#&!J l#25!*W5?5C.NrA0 $4 /Y 9 / @ I4 <~ G + 6/ 'f  $ + ' $ *> i w    D{%5)I s~82P3-(*%',)T8~6+5;P5FG ?Q/)49 4ZCA9OO:/- 8)V+'&,Fa+3"0&$*  2' ( !) /1.%,-# The command reads the password to be scored from the standard input. BAD PASSWORD: %sBad integer valueBad integer value of settingCannot obtain random numbers from the RNG deviceCould not obtain the password to be scoredError: %s Fatal failureMemory allocation errorMemory allocation error when settingNo password suppliedOpening the configuration file failedPassword generation failed - required entropy too low for settingsPassword quality check failed: %s Setting %s is not of integer typeSetting %s is not of string typeSetting is not of integer typeSetting is not of string typeThe configuration file is malformedThe password contains forbidden words in some formThe password contains less than %ld character classesThe password contains less than %ld digitsThe password contains less than %ld lowercase lettersThe password contains less than %ld non-alphanumeric charactersThe password contains less than %ld uppercase lettersThe password contains monotonic sequence longer than %ld charactersThe password contains more than %ld characters of the same class consecutivelyThe password contains more than %ld same characters consecutivelyThe password contains the user name in some formThe password contains too few digitsThe password contains too few lowercase lettersThe password contains too few non-alphanumeric charactersThe password contains too few uppercase lettersThe password contains too long of a monotonic character sequenceThe password contains too many characters of the same class consecutivelyThe password contains too many same characters consecutivelyThe password contains words from the real name of the user in some formThe password differs with case changes onlyThe password does not contain enough character classesThe password fails the dictionary checkThe password is a palindromeThe password is just rotated old oneThe password is shorter than %ld charactersThe password is the same as the old oneThe password is too shortThe password is too similar to the old oneUnknown errorUnknown settingUsage: %s Usage: %s [user] Project-Id-Version: libpwquality 1.3.1 Report-Msgid-Bugs-To: http://fedorahosted.org/libpwquality PO-Revision-Date: 2020-09-14 04:29+0000 Last-Translator: Fabio Tomat Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=n != 1; X-Generator: Weblate 4.2.2 Il comant al lei la password di valutâ, dal standard input. PASSWORD SBALIADE: %sValôr intîr sbaliâtValôr intîr de impostazion sbaliâtImpussibil otignî numars casuâi dal dispositîf RNGImpussibil otignî la password di valutâErôr: %s Faliment fatâlErôr di assegnazion de memorieErôr di assegnazion de memorie in fase di configurazionNissune password furnideNo si è rivâts a vierzi il file di configurazionGjenerazion de password falide - entropie domandade masse basse pe configurazionControl di cualitât de password falît: %s La impostazion %s no je di gjenar intîrLa impostazion %s no je di gjenar stringheLa impostazion no je di gjenar intîrLa impostazion no je di gjenar stringheIl file di configurazion al è malformâtLa password e conten peraulis proibidis in cualchi formeLa password e conten mancul di %ld classis di caratarsLa password e conten mancul di %ld caratarsLa password e conten mancul di %ld letaris minusculisLa password e conten mancul di %ld caratars no-alfanumericsLa password e conten mancul di %ld letaris maiusculisLa password e conten une secuence monotone plui lungje di %ld caratarsLa password e conten plui di %ld caratars de stesse classe consecutîfsLa password e conten plui di %ld caratars compagns consecutîfsLa password e conten il non utent o sù par jùLa password e conten masse pôcs caratarsLa password e conten masse pocjis letaris minusculisLa password e conten masse pôcs caratars no-alfanumericsLa password e conten masse pocjis letaris maiusculisLa password e conten une secuence monotone di caratars masse lungjeLa password e conten masse caratars de stesse classe consecutîfsLa password e conten masse caratars compagns consecutîfsLa password e conten peraulis che sù par jù a derivin dal non reâl dal utentLa password e cambie dome di letaris maiusculis/minusculisLa password no conten vonde classis di caratarsLa password no passe il control dal dizionariLa password e je un palindromLa password e je come chê vecje, voltadeLa password e je plui curte di %ld caratarsLa password e je compagne di chê vecjeLa password e je masse curteLa password e semee masse a chê vecjeErôr no cognossûtImpostazion no cognossudeÛs: %s Ûs: %s [utent] PKx{0]3Y((LC_MESSAGES/atk10.monu[l HI`q# 4UqC 4?:<(7e4,$$B6Gy 5 '#9"](=6*I [f l v        )4EV h v   + 1> EQX] cns|    !+/7<CH Q [ hty          " -9 AK R ^ isz       %- 6 @J S _iox}AVg |$()%D%jH ?TI<FFG<2O+LI V 4m  & " &!7D!8|!(!! !! " """'"-"D"K"T" e"o" t""""""""" # ##0#B#W#j#}###### # # $$!$7$ H$ V$a$|$$$$$ $ $ $$$$$ $ %%4%D%M%V%i% z% %% % % %% %%% % % %%&&&.&4& =&K&\&p& && &&&&&&& ' ''.'@'R'a'h' o'{' ''' ''''' ( (,( 2(@( O(]( b( o( |(((((((Ace",ID+t ';[C /gBP$:ko)m7-.4(O8}wjy%0FELWM^u|X*SJ!r9npHs_RZ1vxUl ]3>hT=f{\ib@2&Nzda6?5~`QGV<K #YqAccessible DescriptionAccessible LayerAccessible MDI ValueAccessible NameAccessible ParentAccessible RoleAccessible Table CaptionAccessible Table Caption ObjectAccessible Table Column DescriptionAccessible Table Column HeaderAccessible Table Row DescriptionAccessible Table Row HeaderAccessible Table SummaryAccessible ValueDescription of an object, formatted for assistive technology accessEnd indexIs used to notify that the table caption has changedIs used to notify that the table caption has changed; this property should not be used. accessible-table-caption-object should be used insteadIs used to notify that the table column description has changedIs used to notify that the table column header has changedIs used to notify that the table row description has changedIs used to notify that the table row header has changedIs used to notify that the table summary has changedIs used to notify that the value has changedNumber of Accessible Hypertext LinksNumber of AnchorsObject instance’s name formatted for assistive technology accessParent of the current accessible as returned by atk_object_get_parent()Selected LinkSpecifies whether the AtkHyperlink object is selectedStart indexThe accessible MDI value of this objectThe accessible layer of this objectThe accessible role of this objectThe end index of the AtkHyperlink objectThe number of anchors associated with the AtkHyperlink objectThe number of links which the current AtkHypertext hasThe start index of the AtkHyperlink objectaccelerator labelacceptablealertanimationapplicationarrowarticleaudioautocompletebadbestblock quotecalendarcanvascaptionchartcheck boxcheck menu itemcolor choosercolumn headercombo boxcommentdateeditordefinitiondescription listdescription termdescription valuedesktop framedesktop icondialdialogdirectory panedocument emaildocument framedocument presentationdocument spreadsheetdocument textdocument webdrawing areaedit barembedded componententryfile chooserfillerfontchooserfooterformframeglass panegoodgroupingheaderheadinghighhtml containericonimageimage mapinfo barinput method windowinternal frameinvalidlabellandmarklayered panelevel barlinklistlist boxlist itemlogmarqueemathmediummenumenu barmenu itemnotificationoption panepagepage tabpage tab listpanelparagraphpassword textpopup menuprogress barpush buttonradio buttonradio menu itemratingredundant objectroot panerow headerrulerscroll barscroll panesectionseparatorsliderspin buttonsplit panestatusbarstrongtabletable celltable column headertable