�ɲɾ�����ӯ�����һ��ˣ��������С���˴��ͣ�������P���ҹ��ñ˽��ά�Բ��������˸߸ԣ�������ơ��ҹ��ñ�����ά�Բ���ˡ���˳^�ӣ������ӡ� ���ͯj�ӣ��ƺ���ӣ� ? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!? PNG ?%k25u25%fgd5n!usr/sbin/rdma000075500000566610152525014170007201 0ustar00ELF>Y@@8 @@@@hhWW ]]"]"k@ ""@@ DDStd PtdQtdRtd]]"]"P2P2/lib64/ld-linux-x86-64.so.2GNUGNUGNU~_j=/nag%h-SgM! (BE |qX92xj (iQ Tt= $R2j|Kbl9 L>[[LAe%+ Xd- |pfo;4+/z'NTne>8tn< vM"E9\@"@"7X"#@"!`"EH"P"libselinux.so.1_ITM_deregisterTMCloneTable__gmon_start___ITM_registerTMCloneTablelibbpf.so.0libelf.so.1libmnl.so.0mnl_attr_nest_endmnl_attr_parse_nestedmnl_attr_type_validmnl_cb_runmnl_attr_get_strmnl_attr_get_u64mnl_attr_get_payloadmnl_socket_closemnl_attr_nextmnl_attr_get_u8mnl_socket_recvfrommnl_socket_get_portidmnl_nlmsg_put_headermnl_attr_put_u8mnl_attr_get_payload_lenmnl_attr_parsemnl_attr_okmnl_attr_put_u32mnl_attr_nest_startmnl_attr_get_u32mnl_socket_sendtomnl_attr_get_typemnl_attr_validatemnl_attr_put_strzlibcap.so.2cap_get_proccap_get_flagcap_clearcap_set_proccap_freemnl_nlmsg_get_payloadmnl_nlmsg_get_payload_lenmnl_attr_get_u16mnl_socket_openmnl_socket_setsockoptmnl_socket_bindmnl_nlmsg_put_extra_headermnl_cb_run2libc.so.6socketfflushstrcpy__printf_chkexitstrncmpoptindstrrchrperrorclosedirftellinet_ntopstrncpy__stack_chk_failputcharmkdirreallocstdinstrtollname_to_handle_atstrpbrkstrspnstrdupinet_ptonstrftime__assert_failstrtodstrtokstrtolisattyfeofstrchrnulfgetscallocstrlensendmemsetstrstrstrcspn__errno_locationmemcmpasctime__fprintf_chkopen_by_handle_atstdoutgethostbyaddrfputcrecvstrtok_rmemcpyfreopen64fclosestrtoulmallocstrcatstrcasecmpopendir__ctype_b_locgetenvsscanfoptargstderr__snprintf_chkoptopt__memset_chkgetuidreadlinkfscanfgetopt_long__strncat_chkif_nametoindexsendmsgstrtoullfilenosethostent__getdelimif_indextonamefwritefreadgettimeofdaygeteuid__memcpy_chk__fread_chklocaltimestrchrgetsockname__vfprintf_chkreaddir64__ctype_tolower_loc__cxa_finalize__sprintf_chkmountfopen64__strcat_chkstrcmprecvmsgstrerror__asprintf_chk__libc_start_mainferrorbasenamesnprintfsysconf_edata__bss_startLIBMNL_1.0GLIBC_2.3GLIBC_2.7GLIBC_2.8GLIBC_2.4GLIBC_2.14GLIBC_2.2.5GLIBC_2.3.4 n `/5 ii ii ii ii %ui 0ti <]"Z]"pZ]"]"]"^"9 ^"@^"`^"^"^"^"_"_"_"_" _"@_"H_"P_"X_"$`_".h_"<p_"x_"L_"^_"l_"v_"_"_"_"_"_"_"_"_"_"_"_"`",`"?`"J`"V(`"d0`"z8`"@`"H`"P`"X`"``"h`"p`"x`"`"`"`"`"`"`"`"`"`"`"5`"`"`"`" a"+a"6a"?a" a"K(a"a0a"l8a"|@a"Ha"Pa"Xa"`a"ha"pa"xa"a"a"a"a"a"a"+a":a"Ca"Ra"Va"\a"Ba"da"ja"ra"b"b"b"b" b"R(b"0b"8b"d@b"Hb"`b" hb"pb"xb"b"b"b""b"b"0b";b"Cb"b"Kb"Ob"c"Tc"X c"\f"f"Kf"aj"bj"\j"fj"Kk"kk"r k"0k"y@k"Pk"Tn"bn"\n"n"o"o" o"0o"K@o"Po"`o"po"o"r"r"r"r"Ks"Xs"av"v"v"tv"w"Kw" w"Tz"z"z"Kz"a{"T{"a~"~"~"~"~"~"~"~"""#" "+ "6("=0"L@"H"P"X"`"h"p""W""d""""\"K""Ѓ"K""""  "("@"H"P")X"E`")"_"e"k"q"w"}"""Ȉ"Ј"؈""""Z" "("0"8"i@"'H"/P"5X":`"Bh"Hp"Nx"X"b"f"l"s"z"""Ȑ" " "("`@"(""0"`"8"@"H"h""`""""b"""""""""""""""  " 0""p"#x"'","1"5""""""ȏ"Џ";؏"K"""@"`"H"P"X"X"`"h"p"x""""" " " " " "ȋ"Ћ"؋""""""""" "("0"8"@" H"!P""X"#`"$h"%p"&x"'"(")"*"+","-"."/"0Ȍ"1Ќ"2،"3"4"5"6"7"8"9":"< "=(">0"?8"@@"AH"BP"CX"D`"Eh"Fp"Gx"H"I"J"L"M"N"O"P"Q"Rȍ"SЍ"T؍"U"V"W"X"Y"Z"["\"] "^("_0"`8"a@"bH"cP"dX"e`"fh"gp"hx"i"j"k"l"m"n"o"p"q"rȎ"sЎ"t؎"u"v"w"x"y"z"{"|"} "~("0"8"@"H"P"X"`"h"p"x""""""""HHJ"HtH52F"%3F"hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1%m="D%e="D%]="D%U="D%M="D%E="D%=="D%5="D%-="D%%="D%="D%="D% ="D%="D%<"D%<"D%<"D%<"D%<"D%<"D%<"D%<"D%<"D%<"D%<"D%<"D%<"D%<"D%<"D%<"D%}<"D%u<"D%m<"D%e<"D%]<"D%U<"D%M<"D%E<"D%=<"D%5<"D%-<"D%%<"D%<"D%<"D% <"D%<"D%;"D%;"D%;"D%;"D%;"D%;"D%;"D%;"D%;"D%;"D%;"D%;"D%;"D%;"D%;"D%;"D%};"D%u;"D%m;"D%e;"D%];"D%U;"D%M;"D%E;"D%=;"D%5;"D%-;"D%%;"D%;"D%;"D% ;"D%;"D%:"D%:"D%:"D%:"D%:"D%:"D%:"D%:"D%:"D%:"D%:"D%:"D%:"D%:"D%:"D%:"D%}:"D%u:"D%m:"D%e:"D%]:"D%U:"D%M:"D%E:"D%=:"D%5:"D%-:"D%%:"D%:"D%:"D% :"D%:"D%9"D%9"D%9"D%9"D%9"D%9"D%9"D%9"D%9"D%9"D%9"D%9"D%9"D%9"D%9"D%9"D%}9"D%u9"D%m9"D%e9"D%]9"D%U9"D%M9"D%E9"D%=9"D%59"D%-9"D%%9"D%9"D%9"DAWL= nAVE1AUATUSHHdH%(H$1Ld$ LHH>AD$ D$ID$ H$D$ E1H "HމH^mE:8IcL>D$"D$ H=q"ML1Hk1H$dH3%((Hĸ[]A\A]A^A_D$ XEDt$ EHq"H$5H mL1H5gl1뉋 Xq"H=Yq"H l1_H 5q"H=5lOMLH=p"Hj1?Ap"T$8Ll$0D|$D$ D$ A AA D$ D$x!"D$|DA ID$ HD$@HD$HID$hD|$8H$H$ H=AHD$hHt&HT$L]LAŅtL 1E,L$H5 LL#AŅuH<$Ht+t$ LHdA묿PH_HcD$ LH)3Af1I^HHPTLiH hH=5"H=9o"H2o"H9tH5"Ht H= o"H5o"H)HHH?HHtH5"HtfD=n"u+UH=b5"Ht H=."ydn"]wHHOH=mn"1HLhI1HHIdH%(H$1HA0HIPHߎHHH iLHD$HD$HrHD$ H HL$HD$(HHD$0H|*HD$8HhHD$@HT<HD$HHhHD$PH cHD$XHhHD$`HHD$h H$dH3%(uHĘf.HHf.fDATI_USHxx2HwHHk4Hx I[]A\fDftHGHfD1DATUHSHHII9wLHH[]A\[]A\ff.t HGff.@t&HHGH5]hH8HH@1ff.fHGhHhH9u5DHH9t(@ tSHxH 1[D1DAWAVAUATUSHXHt$dH %(HL$H1H IyHD$$E1HHD$HD$;HD$ HD$0HD$(@ID$(Nl0J,0D$GH12345678HD$;D$C90,-'HHL|$@HtdIL9|$tI7HuH=j"H1H)hHLHL$HdH3 %(HX[]A\A]A^A_@AGt%Ht$ LLHD$H9D$ HLHCHD$HT$HHCHH8Ht$( HIAGt AEE1DLIHUHEHkHI9rID$pIT$hI\$pIHHC$H$A;$G1@HH$ H$HHfDLD$ H1H=i"HsfFHm@HD$08K H h"$H=f+HGH=h"HeH1fAWAVIAUATLghUSH(H_hdH%(HD$1HAI9uDHL9|HkH{LHl$guHD$1E1E1HD$D}Et6IHDHu[A-EDDHHl$D}Euʸ f1HT$dH3%(|H([]A\A]A^A_Ht$ HAA9tE9!A9 uHl$RfI9ufHL9tH{L|upfAVIAUIATUSH_hHohHH9uHmH9H}LuH}:IHH5bHHHt@H-bHLII9uLH}tqH1HHuǻE11L[]A\A]A^H9t_IfDM$$I9@I|$LVu*D1@8H e"H=cI1wfATI`USHx4HH5dH,xA,$[]A\[]A\fDATI`H UH1SHdH%(H$1HHLHiH|$HH|$H|$tg" I HHteLPHCHtHE(H](H H+H|$HCHWH|$CJC"H d"'H=hbH$dH3%(u"H[]A\H@HAVAUATUSHHHLs Hk LeML9t/HEH}ID$L HLM$$ML9uHkhHhLeMH9t=HEH}ID$L [H}RHLGM$$MH9u[]A\A]A^fff.@AWAVAUATUSHtYIHoL5gL=5LLut&A]Imt&LeLHLOuA]ImtH1[]A\A]A^A_fDH b"H= _H[]A\A]A^A_AWAVAUATUSHD'EtfL~LwHvIHIHubf.II7HtLHuAIIGHDeLuH[]A\A]A^A_HFH[]A\A]A^A_@H=b"IL1HZ^(H1[]A\A]A^A_AUAATI1UHSfHI|$HEUID$@fXPfDhH[]A\A]ff.@USHHiUHC8HtNHs@HNjŅx 1H[]ÐH=)a"1HY_TH{8;H[]ú#H `"H=_ff.UHAWAVIAUIATASHH(dH%(HE1& H=HBHHH%H)HHH9tHH$H9uI H= HH{8MMLD)Ux%H]dH3%(u\He[A\A]A^A_]{`uH=M\E+EfDFH)fDH)HLUDUSHH tH[]ÐHHHH5 []fDATUS1ۅtPHGHH8IĄuHH] H H9uYfHH9tHHsL|uLH[]A\/HHtf1ff.AWAVAUAATIUHSHX Eu~L} Lu EM9teAGDE0AGD9w=DAG9s*]4HAԅt$$H[]A\A]A^A_M?M9u1@HED}AHEEHEH8/HP-T$H$Ht$H $HHDpEHS1D}Et AHED}Cu4E09r(;E/E4KQE49HAԅtHAEu-S11Hy H $t\HtS9sHH \"H=HY|EuHtϋSA1-1E1QE1@AUATIUHSHXMuUH] Lm L9u>fDHL9t0CHE0AԅtD$ D$ H[]A\A]1@1HHt Ut HEU@HE0A멋UtHEHH=["H1HFXt@tHH ["H=XHDHsE11ҾH ҀH@HE11ҾH WHt@GuDATUSHH}HH5H t7EH-VrLdDH1ҾHDL9u[H5DW]A\:f.AWAVAUATUSHHdH%(HD$81GIHDW\IE(LE1E1D$HHD$,HD$HD$0HD$LLHuHHH)$6AP~ Eg\EHt$H D$,MFMLkH|$H/VH1?6H WHcH>f.HAOXHT$0L$u4HIHU;HAwXHT$0wL$HIHUH=X"1H@AXHT$0AD$u=HHPUDHEOXHT$0AED$o.HHUH=W"1QH|$0x{AN@H HT$0HIHCI1H