rowtable row headertear off menu itemterminaltexttimertitle bartoggle buttontool bartool tiptreetree itemtree tableunknownvery badvery goodvery highvery lowvery strongvery weakvideoviewportweakwindowProject-Id-Version: atk master Report-Msgid-Bugs-To: https://bugzilla.gnome.org/enter_bug.cgi?product=atk&keywords=I18N+L10N&component=general POT-Creation-Date: 2017-03-12 16:16+0000 PO-Revision-Date: 2017-05-27 23:32+0200 Last-Translator: Fabio Tomat Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Generator: Poedit 1.8.12 Descrizion acessibilStrât acessibilValôr MDI acessibilnon acessibilGjenitôr acessibilRûl acessibilDidascalie acessibil de tabeleOgjet didascalie acessibil de tabeleDescrizion acessibil de colone de tabeleIntestazion acessibil de colone de tabeleDescrizion acessibil de rie de tabeleIntestazion acessibil de rie de tabelSintesi acessibil de tabeleValôr acessibilDescrizion di un ogjet, formatade pal acès cun la tecnologjie di jutoriIndiç finâlDoprade par notificâ che la didascalie de tabele e je cambiadeDoprât par notificâ che la descrizion de tabele e je cambiade; no si varès di doprâ cheste proprietât. Si varès di doprâ invezit accessible-table-caption-objectDoprade par notificâ che la descrizion de colone de tabele e je cambiadeDoprade par notificâ che la intestazion de colone de tabeleDoprade par notificâ che la descrizion de rie de tabele e je cambiadeDoprade par notificâ che la intestazion de rie de tabele e je cambiadeDoprade par notificâ che la sintesi de tabele e je cambiadeDoprât par notificâ che il valôr al è cambiâtNumar di colegaments acessibii tal ipertestNumar di AncurisIl non de istance dal ogjet formatât pal acès cun la tecnologjie di jutoriIl gjenitôr dal atuâl acessibil come tornât di atk_object_get_parent()Colegament selezionâtSpecifiche se l'ogjet AtkHyperlink al è selezionâtIndiç iniziâlIl valôr MDI acessibil di chest ogjetIl strât acessibil di chest ogjetIl rûl acessibil di chest ogjetL'indiç finâl dal ogjet AtkHyperlinkIl numar di ancuris associadis cun l'ogjet AtkHyperlinkIl numar di colegaments presints tal AtkHypertext atuâlL'indiç iniziâl dal ogjet AtkHyperlinketichete aceleradôrpassabilealerteanimazionaplicazionfrecearticulaudiocompletament automaticno bonil miôrbloc di citazioncalendariteledidascaliediagramcasele di discrosâvôs di menù di discrosâseletôr colôrintestazion colonecasele cumbinadecomenteditôr di datedefinizionliste descriziontiermin descrizionvalôr descrizioncurnîs de scrivanieicone dal scritoricuadrant circolârdialicricuadri carteledocument e-mailcurnîs documentdocument presentaziondocument sfuei di calculdocument testdocument webaree di disensbare di modifichecomponent incorporâtcjamp inserimentseletôr filejempladôrseletôr gjenar di caratarda pît de pagjinemodulcurnîsricuadri trasparentbonintropamentintestazionintestazionaltcontignidôr htmliconeimagjinmape imagjinsbare informazionsbarcon metodi di inputcurnîs interneno valitetichetepont di riferimentricuadri a niveisbare nivelcolegamentlistecasele listevôs di listeregjistritendonmatematichemedimenùsbare menùvôs di menùnotifichericuadri opzionpagjineschedeliste di schedispanelparagraftest passwordmenù a comparîsbare di avanzamentboton di fracâboton radiovôs di menù radiovalutazionogjet ridondantricuadri lidrîsintestazion rieriesbare di scorimentricuadri di scoriment sezionseparadôrcontrol dal scoriboton che al zirericuadri dividûtsbare di stâtfuartetabelecele tabeleintestazion colone tabelerie di tabeleintestazion rie tabelevôs di menù distacabilterminâltesttimersbare dal titulboton di comutazionsbare dai strumentssugjerimentarbulelement arbultabele a arbulno cognossûtmâlune vore bonune vore altune vore basune vore fuarteune vore debulevideoaree de viodudedebulebarconPKx{0] < % %LC_MESSAGES/sudoers.monu[gT F @Q  +   " ! / +L #x A 8  / -C )q   ,  3 E P b 5 ' 5 , &@ g 'y , * . )(Rk3 (0Yu##"(8a{& "%**P${ '3%[' +-C_q ##G]m~#  OCc8#'5 ]4~'A?]w709'!a6 !4,8;e65 52Q(8)&)P(g(2&'"N q+, 0<m2   %1 +W 1 (  & !/!!I!%k!!,!2!+";"["%v"8""*"#%/#*U#&##%#*# $/"$R$n$$"$$$!$ZEY[FI 1L5CM"3K8V7 e ?G^-T\NP_@,)d+#.`(XB9:2> $WH&U RJ/fg*ba=cAQ%6DS<O0]'!;4 Sudoers path: %s Commands: Options: %p's password: %s is not a regular file%s is not allowed to run sudo on %s. This incident will be reported. %s is not in the sudoers file. This incident will be reported. %s: %s%s: Cannot verify TGT! Possible attack!: %s%s: command not found%s: read error%s: unable to allocate options: %s%s: unable to get credentials: %s%s: unable to parse '%s': %s%s: unable to store credential in cache: %s*** SECURITY information for %h ***Account or password is expired, reset your password and try againAttempt to establish PAM credentials for the target userAuthentication methods:Ignore '.' in $PATHLog the hostname in the (non-syslog) log fileLog the year in the (non-syslog) log fileNo user or hostPAM authentication error: %sPAM service name to use for login shells: %sPAM service name to use: %sPassword expired, contact your system administratorPassword: Root may run sudoSecurID communication failedSend mail if the user is not allowed to run a commandSend mail if the user is not in sudoersSend mail if the user is not in sudoers for this hostSend mail if the user tries to run a commandSend mail if user authentication failsSorry, try again.Sorry, user %s may not run sudo on %s. Unable to initialize authentication methods.User %s is not allowed to run sudo on %s. User %s may run the following commands on %s: User ID locked for SecurID Authentication[sudo] password for %p: a digest requires a path namea password is requiredaccount validation failure, is your account locked?authentication failureauthentication server error: %scommand not allowedcommand too longfailed to initialise the ACE API libraryinternal error, %s overflowinvalid authentication methodsinvalid authentication typeinvalid passcode length for SecurIDinvalid timeout valueinvalid username length for SecurIDldap.conf path: %s ldap.secret path: %s lost connection to authentication serverno authentication methodsnsswitch path: %s sorry, you must have a tty to run sudosyntax errortimeout value too largetoo many processesunable to allocate memoryunable to begin bsd authenticationunable to change expired password: %sunable to connect to authentication serverunable to contact the SecurID serverunable to create %sunable to dup stdin: %munable to execute %sunable to execute %s: %munable to forkunable to fork: %munable to get GMT timeunable to get current working directoryunable to get login class for user %sunable to initialize BSD authenticationunable to initialize LDAP: %sunable to initialize PAMunable to initialize SIA sessionunable to initialize sudoers default valuesunable to load %s: %sunable to lock log file: %sunable to open %sunable to open audit systemunable to open log file: %sunable to open pipe: %munable to read %sunable to send audit messageunable to write log file: %sunable to write to %sunable to write to I/O log file: %sunknown SecurID errorunknown uid: %uunknown user: %suser NOT authorized on hostuser NOT in sudoersvalidation failureyou do not exist in the %s databaseProject-Id-Version: sudoers-1.8.22b2 Report-Msgid-Bugs-To: https://bugzilla.sudo.ws PO-Revision-Date: 2017-12-24 14:18+0100 Last-Translator: Fabio Tomat Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Bugs: Report translation errors to the Language-Team address. Plural-Forms: nplurals=2; plural=(n != 1); X-Generator: Poedit 2.0.3 Percors di sudoers: %s Comants: Opzions: Password di %p: %s nol è un file regolâr%s nol è permetût eseguî sudo su %s. Chest incident al vignarà segnalât. %s nol è tal file sudoers. Chest incident al vignarà segnalât. %s: %s%s: Impussibil verificâ TGT! Pussibil atac in vore!: %s%s: comant no cjatât%s: erôr di leture%s: impussibil assegnâ opzions: %s%s: impussibil otignî credenziâls: %s%s: impussibil analizâ '%s': %s%s: impussibil archiviâ la credenziâl te cache: %s*** informazions di SIGURECE par %h ***Acount o password scjadude, ristabilìs la password e torne proveTentatîf di stabilî lis credentziâls PAM pal utent designâtMetodis di autenticazion:Ignore '.' in $PATHRegjistre il non host tal file di regjistri (no-syslog)Regjistre l'an tal file di regjistri (no-syslog)Nissun utent o hostErôr di autenticazion PAM: %sNon dal servizi PAM di doprâ pes interfacis di acès: %sNon dal servizi PAM di doprâ: %sPassword scjadude, contatâ l'aministradôr di sistemePassword: L'utent root al pues eseguî sudoComunicazion SecurID falideInvie une mail se l'utent nol pues eseguî un comantInvie une mail se l'utent nol è tai sudoersInvie une mail se l'utent nol è tai sudoers par chest hostInvie une mail se l'utent al cîr di eseguî un comantInvie une mail se la autenticazion dal utent e falìsTorne prove.Mi displâs, l'utent %s nol pues eseguî sudo su %s. Impussibil inizializâ i metodis di autenticazion.L'utent %s nol pues eseguî sudo su %s. L'utent %s al pues eseguî su %s i comants chi daurman: ID utent blocât pe autenticazion SecurID[sudo] password par %p: un digest al domande un non di percorse covente une passwordvalidazion account falide, isal blocât?autenticazion falideerôr dal servidôr di autenticazion: %scomant no permetûtcomant masse luncno si è rivâts a inizializâ la librarie API ACEerôr interni, %s overflow (stranfât)metodis di autenticazion no valitsgjenar di autenticazion no valitlungjece dal passcode no valide par SecurIDvalôr di timeout no valitlungjece dal non utent no valide par SecurIDpercors di ldap.conf: %s percors di ldap.secret: %s conession pierdude al servidôr di autenticazionnissun metodi di autenticazionpercors di nsswitch: %s mi displâs, si scugne vê un tty par eseguî sudoerôr di sintassivalôr di timeout masse larcmasse procèsimpussibil assegnâ memorieimpussibil tacâ la autenticazion bsdimpussibil cambiâ la password scjadude: %simpussibil conetisi al servidôr di autenticazionimpussibil contatâ il servidôr SecurIDimpussibil creâ %simpussibil fâ il "dup" di "stdin": %mimpussibil eseguî %simpussibil eseguî %s: %mimpussibil inglovâ (fâ il fork)impussibil inglovâ (fâ il fork): %mimpussibil otignî la ore GMTimpussibil otignî la cartele di vore atuâlimpussibil otignî la classe di login pal utent %simpussibil inizializâ la autenticazion BSDimpussibil inizializâ LDAP: %simpussibil inizializâ PAMimpussibil inizializâ la session SIAimpussibil inizializâ i valôrs predefinîts di sudoersimpussibil cjariâ %s: %simpussibil blocâ il file di regjistri: %simpussibil vierzi %simpussibil vierzi il sisteme di auditimpussibil vierzi il file di regjistri: %simpussibil vierzi il condot (pipe): %mimpussibil lei %simpussibil inviâ il messaç di auditimpussibil scrivi il file di regjistri: %simpussibil scrivi su %simpussibil scrivi sul file di regjistri I/O: %serôr SecurID no cognossûtuid no cognossût: %uutent no cognossût: %sl'utent NOL è autorizât sul hostl'utent NOL è in sudoersvalidazion falideno tu esistis te base di dâts %sPKx{0]LC_MESSAGES/libsecret.monu[ l . /0'`0-0! :[@"cG|1G0>+o(.  Couldn’t communicate with the secret storageDefault keyringReceived invalid secret from the secret storageattribute value pairs of item to lookupattribute value pairs which match items to clearreturn all results, instead of just first onethe collection in which to place the stored itemthe label for the new stored itemunlock item results if necessaryProject-Id-Version: libsecret master Report-Msgid-Bugs-To: http://bugzilla.gnome.org/enter_bug.cgi?product=libsecret&keywords=I18N+L10N&component=general POT-Creation-Date: 2013-12-19 15:14+0000 PO-Revision-Date: 2016-03-23 16:07+0100 Last-Translator: Fabio Tomat Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Generator: Poedit 1.8.5 Impussibil comunicâ cul dispositîf di archiviazion dai segretsPuarteclâfs predefinîtRicevût un segret no valit dal dispositîf di archiviazion dai segretsPâr di valôrs dal atribût dal element di cirîPâr di valôrs dal atribût che a corispuindin al atribût di eliminâtorne ducj i risultâts invezit che dome il prinla colezion dulà plaçâ l'element salvâtle etichete par il gnûf element salvâtSbloche i elements dai risultâts se necessariPKx{0]B^\\LC_MESSAGES/gdk-pixbuf.monu[\ )&:Y%y)-!6X-q,, -$N*s "*!)Lv,0. %</b<'Db"'%`C*R(""K&nV!N(w '"6ZP887!O"q&%%BNJ0.& *&1$X}!""$(qM;$ .? $n * O *!%9!/_!-!e!%#"xI""""##N5#S#N#N'$2v$H$$$$%,9%f%,z%2%"%"%# &&D&k&&U&Z&CN'C'!' '&(@(_(-}(4(4( )!)!()-J)Fx)A)**!3* U*_* n**&*9*2 +D@+D+3++L,#i, ,,E,'-*<--g-C-)- .+$.(P. y."..!.".!/!7/+Y/G/2/90':0b0%h000%0)0V1r111111112-2?2R2$c22222&4-4156J525>5!5"6861H6.z6.6#6769479n7#7%7$7287J8 8)888#8<9>W999.98927:$j:O:!:;;=>;|;;;);(;/ <!P<(r<%<!<<9g==1#>3U>4>*>k>2U?c?)?.@+E@2q@*@)@)@s#A$AQAQB!`B'B(B,BC%CUECeC7DD9D-~D DD-D%DE1E%QEwE/E0E/E|(FJF+F(G8EG(~G0G^G,7H(dH3H2HmH.bIIJ$J">J aJ%JmJuK^K^KCJLULL!L/ M9W0W%W>WA&X$hX+X+X$X+ Y6Y&TY-{YVY3ZP4Z*ZZ+Z%Z* [.6[1e[q[ \ \\\ \ $\2\6\ F\P\U\[\_\ w\\\<kXyK5IrtxBL*?#^9,ZqgR=\ -_ QH3$ c|~U1fms(}u/J`WV47) phT86 2N&> FESG'jYlivCa.z[@w:!on+PdD]"O0A%M;{beA pointer to the pixel data of the pixbufANI image was truncated or incomplete.BMP image has bogus header dataBMP image has oversize paletteBMP image has unsupported depthBMP image has unsupported header sizeBMP image width too largeBad code encounteredBits per SampleBits per channel of PNG image is invalid.Bits per channel of transformed PNG is not 8.Cannot allocate TGA header memoryCannot allocate colormapCannot allocate memory for TGA context structCannot allocate memory for loading PNM imageCannot allocate memory for loading XPM imageCannot allocate new pixbufCannot read XPM colormapCircular table entry in GIF fileColor profile has invalid length %d.Color profile has invalid length “%u”.ColorspaceCompressed icons are not supportedCould not allocate memory: %sCould not create stream: %sCould not decode ICNS fileCould not get image height (bad TIFF file)Could not get image width (bad TIFF file)Could not read from stream: %sCould not seek stream: %sCouldn’t allocate memory for color profileCouldn’t allocate memory for loading JPEG fileCouldn’t allocate memory for saving BMP fileCouldn’t allocate memory for streamCouldn’t allocate memory to buffer image dataCouldn’t decode imageCouldn’t load bitmapCouldn’t load metafileCouldn’t recognize the image file format for file “%s”Couldn’t saveCouldn’t write to BMP fileCouldn’t write to TIFF fileCursor hotspot outside imageDimensions of TIFF image too largeError interpreting JPEG image file (%s)Error reading ICNS image: %sError while decoding colormapError writing to image file: %sError writing to image streamFailed to allocate %d byte for file read bufferFailed to allocate %d bytes for file read bufferFailed to allocate QTIF context structure.Failed to close “%s” while writing image, all data may not have been saved: %sFailed to create GdkPixbufLoader object.Failed to find an image data atom.Failed to load RGB data from TIFF fileFailed to load TIFF imageFailed to load animation “%s”: reason not known, probably a corrupt animation fileFailed to load image “%s”: %sFailed to load image “%s”: reason not known, probably a corrupt image fileFailed to open TIFF imageFailed to open file “%s”: %sFailed to open temporary fileFailed to open “%s” for writing: %sFailed to read QTIF headerFailed to read from temporary fileFailed to save TIFF imageFailed to skip the next %d byte with seek().Failed to skip the next %d bytes with seek().Failed to write TIFF