X(H|$0nD$E1HHH|$0FHD$8dH3%(HH[]A\A]A^A_A1ɾH|$0뒃 uIfDHD$y@LE1_HmfDHIHSfDHHS4@HhfHVdH%(HD$X1Hv)$HHD$HWHD$HHD$HVHD$ HHD$(HcVHD$0H7)D$@HD$8HL$XdH3 %(uHhff.HXfH!VdH%(HD$H1H)$HHD$H]fHD$HHD$HIfHD$ H)D$0HD$(HL$HdH3 %(uHXfDH8fHUdH%(HD$(1HH)$)D$HD$HL$(dH3 %(uH8fDSHHOH;UH=T"1*HK1H=T"HAX HK1H=T"HKXHK1H=|T"HUX1[ff.H5USHHdH%(HD$1HT$qS0H{@H{@@վT~t$HHL$dH3 %(uH[]vfD1uDbfUSHH(dH%(HD$1nHH|$H SIHBk1H|$1#Ņx}HHT$ vS0H{@H{@Dt$ HH|$HL$dH3 %(H([]f8dH߻HH=R"IHVH1ffH R"H=#Oc@H5SHHdH%(HD$1HT$PH{@S0HuL$HH5HHL$dH3 %(uH[RfSHHdH%(HD$1oukHT$HS0H{@SHH{@H*t$HHL$dH3 %(u2H[H 9Q" H=HUSAWI`AVAUATUH1SH8HdH%(H$(1HHHLH|$H|$1H|$EH|$AEH PHHP%IH PHPH|$pHt;LP<wH!LH PHPpH|$(Ht%!H PIHnAH|$0Htqr H$HLVPHRRHH0H I1R*H IH 4PH;PH|$8Htq H$HLOHRRHH0H I1RH IH OHOKEu=HmH$(dH34%(?H8[]A\A]A^A_H$Ht*<w!DH oOHNAH|$ HtE11E1H ]OHH5QOL-NiL%eL5zNHu?|@DH!LMMDHLIEͿ1@AHt?HHHtAvAGLNwH5H IH ;KHFKH|$HHt% H (KAH)KH|$PHt%H JAHJH|$XHt&mH JDHJH|$`Ht;=L5F<wHx!LH SHNH|$hHt;LE< wH!LH aJHcJH$HtqH$tfeH$IMH 1JHIsEAؾH IHzjHDHIEu>HaH$(dH34%(*H8[]A\A]A^A_fDH|$ Ht1E11E1H EHH5EL-DL%\L5DHu>{DH!LMMDHLIEͿ1pAHt?HHHtAvAGLGDwH5!LMMDH5~@wfH C"'H=xAfHIdH%(HD$x1HHvHH5lHHrHT$H HD$HQHH=DDHD$8HD$HH=HL$H "DHT$ H(HHt$(HH|$@LHD$PHHL$0HD$XHT$xdH3%(uHĈ"fHHOH=mB"1HJH NB"H=K4H 1B"H=Kp+H B"H=LSFH A"H=L6.H A"H=FLIH A"H=YL+H A"H=LFH A"H=L%H fA"H=L@H IA"H=L%H ,A"H=Mk@H A"H= MN&H @"H=6M1AH @"H=AM&H @"H=lMAH @"H=wM1HUHSHdH%(H$1HHHHHHD$HHHD$HHD$HHHD$ HUHD$(HyHHD$0HHD$8HdHHD$@HHD$HHOHHD$PHMHD$XHWIHD$`HHD$hH"HHD$pHHD$xt6H?HHH$dH3%(u1HĨ[]1HHtH5HS1Ht[HH5[SH5t!Hlt[fDHuHH5[d@SH54!H,t[fDHXuHH5[$@SH5!Ht[fDHuHH5*[@SH5!Ht[fDHuHH5z[@SH5t!Hlt[fDHuHH5[d@SH54!H,t[fDHXuH1H58[fSH5!Ht[fDHuH1H5[fSHHIHIH ;:[1ҾAWI`AVI1AUATUSHL%dH%(H$1HLHLH H|$H9H|$-H|$x!PH|$L$1HbAH <H<"IؾH <H<Ll$xLHs1H$LL`HHuzH$HtmH$tbH$HH$t HHhHHLLHJHHH)aL)H$dH3%(uH[]A\A]A^A_f.AVAιAUIATAUDSHHdH%(HD$1HT$BS0H{@S4uZH{@DAtUHmuL$HLHHL$dH3 %(uHHtEuHHHL$dH3 %(uH[]螽ff.UHSHdH%(HD$1GHt$<ۃt)E`L$A=H=HetEuH4H*HL$dH3 %(uH[]ff.SHHdH%(HD$1Ht$Zt,C`L$ HH/A?tCuH HHL$dH3 %(uH[kff.UHSHdH%(HD$1GHt$<ۃt)E`L$AH#H5tEuH$HHL$dH3 %(uH[]λff.@ v@H5H=HE@H !HSH dH%(HD$1HtFHHtUHHLH1̻IؾH =HW HD$dH3%(u8H [fDGXuIL<H1Ϻff.@SAH1H4]Iؾ[H +9H4lff.AUfIATMAU1SHHB4HXdH%(HD$H1)$)D$)D$ )D$0U1IؾH4I|$A1H<IH@1UIL;@LطZYAEXtHD$HdH3%(uVHX[]A\A]M1ҾH g;UIILK;1@@Lj3@ v6@L:H3LEH ;H ;@He!Lff.@HtGUHHE1S1HHHAHH /[]fff.@Ht7SHHAؾAH 6[1Ҿpff.@HHt H,@HhfH2dH%(HD$X1H)$HHD$H o2HD$HD$(H ,HT$ H9HD$0HzHL$)D$@HD$8fHL$XdH3 %(uHhlf.fAWAVAUATUHSHxH0Ht$T$dH%(HD$h1HFHHE1HtH7H0A(H0H59HIHD$Ht D$HHӻLd$ @LA<HLEDH58HhHD$HtHtHD$T$H58H&uBHD$HtH6HD$T$H5d8Htt@Ht$hdH34%(7Hx[]A\A]A^A_LMt$LE1IHIf.1E1fD1HT$t$HHT$HH57HDHH5;UH0LHH57HT$HH5;"HT$HH5^7hHDHH5/7OHLH1HHH苴ff.ATI`UH1SHHdH%(H$1HHHHLH|$tNH|$HtDϷH|$IBHLHH$dH3%(uH[]A\Գ@AWI`AVI1AUATUSH(HdH%(H$1H|$HHL$LOH|$H|$ HH$H|$L$IlL$D$ L舷HN1`LH5OH$HH|uOT$ LLLu8H訴HL-LHHHH)葸uH$dH3%(uH([]A\A]A^A_øwAWAVAUATUSHHt$T$(dH%(HD$x1HhhHHPHE1HtIAHXE1Ht2AH`E1HtIHh HhH54HIHH ԶHL$0@HΉHL$D$ 7HL$HDHHD$ T$ H53HXHD$HtHdHD$T$H54HuBHD$,HtH&HD$,T$,H5T3Htt@HT$xdH3%(]HĈ[]A\A]A^A_DHH|$ Ht:HD$ HD$ 1D$ 1HT$t$(HHT$HH533HPDHH56EHXDHH56,H`LHH56HhLHH52HT$,HH5)2@HT$ HH52&Ht$ HHHHHHHUDAUI`ATUSH1HHkdH%(H$1HHHHLԮH|$H|$Ht~虲H|$I ACtsH$tX1!LDHHH(HH$dH3%(u:H[]A\A]f.fHLHIfAWI`AVAUATI1USH(HWdH%(H$1H|$HHL$L迭H|$;H|$ H-H$PqH|$L$IܲL$PD$ LHLLH袳HHH)Q1`LH5H$HHűupAD$tHH$1肽t$ LLSLLL HȮH[T$ LLLntfH$dH3%(u$H([]A\A]A^A_ѐ蔬@AWAVAUATUSHHxH(dH%(HD$h1HH0IIAnI0D$^I0H5 /H߉HI8H2E1Ht5HݱI8H%DAwAH!HfDH5.H!)IHAİHL$ @HΉHL$D$'HL$HDIHD$T$H5-HHID$HtHTID$T$H5-H~ID$HtHID$T$H5M-HĻ<1LDHIT$HH5 -I(T$HH501I0HHH5J-:I8t5L8$Aw H!NH 0H- IHt*<w!DH s$H#EIT$H5T,H[IT$HH5!,AHt$LH!IHHf.H\$hdH3%(uZHx[]A\A]A^A_@IH|$Ht'ID$HD$f1D$ ff.AUI`ATUSH1HHdH%(H$1HHHHL脨H|$H|$Ht~IH|$I輭ACtsH$tX1ѸLDHHHHpH$dH3%(u:H[]A\A]f.fHLHpfAWI`AVAUATI1USH(HdH%(H$1H|$HHL$LoH|$;H|$ H-H$(!H|$L$I茬L$(D$ L訫HL蝫LHRHHH)1`LH5HH$HHuupAD$tHH$12t$ LLLL8LHxH[T$ LLLtfH$dH3%(u$H([]A\A]A^A_ѐD@ATIUHS葪Hft5f uJHs.H Ht/C[]ffA$1A\Hs.HHu[]A\ff.AUI4L,ATIUH4SںHHdH%(HD$81IHSL褣XMZLLJ1IH 2,/1AؾH #dHD$8dH3%(u HH[]A\A]@AWIAVAUATUHSHHHyT$ dH%(H$1Ht E1HE1HtHϩHADH5'H胵LMLSLD$+LH5X&HH諶ugH[HH+A=t+H*=t=?H*H*HEH5HItuDH$dH34%(.H[]A\A]A^A_fDu4D9uf1D$+/@Hd*Hk*HEfHDH5<HHt$< wH3!HHD$HT$H5%H膵>HHHD$PHT$LHHHD$ HHT$H5%H1HT$LH5o%H螳HHH$HT$NHHHD$ )HHT$ H5 %H趴nHT$NH5%H#KHH,6H$@HΉHL$0D$,HL$0HDHHD$8T$,H5*$H跲HD$0HtHæHD$0T$0H5a$Hu1Ʊt$ IDLHHT$0HH5 $HDHH5#Ht t$+HLD$H (H#ոL'At/L'AtA?L'H'LEH 'H7yHT$,HH5"Ht$8HHHtT$LHt$H=#HtT$NHt$ H="_HH0H(3HD$PHD$H$HD$ HH|$8Ht9yHD$,HD$8AL&H&LE1D$,聟ATI`UH1SHHdH%(H$1HHHHLH|$tfH|$Ht\ϢH|$IBH$t?H$t4HىLHH$dH3%(uH[]A\D輞ff.AWI`AVI1AUATUSH(HǪdH%(H$1H|$HHL$L/H|$H|$ HH$H|$L$ILL$D$ LhHL]LHHHH)1`LH5H$HH5uEH$t5H$t*T$ LLLuHKHnH$dH3%(uH([]A\A]A^A_fD4@AWIAVE1AUATIUSHHHydH%(HD$x1Ht#AD9s4t2Ht$xdH34%(kHĈ[]A\A]A^A_IܡIH5H߉A葭uID$HtH衡ID$T$H5HSaID$HtH_ID$T$H5HID$ HtHID$ T$ H5iHϬIIH58H߉‰D$蟬IH#D$Ht/HgIHXD$<wH!HH5H豭OIIHL$D$ SHL$H5HHl IؠHIHT$<wH'!HHD$HT$H5THIH轟HL$0@HΉHL$(D$$ HL$(HDIHD$(T$$H5HAO1蒪MDLHIDHH5It"DD$H f!He|$ H IH衱LD$H =!H;It"DD$ H H裭IT$H5HIt;|$L"wD$H!LH HIT$HH5czIT$$HH5@`Ht$(LH@IHѷHɶIH|$(Ht>ID$$HD$(!1D$$aAUI`ATUSH1HH{dH%(H$1HHHHLH|$H|$H襛H|$IACt_H$t|1-K4ILDHIHH.HƵH$dH3%(u[H[]A\A]H$tH$tH$u밐H$tHLH.ff.AWI`AVAUATI1USH(L=7dH%(H$1H|$LHHL$L蜖H|$H|$ HH$NH|$L$H$踛L$D$ LԚHLɚLH~HHH)-1H$LL`HH襚ueAD$H$tI1bAL$4MLH$t$ zLL_LH蟗HVH$dH3%(urH([]A\A]A^A_fDH$tH$tH$tH$tT$ H4$LL!qfD{1HXfH v dH%(HD$H1H&)$HHD$HHD$HHD$ H)D$0HL$HD$(觫HT$HdH3%(uHX譔ff.fHHfH ndH%(HD$81H*H)$H)D$ HD$HL$HD$/HT$8dH3%(uHH5DSHHOH-H=v "1ʙHK1H=X "H)謙1[HHOH=- "1H4z4H  "H=:M1HfDSHHdH%(HD$1HT$HhuL$HH5&HHL$dH3 %(uH[#HI`1dH%(H$1HH.HLH谒H$Ht-辘L <v{H H 薪H$E1Ht聘E1AH MHR˫H$dH34%(uHH!Lr0USHHdH%(HD$1Nu@HH-諞 H=H€tPHƹHt:H C "*H=]H\$dH3%(ucH[]ÐH8HHT$HH߾@@ @H{@1҅B#t$H'0HhfH dH%(HD$X1Hf)$HHD$HHD$H*HD$ HHD$(H(HD$0H)D$@HL$HD$8菧HT$XdH3%(uHh蕐DHXH /HZdH%(HD$H1fH HHL$H HT$H )$)D$0HD$HL$ HD$(HT$HdH3%(uHX ff.fHXH s.HdH%(HD$H1fHo HHL$H HT$Hh )$)D$0HD$HL$ HD$(wHT$HdH3%(uHX}ff.fHxI dH%(HD$h1HH-HHHyHT$LHD$H HHD$HD$(HHD$0HAHD$8HNHD$@HHL$ HD$H躥HT$hdH3%(uHxHXfH /-dH%(HD$H1H)$HHD$H7HD$HHD$ H )D$0HL$HD$(7HT$HdH3%(uHX=ff.fHIdH%(H$1HHHHHHT$LHD$H HHD$HD$(HHD$0HHD$8HHD$@HHD$HHHD$PHHD$XHHD$`HSHD$hHHD$pHHL$ HD$x,H$dH3%(uHĨ,ff.HXH +HjdH%(HD$H1fHHHL$H 9HT$H)$)D$0HD$HL$ HD$(藣HT$HdH3%(uHX蝌ff.fHXH +HdH%(HD$H1fHHHL$H HT$H)$)D$0HD$HL$ HD$(HT$HdH3%(uHX ff.fHXH s*HdH%(HD$H1fHoHHL$H HT$Hh)$)D$0HD$HL$ HD$(wHT$HdH3%(uHX}ff.fHHfdH%(HD$81H)$HD$HNHD$HHD$G4)D$ u 1HL$8dH3 %(uHHfHHѡf.HXfH O)dH%(HD$H1Hv)$HHD$HWHD$HHD$ H+)D$0HL$HD$(WHT$HdH3%(uHX]ff.fHXfH (dH%(HD$H1H)$HHD$HHD$H`HD$ H)D$0HL$HD$(ǠHT$HdH3%(uHX͉ff.fHhfH /(dH%(HD$X1H)$HHD$H7HD$HJ HD$ HKHD$(HHD$0H)D$@HL$HD$8HT$XdH3%(uHh%DH5ۣff.H50 黣ff.1H5 鞣ff.1H5 ~ff.H5p[ff.H5;ff.1H5ff.1H5 ff.1H5#ޢff.1H5S 龢ff.ATAUSHHdH%(HD$1HT$\H{@JH{@KևS0H{@ŇS4H{@贇H{@DO裇H{@蓇t$H'HL$dH3 %(u H[]A\fUSHHdH%(HD$1HT$葞S0H{@ S4H{@H{@KH{@JH{@Lنt$HmHL$dH3 %(uH[]aSHHOHH=!1HK1H=!H܋HK1H=j!H辋HK1H=L!H蠋HK1H=.!H肋HK1H=!HAdHK1H=!HFHK1H=!H(HK1H=!H HK1H=!HHK1H=z!HΊHK1H=\!H谊HK1H=>!H蒊H &!H= eH !H= H'H !H=+,H !H= H !H= HK1H=!H HK1H=q!HʼnHK1H=S!H{ 觉HK1H=5!H艉HK1H=!HkHK1H=!HMHK1H=!H,/HK1H=!HFHK1H=!HhHK1H=!HՈHK1H=c!H 跈HK1H=E!H虈HK1H='!Hl {HK1H= !Hr]HK1H=!H|?HK1H=!H!HK1H=!HHK1H=!H1[ÐAWI`AVI1AUATUSHH7dH%(H$1HHLH裁H$xHL$AMLL$H_@1`LH5H$HHH$Ht~聆DLdupHHL荅LHBHHH)yH$dH3%(u(H[]A\A]A^A_͐Ā@SHHZS0H{@H{@S4؀H[鏘ff.@AWI`AVAUATUSH8L%Ht$H|$ 1T$LdH%(H$(1HHL$ LH|$(H|$0HwH|$8kH$\萃H|$8AL$ HD$H$D$HDHpHH$H$H蠅HHH)O1H$ LL`HHǃNH$?H$Hv H$A蹂HEu |$NE1FLD$H H贖DD$H $Hy|$H5VVE11ҾH [HD$H\t PXIH 1E1&E11ҾH H5ώtf.H$(dH3%(uVH8[]A\A]A^A_fDH_1Eu1D$H|$诛D$랸}}ff.ff1DSHHdH%(HD$1Ht$躊t,C`L$HHA>4tCuHHHL$dH3 %(uH[|ff.SHW4dH%(HD$1u HT$dH3%(u9H[f.Ht$HuϋL$HH5 H R|fSHW4dH%(HD$1u HT$dH3%(u9H[f.Ht$HCuϋL$HH5H虔{fSHW4dH%(HD$1u HT$dH3%(u9H[f.Ht$HuϋL$HH5!H)r{fSHW4dH%(HD$1u HL$dH3 %(H[fDHHT$ɒS0H{@X{S4H{@G{H{@J4{H{@K!{HْqL$HH5S H[VzSHW4dH%(HD$1u HL$dH3 %(umH[f.HHT$S0H{@zH{@S4wzH/uL$HH5H赒yff.SHW4dH%(HD$1u HL$dH3 %(H[fDH5!H聇u͹HT$H6S0H{@yS4H{@yH{@KyHYqL$HH5#HۑV!ySH54!Ht[fDHuHH5[@UHSHHdH%(HD$1oHH脅uPHȅHuLHDH H{H߉蚅HL$dH3 %(uHcl$HH$H5Hi kff.@AWAVAAUIHATIUSH(dH%(H$1L|$oH&DH$HHLHlHL_oLHqHHH)p1H|$`LHH5wH:oueH$HtXH$tMEtCnH$HjAM\OAUXCLHD$讈HD$,@H$dH3%(uH([]A\A]A^A_fDj@AWI`AVI1AUATUSH H'vdH%(H$ 1H|$`HHL$`LiH|$hCH|$pH5H$&AmH|$hHD$PnD$\H$HHD$mIH$`HD$H$`HD$HH$` HD$@Hl$HmHH@oLHL)nAń1`H$`HT$HH5&uL^mH$xD$Ht mD$H$L$HD$ H)M H$HmH$H5ML‰D$,]yH$0HH,nH$0D$4fHH5.LHzyH$@H#mH\$@@ljD$0H苓H$@HDHD$8T$0H5#LxLlDl$[Ll$HHp1`LH5sH$`HHkH$H}lH$H5L4xHhHLykLH.mHHH)leHt$ 1LDl$[pH$ dH3%(jHĸ []A\A]A^A_ÿH5L|$wL谄LXhIH1D$4FH$HH|$8Ht& jH$@D$0HD$8|1D$0ff?fD1ivL$t$\LLD$HT$PDD$,H H zH$0t t$4L膬H$@T$0H5L{HT$Ht$8L Ht$ LH56vE11ҾH ;}LiL|$L|$HH-@AH P1E1RyHfHL_iLHkHHH)j-1`LH5 qH$`HH7iuRH$HtEiEeE11ҾH Hj|EDfDQdATI`USH1HHmpdH%(H$1HHHLcH|$H|$HH|$H$gH|$Ih1tMH H{AH HPwH$HߺH߉zH$dH3%(uH[]A\f$c@HIdH%(H$1HHHHH#HT$LHD$H HHD$HD$(HHD$0HKHD$8HfHD$@HcHD$HHZHD$PH[HD$XHtHD$`HHD$hHHD$pHKHD$xHH$HHL$ H$xH$dH3%(uHĸaf.@AVIAUAATE1UHSHHHtHfHADH5Hrt[]A\A]A^D1qLDH軦HDHH5gHHtHƒuHZ[]A\A]A^f.ATI`UH1SHH=mdH%(H$1HHHHL`H|$tNH|$HtDodH|$IeHLHH$dH3%(uH[]A\t`@AWI`AVI1AUATUSH(HldH%(H$1H|$HHL$L_H|$H|$ HH$PcH|$L$I eL$PD$ L(dHN1`LH5kH$HHduOT$ LLLu8HHaHLcLHeHHH)1euH$dH3%(uH([]A\A]A^A_ø_AWAVAUATUSHhT$ dH%(HD$X1H HHIHHcLd$@LAVHLEDH5HoHE1HtHcHADH5HGoum1nt$ LHmHDHH5褥HDHH5k若HLHmHH|H{HT$XdH3%(uKHh[]A\A]A^A_fLMt$LE1IaHIf.1E1q]ATI`UH1SHHidH%(H$1HHHHL\H|$tNH|$HtD`H|$I2bHLHH$dH3%(uH[]A\\@AWI`AVI1AUATUSH(HhdH%(H$1H|$HHL$L?\H|$H|$ HH$_H|$L$I\aL$D$ Lx`HN1`LH5?hH$HHl`uOT$ LLLu8H]HL`LHaHHH)auH$dH3%(uH([]A\A]A^A_øg[UHAWIAVLAULATSH˹ HH@HLE1E1AHXEEHL`LAUHX1RHXYL^HƋ H!%tIDHJHDѹ@ǸLHL)H)HYLL H!%tHXDHJHDѹ@HHE1E1H)11YHsH`A9r8HHHPH5dEA݃A9sLEHEHL`LQAUH1FQXZL H!%tLDHJHDѹ@LHHH)HXHH`@AATL`LAUfATL`LAU:fL H!%tLDHJHDѹH1L)W*;H!LQATI`UH1SHH ^dH%(H$1HHHHLvQH|$tNH|$HtD?UH|$IVHLHH$dH3%(uH[]A\DQ@AWI`AVI1AUATUSH(HW]dH%(H$1H|$HHL$LPH|$H|$ HH$qTH|$L$IUL$D$ LTHN1`LH5\H$HHTuOT$ LLLu8HRHLTLHRVHHH)VuH$dH3%(uH([]A\A]A^A_øOGft>f u0DGEuw u OtffDtJfWuf EfD ffWuUSHHt:/t&HUHHH]t/tDX tH[]H1[]ff.@AVILAUIպATIUSHdH%(H$1Hl$`HVHタLZY~#H5LHPIHXH\$H¾PHOHs HNHtLM1Ht$HPIHD$8H9HLHw1Me1H$dH3 %(,H[]A\A]A^@sL8"uſ"SL-!HHI1I}@SI}HH1&Sy@Ha!&H=hHRKL-7!IH1HI}RK8 SHH2IH!H81RL-،!ILH I}mRLUL Lff.G<v%G<vG< w'@G@G@Gf.USHdH%(HD$1H}>HtuHHHNH$HHt[H9tV:uQHH¸HvH|$dH3<%(u0H[]fHH9wM1K@ω!u!tf.u1øUSHdH%(HD$1HtY>HtQHHH{PH9H$H9t/Ht*:u%u!E1HL$dH3 %(uH[]DJff.AVIAUIATI.ULSH dH%(HD$1JHt$H<LIff/Hl$HL9f.5/D$HD$8"A}KH5cAHD$HD$1H5PHbHD$H58HEHD$H5wHD$"HD$H5HHD$tpH5HGD$tWflf1LNHl$HL9tHtHt~HfH*A}H,fɉЉH*f/w#AU1H\$dH3%(ujH []A\A]A^Ã1AMDYXfD[G8"BH؃fAHH ؀}H*X]h^Hff.ATUSHdH%(HD$1Htg>Ht_IHHIHH$H9tEHt@8u;Ht%I,$1HL$dH3 %(u&H[]A\fDF8"ufDGff.W1DUSHdH%(HD$1HtY>HtQHHHLH$H=H9t1Ht,:u'u#fE1HL$dH3 %(uH[]fD Gff.USHdH%(HD$1HtY>HtQHHH+LH$H=H9t1Ht,:u'u#E1HL$dH3 %(uH[]|Fff.AUAATUHSHHdH%(HD$1EHti;tdDHHICHH$H9tJHtE:u@HHHw%HE1HL$dH3 %(uH[]A\A]@A<$"uԐE@ATAUHSHHdH%(HD$1VDHt{;tvDHHHH$HHt\H9tW:uRHH¸HvH|$dH3<%(u1H[]A\ÐHH9wM1E@SHHdH%(HD$1HuH$H H H HH\$dH3%(uH[DSHHdH%(HD$1H|$uT$ʉHL$dH3 %(uH[SDSHHdH%(HD$1H|$u T$ffHL$dH3 %(uH[Cff.@AUIATIUS1H(dH%(HD$1Hl$HLIH=w=HT$L9t3ffD\tC<:HuLjf.Ht$dH34%(uH([]A\A]HD$I$;Cff. tt 1ff.AUATLgUHSHHH(dH%(HD$1HHLJLHH)HH=!u^fSQPf{If fSH}1Ht$dH34%(H([]A\A]@H=HtfH=HtL:HT$ ZBT$ Hta fKt4 t/cfDtfSC>LH `D~CfCuE1Ll$1LHFH=wHT$H9vBD#tS<.AIRHj@HLM0fCfsfCzCnHfSLoCCu8DHHATʀtfKd@ff.fAT1IUHSHdH%(H$1Åu'H$dH3 %(uQH[]A\fDHHÅu"f|$u|$Ax A$?@AUAATI/UHLSHdH%(HD$1?HDLHH_/t(HL$dH3 %(H[]A\A]f}f}At]HsH|$uKD$D9wBfE1f U뙐DLHu}f}DfD^>tauL AfOfDGoFGtG9uU1HfGf|1HDf.AAfDOfDWFGu뫸SHHHdH%(H$1Hu H$dH3 %(D$u3H[H}!HپHLH81ZC0C=ff.PXH=S0HHn}!HCBff.PXHKHH3}!HH81BBff.PXH3HH|!IHH81BiBfPXHHH|!HIH81SB)BfPXHHHx|!HIH81BAfHHA|!HHH81AHff.SH;Hw;tH[[Ð?tff.ATIHUHSÅt []A\DHLH:[]A\ÐSHt&H^HZHEH[f.HI{!HH81@hBHt1t%8u!fDH8u  uff.UHSHH55HHuEH1[]DHHH1[]DAUAATALgUHnSHtHLHc;u;Et% HcӸD)E1A 3LȅAHD[]A\A]HA[D]A\A]@USHdH%(H$1HtSWHft%f~HHu5SHHH$dH3 %(uH[]D1ڸX9UH=SH(dH%(H$1D7HtH=37 1H;ÅtNH$dH3 %(AH([]|$@B\$ Hn8uf.dfH=E6HtH=4H\$6HHH18H56H:HHtHHL$ HT$1H5 39RHd7H=$6Ht?H=H\$6LHI15afDfoD$ H\$)D$?7ff.@HDIcL޿XeLAAft>f t HDL5DIsD 4IsD4AH o!:f.IH=xL€H=YLƸ €taH=LƸ€tAH=LƸ€t!H=LHt9H t-HOt!HtHHHDfDUHSHu H1[]Hzt}HHsu!IHaH81 ;:UHSHtwu3H1[]H#u!HHIH81::HtHHt!IHRH81{:Q:AWAAVAUEATIUHSH8H! D<$IcAHl$HD$HDHHH(Љ)H!HHT$(HD$ H \$DIfDM6MAF9uAF9$uHT$Ht$I~V5uʋ\$IFpDDHDIAEσ*H8ELHD[]A\A]A^A_Uu9Eu2}u)HE AHD$HD$$DIcA D<$HD$HDHl$Aދ\$G6IHZfDp$IxHT$Ht$LD$fA@I@4HD$ LD$HL$(IHo!LȋE!XE11ɾHG8D3I;uD4ЉÃM1ɾH|CD4ЉÃ+ff.AWHAVAUATUHSHXHT$ Ht$dH%(HD$H1t-IH H]L5m!#HA+HtH]HD$@HD$ HD$8HD$(HL$Ht$ HD$8HD$@H|$(,IHA#H\$8H`+HtH\$8L}L*HHD$*HL$LHtHD$H0p.HEHHt$8HOl,0H|$8(H]HH50HH(HT$HdH3%(LuuHX[]A\A]A^A_fDHIj!MH=H/H!j!H=~IH/HD$Hx)ff.AWIAVAUATUSH?HIL-A1Dr1DI$LH*H؀8}IxHXtlLH*H3@tVA9~t@'t@"uH{I<$)HuH9i!H=H..fDHcM!ff.fSHH*?Bwmv5Lٳ^Hߺ?HH[ALH1H?H[fD^XLfATIUHSHH dH%(HD$1Ht$H\$H9;u.H,I$1HT$dH3%(H []A\fDH5xHD$D$]H5lH~D$@H5THaD$#H5HD$>D$H5H!D$H5HD$H5MHD$D$H5HD$H5HD$H5HD$D$H5HgD${H5HJD$^_fYXEY@5Y+(qfSHH*Hɚ;^H?B=H~dL'^Hߺ?HGH[f^L԰^LILǰH1H?H[fDAWAVAUATUSHH $H8H-s]!H<$IIHU@t$dH%(H$(1HD$HD$HtHH=H!Ll$Ld$D$H\$ f.HULL!HtcH|$H tLHމAօtH!H $HDH\!H81["|$D$u@H|$HtH$(dH3 %(D$umH8[]A\A]A^A_H<$H5Ht HU86"H $HIH\!H81!D$|AWAVMAUIATUSHH|$HHI1fHtAHtLHI9uH[!HL$H1NdL=H;,!H;fHMHtL1!H;HL9uLHG1E1 AHD[]A\A]A^A_f.AH[!HL$H1H; H;HIйHR!Hf.AWAVIAUATUSH8/HH|$Ht$LD$dH %(HL$(1Ʌ~UILl$$6fLH3AԅuhIwHT$|$$AօuTHtH;:IHu1HL$)HL$HHL$(dH3 %(uH8[]A\A]A^A_fDff.tH @Hff.HtQUSHHHt#H@Hht$HtH;HuH[]f.CH[]øHt*HHt$;wu)HHt9wtHu1f.ff.Ht'HHt!;wu&DHHt9wtHu1f.ff.