dataFailed to write to temporary file when loading XBM imageFailed to write to temporary file when loading XPM imageFailure reading GIF: %sFatal error in PNG image file: %sFatal error reading PNG image fileFatal error reading PNG image file: %sFile does not appear to be a GIF fileFile error when reading QTIF atom: %sGIF file was missing some data (perhaps it was truncated somehow?)GIF image has no global colormap, and a frame inside it has no local colormap.GIF image is corrupt (incorrect LZW compression)GIF image loader cannot understand this image.GIF image was truncated or incomplete.Has AlphaHeightICO image was truncated or incomplete.Image file “%s” contains no dataImage format unknownImage header corruptImage is too wide for BMP format.Image pixel data corruptImage too large to be saved as ICOImage type currently not supportedImage type “%s” is not supportedImage-loading module %s does not export the proper interface; perhaps it’s from a different gdk-pixbuf version?Incremental loading of image type “%s” is not supportedInput file descriptor is NULL.Insufficient memory to load PNG fileInsufficient memory to load PNM context structInsufficient memory to load PNM fileInsufficient memory to load XBM image fileInsufficient memory to load image, try exiting some applications to free memoryInsufficient memory to open JPEG 2000 fileInsufficient memory to open TIFF fileInsufficient memory to save image into a bufferInsufficient memory to save image to callbackInsufficient memory to store a %lu by %lu image; try exiting some applications to reduce memory usageInternal error in the GIF loader (%s)Internal error: Image loader module “%s” failed to complete an operation, but didn’t give a reason for the failureInvalid XBM fileInvalid XPM headerInvalid header in animationInvalid header in iconInvalid header in icon (%s)JPEG quality must be a value between 0 and 100; value “%d” is not allowed.JPEG quality must be a value between 0 and 100; value “%s” could not be parsed.JPEG x-dpi must be a value between 1 and 65535; value “%s” is not allowed.JPEG y-dpi must be a value between 1 and 65535; value “%s” is not allowed.Keys for PNG text chunks must be ASCII characters.Keys for PNG text chunks must have at least 1 and at most 79 characters.LoopMalformed chunk in animationMaximum color value in PNM file is 0Maximum color value in PNM file is too largeNo XPM header foundNot all frames of the GIF image were loaded.Not enough memory to composite a frame in GIF fileNot enough memory to load GIF fileNot enough memory to load ICO fileNot enough memory to load animationNot enough memory to load bitmap imageNot enough memory to load iconNumber of ChannelsPNG compression level must be a value between 0 and 9; value “%d” is not allowed.PNG compression level must be a value between 0 and 9; value “%s” could not be parsed.PNG x-dpi must be greater than zero; value “%s” is not allowed.PNG y-dpi must be greater than zero; value “%s” is not allowed.PNM file has an image height of 0PNM file has an image width of 0PNM file has an incorrect initial bytePNM file has an invalid heightPNM file has an invalid widthPNM file is not in a recognized PNM subformatPNM image loader does not support this PNM subformatPNM loader expected to find an integer, but didn’tPixel BytesPixelsPremature end-of-file encounteredPseudocolor image does not contain a colormapQTIF atom size too large (%d byte)QTIF atom size too large (%d bytes)Raw PNM formats require exactly one whitespace before sample dataRaw PNM image type is invalidReadonly pixel dataResulting GIF image has zero sizeRowstrideStack overflowTGA image has invalid dimensionsTGA image type not supportedTGA image was truncated or incomplete.TIFF bits-per-sample doesn’t contain a supported value.TIFF compression doesn’t refer to a valid codec.TIFF x-dpi must be greater than zero; value “%s” is not allowed.TIFF y-dpi must be greater than zero; value “%s” is not allowed.The colorspace in which the samples are interpretedThe number of bits per sampleThe number of bytes between the start of a row and the start of the next rowThe number of columns of the pixbufThe number of rows of the pixbufThe number of samples per pixelThis build of gdk-pixbuf does not support saving the image format: %sTopdown BMP images cannot be compressedTransformed JPEG has zero width or height.Transformed JPEG2000 has zero width or heightTransformed PNG has unsupported number of channels, must be 3 or 4.Transformed PNG has zero width or height.Transformed PNG not RGB or RGBA.Unable to load image-loading module: %s: %sUnexpected bitdepth for colormap entriesUnexpected end of PNM image dataUnexpected icon chunk in animationUnrecognized image file formatUnsupported JPEG color space (%s)Unsupported depth for ICO file: %dUnsupported icon typeUnsupported image format for GDI+Unsupported number of color components (%d)Value for PNG text chunk %s cannot be converted to ISO-8859-1 encoding.Version %s of the GIF file format is not supportedWhether the animation should loop when it reaches the endWhether the pixbuf has an alpha channelWidthWidth or height of TIFF image is zeroXPM file has image height <= 0XPM file has image width <= 0XPM file has invalid number of colorsXPM has invalid number of chars per pixelfailed to allocate image buffer of %u bytefailed to allocate image buffer of %u bytesimage formatBMPimage formatEMFimage formatGIFimage formatJPEGimage formatJPEG 2000image formatMacOS X iconimage formatPNGimage formatPNM/PBM/PGM/PPMimage formatQuickTimeimage formatTIFFimage formatTargaimage formatWMFimage formatWindows animated cursorimage formatWindows iconimage formatXBMimage formatXPMProject-Id-Version: gdk-pixbuf master Report-Msgid-Bugs-To: https://bugzilla.gnome.org/enter_bug.cgi?product=gdk-pixbuf&keywords=I18N+L10N&component=general POT-Creation-Date: 2017-12-05 15:46+0000 PO-Revision-Date: 2017-12-15 13:39+0100 Last-Translator: Fabio Tomat Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=(n != 1); X-Generator: Poedit 2.0.3 Un pontadôr ai dâts pixel dal pixbufLa imagjin ANI e jere cjonçade o incomplete.La imagjin BMP e à dâts di intestazion pustiçsLa imagjin BMP e à une palete di colôrs masse grandeLa imagjin BMP e à une profonditât no supuartadeLa imagjin BMP e à une dimension di intestazion no supuartadeLargjece imagjin BMP masse grandeSi à incontrât un codiç no justBit par campion“Bit par canâl” de imagjin PNG nol è valit.I bit par canâl dal PNG trasformât no son 8.Impussibil assegnâ memorie pe intestazion TGAImpussibil assegnâ mape di colôrsImpussibil assegnâ memorie pe struture dal contest TGAImpussibil assegnâ memorie pal cjariament de imagjin PNMImpussibil assegnâ memorie pal cjariament de imagjin XPMImpussibil assegnâ un gnûf pixbufImpussibil lei la mape di colôrs XPMVôs tabele circolâr intal file GIFIl profîl colôr al à une lungjece %d no valide.Il profîl colôr al à la lungjece “%u” no valide.Spazi colôrLis iconis comprimudis no son supuartadisImpussibil assegnâ memorie: %sImpussibil creâ il flus: %sImpussibil decodificâ il file ICNSImpussibil otignî la altege de imagjin (file TIFF difetôs)Impussibil otignî la largjece de imagjin (file TIFF difetôs)Impussibil lei dal flus: %sImpussibil cirî il flus: %sImpussibil assegnâ memorie pal profîl colôrImpussibil assegnâ memorie pal cjariament dal file JPEGImpussibil assegnâ memorie par salvâ il file BMPImpussibil assegnâ memorie pal flusImpussibil assegnâ memorie par archiviâ in memorie temporanie i dâts imagjinImpussibil decodificâ la imagjinImpussibil cjariâ il bitmapImpussibil cjariâ il meta-fileImpussibil ricognossi il formât di imagjin pal file “%s”Impussibil salvâImpussibil scrivi sul file BMPImpussibil scrivi tal file TIFFLa ponte dal cursôr e je fûr de imagjinDimensions de imagjin TIFF masse grandisErôr tal interpretâ il file imagjin JPEG (%s)Erôr tal lei la imagjin ICNS: %sErôr tal decodificâ la mape di colôrsErôr tal scrivi tal file imagjin: %sErôr tal scrivi sul flus imagjinNo si è rivâts a assegnâ %d byte pal buffer di leture dal fileNo si è rivâts a assegnâ %d byte pal buffer di leture dal fileNo si è rivâts a assegnâ la struture dal contest QTIF.No si è rivâts a sierâ “%s” intant che si scriveve la imagjin, al pues jessi che ducj i dâts no sedin stâts salvâts: %sNo si è rivâts a creâ l'ogjet GdkPixbufLoader.No si è rivâts a cjatâ un atom di dâts imagjin.No si è rivâts a cjariâ i dâts RGB dal file TIFFNo si è rivâts a cjariâ la imagjin TIFFNo si è rivâts a cjariâ la animazion “%s”: reson no cognossude, forsit un file di animazion ruvinâtNo si è rivâts a cjariâ la imagjin “%s”: %sNo si è rivâts a vierzi la imagjin “%s”: reson no cognossude, forsit un file imagjin ruvinâtNo si è rivâts a vierzi la imagjin TIFFNo si è rivâts a vierzi il file “%s”: %sNo si è rivâts a vierzi il file temporaniNo si è rivâts a vierzi “%s” pe scriture: %sNo si è rivâts a lei la intestazion QTIFNo si è rivâts a lei dal file temporaniNo si è rivâts a salvâ la imagjin TIFFNo si è rivâts a ometi il sucessîf %d byte cun seek().No si è rivâts a ometi i sucessîfs %d byte cun seek().No si è rivâts a scrivi dâts TIFFNo si è rivâts a scrivi sul file temporani cuant che si cjariave la imagjin XBMNo si è rivâts a scrivi sul file temporani cuant che si cjariave la imagjin XPMNo si è rivâts a lei il GIF: %sErôr fatâl intal file imagjin PNG: %sErôr fatâl tal lei il file imagjin PNGErôr fatâl tal lei il file imagjin PNG: %sIl file nol semee jessi un GIFErôr di file tal lei l'atom QTIF: %sIl file GIF al mancjave di cualchi dât (forsit al jere cjonçât in cualchi maniere)La imagjin GIF no à une mape di colôrs globâl e un fotogram jenfri nol à une mape colôrs locâl.La imagjin GIF e je ruvinade (compression LZW no juste)Il modul di cjariament dai GIF nol rive a ricognossi cheste imagjin.La imagjin GIF e jere cjonçade o incomplete.Al à AlphaAlteceLa imagjin ICO e jere cjonçade o incomplete.Il file imagjin “%s” nol à dâtsFormât imagjin no cognossûtIntestazion de imagjin ruvinadeImagjin masse largje pal formât BMP.Dâts pixel de imagin ruvinâtsImagjin masse largje par jessi salvade come ICOIl gjenar di imagjin par cumò nol è supuartâtIl gjenar di imagjin “%s” nol è supuartâtIl modul pal cjariament des imagjins %s nol espuarte la interface juste; Isal forsit di une version diferente di gdk-pixbuf?Il cjariament progressîf nol è supuartât pal gjenar di imagjin “%s”Il descritôr dal file di input al è NULL.No vonde memorie par cjariâ il file PNGNo vonde memorie par cjariâ la struture dal contest PNMNo vonde memorie par cjariâ il file PNMNo vonde memorie par cjariâ il file imagjin XBMNo vonde memorie par cjariâ la imagjin, prove a sierâ cualchi aplicazion par liberâ memorieNo vonde memorie par vierzi il file JPEG2000No vonde memorie par vierzi il file TIFFNo vonde memorie par salvâ la imagjin intun bufferNo vonde memorie par salvâ la imagjin di riclamâNo vonde memorie par archiviâ une imagjin di %lu par %lu; prove siere cualchi aplicazion par liberâ memorieErôr interni tal modul di cjariament GIF (%s)Erôr interni: il modul di cjariament imagjin “%s” nol rive a completâ une operazion, ma nol à dât un motîf pal problemeFile XBM no valitIntestazion XPM no valideIntestazion no valide te animazionIntestazion inte icone no valideIntestazion inte icone no valide (%s)La cualitât di une imagjin JPEG e scugne jessi comprindude tra 0 e 100; il valôr “%d” nol è permetût.La cualitât di une imagjin JPEG e scugne jessi comprindude tra 0 e 100; il valôr “%s” nol pues jessi analizât.Il x-dpi dal JPEG al à di jessi un valôr tra 1 e 65535; il valôr “%s” nol è permetût.Il y-dpi dal JPEG al à di jessi un valôr tra 1 e 65535; il valôr “%s” nol è permetût.Lis clâfs pes porzions di test PNG a scugnin jessi caratars ASCII.Lis clâfs pes porzions di test PNG a scugnin vê almancul 1 e al massim 79 caratars.CicliPorzion malformade inte animazionIl valôr di colôr massim tal file PNM al è 0Il valôr di colôr massim tal file PNM al è masse grantNissune intestazion XPM cjatadeNo ducj i fotograms de imagjin GIF a jerin cjariâts.No vonde memorie par componi un fotogram tal file GIFNo vonde memorie par cjariâ il file GIFNo vonde memorie par cjariâ il file ICONo vonde memorie par cjariâ la animazionNo vonde memorie par cjariâ la imagjin bitmapNo vonde memorie par cjariâ la iconeNumar di canâiIl nivel di compression PNG al scugne jessi un valôr tra 0 e 9; il valôr “%d” nol è permetût.Il nivel di compression PNG al scugne jessi un valôr tra 0 e 9; il valôr “%s” nol pues jessi interpretât.Il x-dpi PNG al scugne jessi plui grant di zero; il valôr “%s” nol è permetût.Il y-dpi PNG al scugne jessi plui grant di zero; il valôr “%s” nol è permetût.Il file PNM al à une altece imagjin di 0Il file PNM al à une largjece de imagjin di 0Il file PNM al à un byte iniziâl no justIl file PNM al à une altece no valideIl file PNM al à une largjece no valideIl file PNM nol è intun sot-formât PNM ricognossûtIl modul di cjariament imagjin PNM nol supuarte chest sot-formât PNMIl modul di cjariament PNM si spietave di cjatâ un intîr, ma no lu à vûtByte pixelPixelFin dal file (eof) rivade masse adoreLa imagjin in fals colôrs no conten une mape di colôrsLa dimension dal atom QTIF e je masse largje (%d byte)La dimension dal atom QTIF e je masse largje (%d byte)I formâts PNM grês a àn bisugne di juste un spazi blanc prime dai dâts grêsIl gjenar di imagjin PNM grês nol è valitDâts in dome leture dai pixelLa imagjin GIF risultant e à dimension zeroVarc rieStack overflowLa imagjin TGA e à dimension no validisIl gjenar de imagjin TGA nol è supuartâtLa imagjin TGA e jere cjonçade o incomplete.Il bit-par-campion TIFF nol conten un valôr supuartât.La compression TIFF no fâs riferiment a un codec valit.Il x-dpi TIFF al scugne jessi plui grant di zero; il valôr “%s” nol è permetût.Il y-dpi TIFF al scugne jessi plui grant di zero; il valôr “%s” nol è permetût.Il spazi di colôr dulà che i campions a son interpretâtsIl numar di bit par campionIl numar di byte tra l'inizi di une rie e l'inizi di chê sucessiveIl numar di colonis dal pixbufIl numar di riis dal pixbufNumar di campions par pixelCheste version di gdk-pixbuf no supuarte il salvâ tal formât imagjin: %sLis imagjins BMP “topdown” no si puedin comprimiIl JPEG trasformât al à largjece o altece zero.Il JPEG2000 trasformât al à largjece o altece zeroIl PNG trasformât al à un numar di canâi no supuartât, al scugne jessi 3 o 4.Il PNG trasformât al à largjece o altece zero.Il PNG trasformât nol è RGB o RGBA.Impussibil vierzi il modul pal cjariament des imagjins: %s: %sProfonditât di colôr inspietade pai elements de mape di colôrsFin inspietade dai dâts imagjin PNMPorzion di icone no spietade inte animazionFormât dal file di imagjin no ricognossûtSpazi colôr JPEG no supuartât (%s)Profonditât no supuartade pal file ICO: %dGjenar di icone no supuartâtFormât imagjin no supuartât par GDI+Numar di components colôr (%d) no supuartâtIl valôr pe porzion di test PNG %s nol pues jessi convertît ae codifiche ISO-8859-1.La version %s dal formât file GIF no je supuartadeIndiche se la animazion e à di tornâ a tacâ dal inizi cuant che e rive ae finIndiche se il pixbuf al à un canâl alphaLargjeceLargjece o altece de imagjin TIFF e je zeroIl file XPM al à altece imagjin <= 0Il file XPM al à largjece di imagjin <= 0Il file XPM al à un numar di colôrs no valitXPM al à un numar di caratars par pixel no valitno si è rivât a assegnâ %u byte pal buffer de imagjinno si è rivât a assegnâ %u byte pal buffer de imagjinBMPEMFGIFJPEGJPEG 2000Icone MacOS XPNGPNM/PBM/PGM/PPMQuickTimeTIFFTargaWMFCursôr animât WindowsIcone WindowsXBMXPMPKx{0](@NLC_MESSAGES/libdnf.monu[,,(+:(c ;84Gg'83F:D"(KG^'#%3I}     does not belong to a distupgrade repository'%s' is not an allowed valueCannot find a valid baseurl for repo: %sRepository %s has no mirror or baseurl set.Repository '%s' has unsupported type: 'type=%s', skipping.given path '%s' does not exist.given path '%s' is not absolute.given value [%d] should be greater than allowed value [%d].given value [%d] should be less than allowed value [%d].invalid boolean value '%s'no value specifiedpercentage '%s' is out of rangerepo %s: 0x%s already importedrepo %s: imported key 0x%s.seconds value '%s' must not be negativeunknown unit '%s'Project-Id-Version: PACKAGE VERSION Report-Msgid-Bugs-To: POT-Creation-Date: 2023-02-28 09:11+0100 PO-Revision-Date: 2020-09-25 13:29+0000 Last-Translator: Fabio Tomat Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=n != 1; X-Generator: Weblate 4.2.2 nol aparten a un dipuesit di avanzament di distribuzion'%s' nol è un valôr permetûtImpussibil cjatâ un url di base valit pal repo: %sIl dipuesit %s nol à stabilît nissun servidôr-spieli o url di base.Il dipuesit '%s' al à un gjenar no supuartât: 'type=%s', si salte.il percors furnît '%s' nol esist.il percors furnît '%s' nol è assolût.il valôr furnît [%d] al à di jessi plui grant dal valôr permetût [%d].il valôr furnît [%d] al à di jessi minôr dal valôr permetût [%d].valôr boolean '%s' no valitnissun valôr specificâtla percentuâl '%s' e je fûr di scjaledipuesit %s: 0x%s za impuartâtdipuesit %s: clâf 0x%s impuartade.il valôr dai seconts '%s' nol à di jessi negatîfunitât '%s' no cognossudePKx{0]IQQLC_MESSAGES/dnf-plugins-core.monu[ Ncv&o*+Jv+M:5pIIKKk&: E%]61!1$S2x/&_0b $.-16h9 :%B`"  %)1[p$(E^}475Kai%.--Hb{2/!E g  ) I g  ! # ( h!2z!2!!N!/M"-}""-""#%#,;#Fh#C# #$8$P$Bh$!$$$$5%/F%/v%&%%&%$&'4&)\&&5&>&'1'5L''4'2'((((#0(KT((,(("(, )JM)))(),)/*ZM*2*m*)I+)s+E+^+4B,&w,X,,,,.000E0K0$_000X1m11#1%1 1 2 .2EO242)22 3-43ob3G3(4GC4G4I4I5g5>|5(5=5"6"B6Pe666<6)77B7<z7B7>7898sr838 9&;95b90989%:"(:FK::#:7:S:PS;(;";;(<,<D<.W<3<<<<& =,1=.^==="==(=(>>>7T>A>9>??%?%D?j?/}?,?,?@$@A@OI@2@!@@A7A#NA rAA!A.ABB">B-aB%B"B$B!B,C<LCsC,C,*D$WDV|D.D1E#4E6XE&EEE8ET#FOxFFF>F!+GHMG#G&G+G7 HEEH@H-HH3I/JI&zI(II@I?(J&hJJ<JJ>K>DKKKKK'K_K&LL5sLL3L3L['M*MM.M8M-.N\NON3O3O1OK,PixP@P)#QkMQQQc)Y2 %<RQgL 3D\6Cf$xEFj,pP|d1zH4IW(eO*Uy{n&kMwBG h^r>q}7XK5a+J9;#v [So08/:b'Tuml-sZ A]!_.t ?"~=`iVN@ enable name/project [chroot] disable name/project remove name/project list --installed/enabled/disabled list --available-by-user=NAME search project Examples: copr enable rhscl/perl516 epel-6-x86_64 copr enable ignatenkobrain/ocltoys copr disable rhscl/perl516 copr remove rhscl/perl516 copr list --enabled copr list --available-by-user=ignatenkobrain copr search tests Downgraded packages Modified packages Summary Upgraded packages'%s' is not of the format 'MACRO EXPR''{}' is not a directory* These coprs have repo file with an old format that contains no information about Copr hub - the default one was assumed. Re-enable the project to fix this.Added package : {}Added packages: {}Adding exclude on:Adding repo from: %sAdding versionlock on:Bad Action Line "%s": %sBad Transaction State: %sBad dnf debug file: %sBoth old and new repositories must be set.Can't parse repositories for username '{}'.Can't parse search for '{}'.Can't write file '{}'Changelogs for {}Check only the newest packages in the reposCompare packages also by arch. By default packages are compared just by name.Configuration of repo failedConfiguration of repos failedCopying '{}' to local repoCould not find debuginfo package for the following available packages: %sCould not find debuginfo package for the following installed packages: %sCould not find debugsource package for the following available packages: %sCould not find debugsource package for the following installed packages: %sCould not open {}Could not save repo to repofile %s: %sDeleting versionlock for:Display a list of unresolved dependencies for repositoriesDowngraded packages: {}Download package to current directoryDownload target '{}' is outside of download path '{}'.Error in resolve of packages:Error: Excludes from versionlock plugin were not appliedExiting due to strict setting.Failed to disable copr repo {}/{}Failed to get mirror for package: %sFailed to open: '%s', not a valid source rpm file.Failed to open: '%s', not a valid spec file: %sFailed to remove copr repo {0}/{1}/{2}Ignore architecture and install missing packages matching the name, epoch, version and release.Install the latest version of recorded packages.Interact with Copr repositories.Interact with Playground repository.List all installed Copr repositories (default)List available Copr repositories by user NAMEList differences between two sets of repositoriesList disabled Copr repositoriesList enabled Copr repositoriesList installed packages not required by any other packageList of {} coprsListing all changelogsListing changelogs since {}Listing only latest changelogListing {} latest changelogsListing only new changelogs since installed version of the packageLocklist not setManage a directory of rpm packagesMatched: {}Migrating history data...Modified packages: {}More information:New leaves:Newest N packages to keep - defaults to 1No description givenNo description given.No files to processNo match for argument: %sNo matching package to install: '%s'No matching repo to modify: %s.No package %s available.No package found for:No source rpm defined for %sNot a valid date: "{0}".Not all dependencies satisfiedNothing provides: '%s'Obsoleted by : {}Output a full package dependency graph in dot formatOutput a simple one line message for modified packages.Output additional data about the size of the changes.Output written to: %sPACKAGEPackage %s is not availablePass either --old or --new, not both!Path to directoryPlayground repositories successfully disabled.Playground repositories successfully enabled.Playground repositories successfully updated.Print the newest packagesPrint the older packagesRPM: {}Reboot is required to fully utilize these updates.Reboot should not be necessary.Rebuilding local repoRemoved package: {}Removed packages: {}Repoclosure ended with unresolved dependencies.Repository successfully disabled.Repository successfully enabled.Repository successfully removed.Safe and good answer. Exiting.Show changelog data of packagesSize change: {}Size change: {} bytesSize of added packages: {}Size of downgraded packages: {}Size of modified packages: {}Size of removed packages: {}Size of upgraded packages: {}Some packages could not be found.Space separated output, not newlineSpecify an instance of Copr to work withSpecify architectures to compare, can be used multiple times. By default, only source rpms are compared.Specify new repository, can be used multiple timesSpecify old repository, can be used multiple timesSpecify repositories to checkSplit the data for modified packages between upgraded and downgraded packages.This command has to be run under the root user.Unable to create a directory '{}' due to '{}'Unable to find a matchUnable to read version lock configuration: %sUnknown response from server.Unknown subcommand {}.Upgraded packages: {}Versionlock plugin: could not parse pattern:Versionlock plugin: number of exclude rules from file "{}" applied: {}Versionlock plugin: number of lock rules from file "{}" applied: {}[DELETED] %s[PACKAGE|PACKAGE.spec]add (and enable) the repo from the specified file or urlbad copr project