@Ht&HHt ;wu%@HHt9wtHu1f.ff.US1HHxHuH[]@ATIUHSHHtHI$HE1[]A\øfDH(Ht @Hf.~@foUG$ HGGDff.@~ HDuDHWH5s1fH!SfHDϋu0Mt+D9 tQLQI1DLHID9 t0I9uHcHLũ1HH[fDHA[fAVIAUATIUSHtIIH1HHI9t+H{Lu[]A\fA]fAA^1LL[]A\A]A^AWIAVIAUIATIUSHdH%(H$1HLHFH$H< u fH< t< t<#vM1LLHH5kuAH$dH3 %(H[]A\A]A^A_Ip@1LLHH5t1LLHH5mt1LLHH5QgHLW1PAWI@AVIH5rAUAATUSH8H|$H\$ HdH%(H$(1HLHtJHLd$fHLHBt&tQD|$E9wH'IcIfDHH$(dH3%(uDH8[]A\A]A^A_HS!HL$IH2H81Hk@AWAVAUATUSHH $HH=H5C!dH%(H$1!H=HHH-IL5L-!HHtjx.tLxLHvItHuMMLLLH.HuHH$dH3%(uH[]A\A]A^A_AWAVAUATUSHH $HH=߫dH%(H$1!HHH-nIL5ȫL-!fHxHtjx.tLxLHvItHuMMLL LHHuHH$dH3%(uH[]A\A]A^A_gAW@AVIAUIH5 ATUSH(dH%(H$1H\$HHLHtrHLd$ f.HLHtFtqD$ xHINjD$ AGIGD$ IDHL8IHPH$dH3%(uBH([]A\A]A^A_HP!ILHĩH81HFfDAWAVAUATUSHH $HH h!dH%(H$1!fHHtBHH=uH5Ah!H=AuH=MHHH-IL5EL-h!DHHtex.tLxLaHvItHuMMLv LLHHuHVH$dH3%(uH[]A\A]A^A_ff.ATUSHHwZH!uMH-!LcJDHtH[]A\:!uT$ |$JD|$T$ HuHcALHH1 HH[]A\AWIAVIAUATUSHH=!dH%(HD$1Ht !1L-~!fDHHtmIlLcHtLHuH-!L% !AHL$dH3 %(umH[]A\A]A^A_Hّ!A@u1HLH$H!HtL9t:uH=wA1늸4 @AUAATUHSHwlH!u_L%u!LcKHtH[]A\A]n!u0|$ LH=yM!KDL$ HuHcHLÝ1H HH[]A\A]AWIAVIAUATUSHH=!dH%(HD$1Ht 7!1L-t!fDHHIlLcHtLH uH-$!L%!AHL$dH3 %(H[]A\A]A^A_H!A@H5Lt!H=;!P1HLH$H!HtL9t:uH=w A1f\) fAUAATUHSHwlH!u_L%k!LcKHtH[]A\A]Z!u0|$ LH=9!KDL$ HuHcHL1HHH[]A\A]AWIAVIAUATUSHH=y!dH%(HD$1Ht ' !1L-j!fDHHIlLcHtLH uH-!L%!AHL$dH3 %(H[]A\A]A^A_H!A@H5:u9x5A1H%!AH5YL!H=!-sff.@ATAԋU!UHSt~H!uBH5K!HHHu !H Ht9YuHA[]A\f.HH9uIcALHH1HH5K!H=@!`fDUAHSHw6H!u)s!tOIcH%C!HHtlH[]DHcHL1HHH[]fD|$ H5B!H=!DL$ HcHLHHH[]AWIAVIAUATUSHH=!dH%(HD$1Ht y!1L-(B!fDHHIlLcHtLHuH-!L%!AHL$dH3 %(H[]A\A]A^A_Ha!A@H5A!H=oˆ!P1HLH$H!HtL9t:uH=w A1f\fATUSHH!IAHcڋ(!t7IcH-!H Ht4HHL1 H[]A\D|$ DL$ HLL1HH[]A\DHLL]1H1NH[]A\vfDAWIAVIAUATUSHH=Ƀ!dH%(HD$1Ht !1L-(!fDHH tfIlLcHtLH~uH-[!L%L!AHL$dH3 %(uuH[]A\A]A^A_f.H!A@1HLH$H!Ht%L9t :uHwA1@s={f.DHGHWHHtHP@tHHWHHtHPHW0HG8HBH@UHSHHG0HHxH0H9uH1HC0HH0H9uH[]ff.@tHuAWAVIHAUIATUHSHHxAIHHt~E~Hx@IT$LDx$tAFfC(AFC HC0HtcHU8HE8H0Hk0HS8HLLHU!Hs%H HKHtHqH4HHCHH[]A\A]A^A_DH!AJ H HtHYJJHSHC0HC8@HHAUATL`USHD(AA~\@fvRHHA9}EDA$fv5D90fA|$5uIt$HHA$A)IAH[]A\A]DAWAVAUATUSHWdH%(H$1BfH%GHoH5!ǁL,MueDMmMSA;E$ufH|$ HS A>H|$aH|$(HtdCLwI}@LAE tIIEIUHHtHPLAHJ!Iu%H IMHtHqH4HIEH$H3D8IM0LpALaA~e@fv[D9~QDAfvBA9|:fA~5u Mt5It$@I~u#IT$0LbЍCA)IAI|$00tlL$HT$HL1RftJLd$ HS A>L_HD$(Ht!1HpHSHtLHH@1H$dH3 %(u>H[]A\A]A^A_LL41Lx1붸AUIfATU1SHdH%(H$x1H\$PLd$)D$H)D$ )D$0HD$@Ht$dL1H HD$PMD  HYMt1L!Lh6AL H҃΃5XHT$HL1RxH|$1H|$Ņuo#LAH$xdH3 %(uHĈ[]A\A]HALk1H=F~!H:~!HDATUSH3t.L%4!IHu #HHt;x$uHX@H[]A\159u!IHufDHHt;h$u뾐H5}!H}!{HuAHLt@H!HиHufHHt;z$uB(fDf1t6H-!HиHuHHt;z$uB fATUS1HdH%(HD$1HtIHH|!%HHuNfDHHt@H{0HLcuMt'[HL$dH3 %(uQH[]A\f1HÅuHÅu1HT$H5!Hu\$6HLHD[]A\A]A^A_!Dt7hMcDI1LLLHLLl$A~h~cLM}ALL5`H$fDH4$GL,L1MHL)bCDm9D9IIuHD$H[]A\A]A^A_fЃ=t 0HDLH[]A\A]A^A_u,t(HLHD[]A\A]A^A_#HLHD[ ]A\A]A^A_ f.HDL cff.fAWAVAUIHATUHS.H8dH%(H$(1cHtVH|$ HܯH$(dH3%()H8[]A\A]A^A_DDcL|$ID$L5AHD$0fDD$=wPCD%DHtIHL;d$:HHHtH1LLHtH2!HHH81H1!HH΋H81fDD$(AEfDuHQ1!SH8&$H?!Ht8HO!u u[H$tH=![R&H=;ff.rfH=Ŷ!Ht H7&H=!H#ff.@1%DH=t!tH=k!v#fDff.@H=D!AWMAVIAUAATIUSDHt8@t2H=!MtcL'H1[]A\A]A^A_f.u܃tH/!LLDH8H1[]A\A]A^A_*f.%H!