formatcheck packages of the given archs, can be specified multiple timescomps.xml for repository %s savedcontrol package version locksdefine a macro for spec file parsingdelete local packages no longer present in repositorydetermine updated binaries that need restartingdo not attempt to dump the repository contents.download all packages from remote repodownload all the metadata.download only newest packages per-repodownload only packages for this ARCHdownload the -debuginfo package insteaddownload the -debugsource package insteaddownload the src.rpm insteaddump information about installed rpm packages to fileexactly two additional parameters to copr command are requiredfailed to delete file %sinstall debuginfo packageslimit the query to packages of given architectures.limit to specified typemanage {prog} configuration options and repositoriesmigrate yum's history, group and yumdb data to dnfnname of dump filenono package matched: %sonly consider this user's processesonly report whether a reboot is required (exit code 1) or not (exit code 0)optional name of dump fileoutput commands that would be run to stdout.packages to downloadpackages with builddeps to installprint current configuration values to stdoutprint list of urls where the rpms can be downloaded instead of downloadingprint variable values to stdoutrepo to modifyresolve and download needed dependenciesrestore packages recorded in debug-dump filesave the current options (useful with --setopt)show changelog entries since DATE. To avoid ambiguosity, YYYY-MM-DD format is recommended.show given number of changelog entries per packageshow only new changelog entries for packages, that provide an upgrade for some of already installed packages.treat commandline arguments as source rpmtreat commandline arguments as spec filesuse format `copr_username/copr_projectname` to reference copr projectwhen running with --resolve, download all dependencies (do not exclude already installed ones)when running with --url, limit to specific protocolswhere to store downloaded repositorieswhere to store downloaded repository metadata. Defaults to the value of --download-path.yyesProject-Id-Version: PACKAGE VERSION Report-Msgid-Bugs-To: POT-Creation-Date: 2023-02-28 12:21+0100 PO-Revision-Date: 2019-11-27 09:17+0000 Last-Translator: Fabio Tomat Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit Plural-Forms: nplurals=2; plural=(n != 1) X-Generator: Zanata 4.6.2 enable non/progjet [chroot] disable non/progjet remove non/progjet list --installed/enabled/disabled list --available-by-user=NON search progjet Esemplis: copr enable rhscl/perl516 epel-6-x86_64 copr enable ignatenkobrain/ocltoys copr disable rhscl/perl516 copr remove rhscl/perl516 copr list --enabled copr list --available-by-user=ignatenkobrain copr search tests Pachets cessâts di version Pachets modificâts Sunt Pachets inzornâts'%s' nol è tal formât 'MACRO EXPR''{}' no je une cartele* Chescj copr a àn un file repo cuntun formât vecjo che nol conten infomazions sul hub Copr - si à considerât chel predefinît. Tornâ a abilitâ il progjet par comedâ chest probleme.Pachet zontât : {}Pachets zontâts: {}Daûr a zontâ la esculsion su:Daûr a zontâ il repository di: %sDaûr a zontâ il bloc de version su:Linie di azion "%s" sbaliade: %sStât de transazion sbaliât: %sFile di debug di dnf no just: %sSi àn di indicâ ducj i doi i repository, chei vielis e chei gnûfs.Impussibil analizâ i repository pal non utent '{}'.Impussibil analizâ la ricercje par '{}'.Impussibil scrivi il file '{}'Regjistris des modifichis par {}Controle dome i gnûfs pachets tai repositoryParagone i pachets ancje par architeture. Te impostazion predefinide i pachets a son confrontâts dome par non.Configurazion dal repository falideConfigurazion dai repository faildeDaûr a copiâ '{}' al repository locâlImpussibil cjatâ il pachet debuginfo par chescj pachets disponibii: %sImpussibil cjatâ il pachet debuginfo par chescj pachets instalâts: %sImpussibil cjatâ il pachet debugsource par chescj pachets disponibii: %sImpussibil cjatâ il pachet debugsource par chescj pachets instalâts: %sImpussibil vierzi {}Impussibil salvâ il repository sul file dai repository %s: %sDaûr a eliminâ il bloc de version par:Mostre une liste des dipendencis no risolvudis pai repositoryPachets cessâts di version: {}Discjarie pachet te cartele atuâlLa destinazion di discjariament '{}' e je fûr dal percors di discjariament '{}'Erôr tal risolvi i pachets:Erôr: No si aplicarin lis esclusions dal plugin di bloc de versionSi jes par vie des impostazions fiscâls.No si è rivâts a disabilitâ il repository copr {}/{}No si è rivâts a otignî il spieli (mirror) pal pachet: %sNo si è rivâts a vierzi: '%s', nol è un file rpm sorzint valit.No si è rivâts a vierzi: '%s', nol è un file spec valit: %sNo si è rivâts a gjavâ il repository copr {0}/{1}/{2}Ignore la architeture e instale i pachets che a mancjin e che a corispuindin cul non, epoch, version e publicazion.Instale la ultime version dai pachets regjistrâts.Interagjìs cui repository Copr.Interagjìs cul repository Playground.Liste ducj i repository Copr instalâts (predefinît)Liste i repository Copr disponibii par NON utentListe lis diferencis tra dôs cumbinazions di repositoryListe i repository Copr disabilitâtsListe i repository Copr abilitâtsListe i pachets instalâts che no son necessaris a nissun altri pachetListe di {} coprDaûr a listâ dutis lis modifichisDaûr a listâ i regjistris des modifichis tacant di {}Daûr a listâ dome lis ultimis modifichisDaûr a listâ lis ultimis {} modifichisDaûr a listâ dome lis gnovis modifichis tacant de version instalade dal pachetNo je stade stabilide la liste dai blocsGjestìs un cartele di pachets rpmCorispondencis: {}Daûr a migrâ i dâts de cronologjie...Pachets modificâts: {}Plui informazions:Gnûfs pachets che di chei no dipendin altris:I N plui gnûfs pachets di tignî - predefinît a 1Nissune descrizione furnideNissune descrizion furnide.Nissun file di elaborâNissune corispondence pal argoment: %sNissun pachet corispondent di instalâ: '%s'Nissun reposiory corispondent di modificâ: %sNissun pachet %s disponibil.Nissun pachet cjatât par:Nissun rpm sorzint definît par %sDate no valide: "{0}".No son sodisfatis dutis lis dipendencis.Nuie al furnìs: '%s'Rimplaçât di : {}Mostre un grafic complet des dipendencis in formât dotMostre un messaç sempliç di une rie par ogni pachet modificât.Mostre i dâts adizionâi su la dimension des modifichis.Jessude scrite su: %sPACHETIl pachet %s nol è disponibilPasse o --old o --new, no ducj i doi!Percors ae carteleRepository Playground disabilitâts cun sucès.Repository Playground abilitâts cun sucès.Repository Playground inzornâts cun sucès.Stampe i pachets plui gnûfsStampe i pachets plui vecjosRPM: {}Al covente tornâ a inviâ il sisteme par utilizâ dal dut chescj inzornaments.Nol varès di coventâ tornâ a inviâ il sisteme.Ricostruzion al repository locâlPachet gjavât: {}Pachets gjavâts: {}Repoclosure al à finît cun dipendencis no risolvudis.Repository disabilitât cun sucès.Repository abilitât cun sucès.Repository gjavât cun sucès.Rispueste buine e sigure. Si jes.Mostre il regjistri des modifichis dai pachetsVariazion de dimension: {}Variazion di dimension: {} byteDimension dai pachets zontâts: {}Dimension dai pachets cessâts di version: {}Dimension dai pachets modificâts: {}Dimension dai pachets gjavâts: {}Dimension dai pachets inzornâts: {}Impussibil cjatâ cualchi pachet.Jessude separade di spazis no di riis gnovisSpecifiche une istance di Copr che cun chê si à di lavorâArchiteturis a comparâ, si pues doprâ plui voltis. Impostazion predefinide: dome i rpms sorzint a son comparâts.Gnûf repository, si pues doprâ plui voltisRepository vecjo, si pues doprâ plui voltisSpecifiche i repository di controlâDivît i dâts dai pachets modificâts tra chei inzornâts e chei cessâts di version.Si à di eseguî chest comant come utent root.Impussibil creâ une cartele '{}' par vie di '{}'Impussibil cjatâ une corispondenceImpussibil lei la configurazion di bloc de version: %sRispueste no cognossude dal servidôr.Sot-comant {} no cognossût.Pachets inzornâts: {}Plugin di bloc de version: impussibil analizâ il model:Plugin di bloc de version: numar di regulis di esclusion aplicadis dal file "{}": {}Plugin di bloc de version: numar di regulis di bloc aplicadis dal file "{}": {}[ELIMINÂT] %s[PACHET|PACHET.spec]zonte (e abilite) il repository dal url o dal file specificâtformât dal progjet copr sbaliâtcontrole pachets de architeture indicade, si pues specificâ plui voltissalvât comps.xml pal repository %scontrole i blocs de version dal pachetdefinìs une macro pe analisi dal file specelimine i pachets locâi che no son plui tal repositorydetermine i binaris inzornâts che a àn bisugne di tornâ a inviâsino sta cirî di butâ jù dal grum i contignûts dal repository.discjarie ducj i pachets dal repository rimotdiscjarie ducj i metadâts.discjarie dome i pachets plui gnûfs par repositorydiscjarie dome i pachets par cheste ARCHITETUREdiscjarie invezit il pachet -debuginfodiscjarie invezit il pachet -debugsourcediscjarie invezit il src.rpmingrume jù sul file lis informazions sui pachets rpm instalâtsa son necessaris juste doi parametris adizionâi al comant coprno si è rivâts a eliminâ il file %sinstale i pachets debuginfolimite la interogazion ai pachets de architeture indicade.limite al gjenar specificâtgjestìs lis opzions di configurazion di {prog} e i repositorymigre la cronologjie di yum, i grups e i dâts di yumdb su dnfnnon dal file dal grum (dump)nonissun pachet corispondent: %sconsidere dome i procès di chest utentsegnale dome se al covente tornâ a inviâ (codiç di jessude 1) o mancul (codiç di jessude 0)non opzionâl dal file dal grum (dump)mostre i comants che a vignaran eseguîts sul stdout.pachets di discjariâi pachets cun dipendencis di costruzion di instalâstampe i valôrs de configurazion atuâl sul stdoutstampe la liste dai url dulà che i rpms a puedin jessi discjariâts, invezit di discjariâstampe i valôrs des variabilis sul stdoutrepository di modificârisolf e discjarie lis dipendencis necessariisripristine i pachets regjistrâts tal file di debug-grumsalve lis opzions atuâls (util cun --setopt)mostre lis vôs dal regjistri des modifichis partint de DATE. Par evitâ malintindiments si racomande di doprâ il formât AAAA-MM-DD.mostre, par ogni pachet, il numar indicât di vôs dal regjistri des modifichismostre dome lis gnovis vôs dal regjistri des modifichis par ogni pachet, che a furnissin un inzornament par cualchidun dai pachets za instalâts.dopre i argoments de rie di comant come rpm sorzintdopre i argoments de rie di comant come file specdopre il formât `nonutent_copr/progjet_copr` par riferîsi al progjet coprcuant che si eseguìs cun --resolve, discjarie dutis lis dipendencis (no sta escludi chês za instaladis)cuant che si eseguìs cun --url, limite ai protocoi specificâtsdulà archiviâ i repository discjariâtsdulà archiviâ i metadâts dai repository discjariâts. Il predefinît al è il valôr di --download-path.ssìPKx{0]/LC_MESSAGES/libidn2.monu[!$/, RNI&O #!A*c&&(  ,(:'c44&//L7|-%%".Q.g#'  TZ - a ? #S (w = - ' -4 b0499A,{22@*O-z0,7%(]0     !Charset: %s Command line interface to the Libidn2 implementation of IDNA2008. All strings are expected to be encoded in the locale charset. To process a string that starts with `-', for example `-foo', use `--' to signal the end of parameters, as in `idn2 --quiet -- -foo'. Mandatory arguments to long options are mandatory for short options too. Internationalized Domain Name (IDNA2008) convert STRINGS, or standard input. Try `%s --help' for more information. Type each input string on a line by itself, terminated by a newline character. Unknown errorUsage: %s [OPTION]... [STRINGS]... could not convert string to UTF-8could not determine locale encoding formatdomain label longer than 63 charactersdomain name longer than 255 charactersinput A-label and U-label does not matchinput A-label is not validinput errorout of memorypunycode conversion resulted in overflowpunycode encoded data will be too largestring contains a context-j character with null rulestring contains a context-o character with null rulestring contains a disallowed characterstring contains a forbidden context-j characterstring contains a forbidden context-o characterstring contains a forbidden leading combining characterstring contains forbidden two hyphens patternstring contains invalid punycode datastring contains unassigned code pointstring could not be NFC normalizedstring encoding errorstring has forbidden bi-directional propertiesstring is not in Unicode NFC formatstring start/ends with forbidden hyphensuccessProject-Id-Version: libidn2 2.0.4 Report-Msgid-Bugs-To: bug-libidn2@gnu.org PO-Revision-Date: 2018-03-21 12:24+0100 Last-Translator: Fabio Tomat Language-Team: Friulian Language: fur MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 8bit X-Bugs: Report translation errors to the Language-Team address. X-Generator: Poedit 2.0.6 Plural-Forms: nplurals=2; plural=(n != 1); Cumbinazion caratars: %s Interface a rie di comant ae implementazion Libidn2 di IDNA2008. Dutis lis stringhis si spiete che a sedin codificadis inte cumbinazion di caratars de localizazion. Par elaborâ une stringhe che e tache cun `-', par esempli `-foo', dopre `--' par segnalâ la fine dai parametris, come in `idn2 --quiet -- -foo'. I argoments obligatoris a opzions lungjis a son obligatoris ancje pes opzions curtis. Conversion Non Domini Internazionalizât (IDNA2008) di STRINGHIS o standard-input. Prove `%s --help' par vê plui informazions. Scrîf ogni stringhe di jentrade suntune rie par so cont, terminade cuntun caratar di rie gnove. Erôr no cognossûtÛs: %s [OPZION]... [STRINGHIS]... impussibil convertî la stringhe a UTF-8impussibil determinâ il formât de codifiche de localizazionetichete di domini plui lungje di 63 caratarsnon di domini plui lunc di 255 caratarsla jentrade A-laber e U-label no corispuindinla jentrade A-label no je valideerôr jentradememorie finidela conversion punycode e à stranfât (overflow)i dâts codificâts in punycode a saran masse grancjla stringhe e conten un caratar context-j cun regule nulela stringhe e conten un caratar context-o cun regule nulela stringhe e conten un caratar no permetûtla stringhe e conten un caratar context-j proibîtla stringhe e conten un caratar context-o proibîtla stringhe e conten un caratar di cumbinazion iniziâl proibîtla stringhe e conten doi tratuts proibîtsla stringhe e conten dâts punycode no valitsla stringhe e conten un pont codiç no assegnâtla stringhe no pues jessi normalizade in NFCerôr di codifiche de stringhela stringhe e à proprietâts bi-direzionâls proibidisla stringhe no je in formât NFC Unicodela stringhe e tache/finìs cun tratuts proibîtssucèsPKx{0]qxƳGGLC_MESSAGES/sudo.monu[PKx{0] D55GLC_MESSAGES/sysstat.monu[PKx{0]/'o}LC_MESSAGES/plymouth.monu[PKx{0]^|qqLC_MESSAGES/dnf.monu[PKx{0]٦ܻLC_MESSAGES/p11-kit.monu[PKx{0]2 2 LC_MESSAGES/iso_3166-1.monu[PKx{0]sœ**3LC_MESSAGES/chkconfig.monu[PKx{0]LC_MESSAGES/glib20.monu[PKx{0]EN^'6'6kLC_MESSAGES/xkeyboard-config.monu[PKx{0]p rrLC_MESSAGES/libpwquality.monu[PKx{0]3Y((LC_MESSAGES/atk10.monu[PKx{0] < % %LC_MESSAGES/sudoers.monu[PKx{0]>LC_MESSAGES/libsecret.monu[PKx{0]B^\\=DLC_MESSAGES/gdk-pixbuf.monu[PKx{0](@NLC_MESSAGES/libdnf.monu[PKx{0]IQQLC_MESSAGES/dnf-plugins-core.monu[PKx{0]/LC_MESSAGES/libidn2.monu[PK