@SH#t'H=h!HtH"H=T![N$fD[fDHuHf.H=!H $UHSHt0t+H=!HtHo"H=ش!H[]$Dsuu H[]HH[H5]fDUHSH,tuuu%H[]fDH=Q!H[]#fDHH[H5]VfDAVIAUAATEUHSt-t(H=!HtLDHa'[1]A\A]A^fD{utH-![DL]DA\H8A]1A^ D$[1]A\A]A^ff.fAVIAUAATMUHSt-t(H=Q!HtLLH&[1]A\A]A^fDutH-![LL]DA\H8A]1A^ Lx$[1]A\A]A^ff.fAVIAUIATAUSDqt-@t'H=!MtHL`%[1]A\A]A^D;utH{,!L[D]A\H8A]1A^ "[1]A\A]A^ff.AVIAUIATAUSDt-@t'H= !MtHL$[1]A\A]A^DutH+!L[D]A\H8A]1A^@ i"[1]A\A]A^ff.AVIAUAATEUHS1t-t(H=q!HtLDH#[1]A\A]A^fDutH;+![DL]DA\H8A]1A^ D![1]A\A]A^ff.fAVIAUAATMUHSt-t(H=Ѱ!HtLLH!#[1]A\A]A^fD[utH*![LL]DA\H8A]1A^ Lh![1]A\A]A^ff.fAVIAUAATMUHSt-t(H=1!HtLLHA#[1]A\A]A^fDutH)![LL]DA\H8A]1A^` L![1]A\A]A^ff.fAVIAUAATMUHSQt-t(H=!HtLLH"[1]A\A]A^fDutH[)![LL]DA\H8A]1A^ Lx [1]A\A]A^ff.fAUIATAUHSHD$t0t+H=!D$HtQH H1[]A\A]@sutH(!D$LDH8H[]A\A] H1[]A\A]ff.ATIALU@@SHHPdH%(HD$H1HHzEHHھrHD$HdH3%(u HP[]A\@AVIAUAATMUHSt=t8H=!HtMtWHujMteL[1]A\A]A^f.;utH{'![LL]DA\H8A]1A^H[1]A\A]A^DLH[1]A\A]A^fATIILpU@@SHHPdH%(HD$H1HH:MHHھHD$HdH3%(u HP[]A\@EL EHLDNff.EL pEHpLDff.AVIAUIATAULSHPdH%(HD$H1tu\1҄t)HL$HdH3 %(HP[]A\A]A^fDtH%!LHDH81ADHIL1@@HLI1ɾ1kff.@AVIAUIATAUDSHPdH%(HD$H1tu\1҄t)HL$HdH3 %(HP[]A\A]A^fDtH$!LDH81RfDH1A@L~@HMtH=!HL+1k@H=y!HQ1QDAVMAUIATAUHSt-t(H=1!HtLH[1]A\A]A^futH#![LL]DA\H8A]1A^`+[1]A\A]A^ffI*I*@^zXH=!tÐH#!H5uH1AWAVML{AUIATAUSLH(dH%(HD$1@H_MII@LDLD$LD$t @HL9Ii1H1IHt H9HÃtL9sHcH6!H H jfH|$H*H|ULD$LLDxH|$HL$dH3 %(u\H([]A\A]A^A_HcH!H ЅyLLLjIH q|LD9뙻 fHt#H!!H8 u 1HfH=|!HtE;H8HHtAPЀ<8tyuQ!HfD1ff.fUHAUATSHdH%(HE1HHIHHPHHH%H)HHH9tHH$H9uH|$LHw=HI78IH5zL|upA<$H=zLtkH=hiLu&@H=zLt^fD1HUdH3%(uTHe[A\A]]@IA@H)HL f.ff.ATIUHSHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1!H$$HD$HD$ D$0HD$ڤ!HyHs!HH Hp1yHLHTH yHHo1EH\$dH3%(u4H[]A\HIywHLH6fD@t 1@ D@@t 1@DAUATUSHH $HH5{H=xdH%(H$11HHHL$L-EyHLtJ1HLHH5xct1HH$dH3%(HuKHĘ[]A\A]L(H1ۋ8%HyHH!H81ff.AUAATUSHH18/I@H)DLŅ{/H{/HHuDLzŅtl8t`cLHwIHJ!H81LhH[]A\A]8u{/H{t1ĺH!H=3wHff.fUSHHHtHH[]D@H=1wHHHE11HwHH=w7tK8t?9HvHH#!H81HAU@HHH[]H!H=SvHpH!"H=wHHHH!=H=wHZHi!+H= wHff.AWfAVAUATUSH8dH%(HD$(1)D$HLt$ Ll$HE1HLL꿜D$!xI|$Hl$E1LHT$(dH3%(HH8[]A\A]A^A_@HH;$@{fSGt- HGt  tH3}C ,[fS[H.{ u[fDH3 [fS Ht u,CC t0H3]C~C ,[H7 c\ff.UHSHH @uC ,HHH[]RfH3fD@H1dH%dHDH5>[1fH5g1ff.H5gff.@1H5~gjf.1H5dgKff.1H5qc,ff.H1H5(g ff.H1H5 gff.f.H1H5cff.1H5Yff.H1H5f{ff.UHSHHHHH[]f.UHSHHH[]+ff.SHHD$yD$HH[FfDUSHHLHH[]|ff.UHSHHHHH[]jf.UHSHHHHH[]Zf.UHSHHH[]ff.UHSHHH[]ff.UHSHH[HHH[]f.UHSHH+HHH[]f.USHHHH[]ff.UHSHHHHH[]f.SHH[Zf.UHTdIH DdSH`WHHH-!@HD1H}H|.tHu.HuH []H8f1ɺ dH%(HD$(1D$ H H$G@t$HD$GG ?D$HT$(dH3%(uH8=ff.fAUATIUSHHx>HHDHhhIcՋ4}xIKH[]A\A]DH!H=bH`H[]A\A]H!DHeH81@H[]A\A]AVAAUIATAUSDLDJ…yTHŃt݃ t؉9AؾHbeHH !H81U[]A\A]A^fDt []A\A]A^H!H='bHqf.AWAVAUIպ"ATAUHSHLvIIF x<=LHcHIHtOI1HDI^xM}H[]A\A]A^A_DLD$ \D$ H[]A\A]A^A_H! H=YdHfAUfATUHSHHXdH%(HD$H1)D$)D$ )D$0HD$@St*IľHL$HEH=t(1HL$HdH3 %(HX[]A\A]Ll$Mt LIHT$ 1Ht HG9rqIT$CHEHt"LHxp^MgA}\A$1LljD$ D$ \1;H[Hs H81EDH`\tjD|$(Aff.fSfHHPdH%(HD$H1HL$)D$)D$ )D$0HD$@蘼u#H|$HtdHHt 8u'1H\$HdH3%(u&HP[1ljD$ ND$ cAWfAVE1AUATIUSHHt$dH%(H$1HD$4D$\HD$PHD$@HD$`HD$(HD$HD$PD$lHD$|DŽ$D$X HD$hHD$HT$Ht$A<$ÅIL$(L|$(HtPLGL|$(HD$H8Lh(D$fDA79s3A)IljA79AET$8fA#GfAGuAT$A9W uA|$ A9uDEAGfZfI|$(tIuLAU؅aH|$($$H$dH3%(]HĘ[]A\A]A^A_I}L|$(tI(I}uL $胸D$ $ $ HH' H5YH81藿#AO $蛸 $މ0A|$$t:IEHtIuLШ`AD$0H|$(ڷtu@AW!҉$yn'$Hʼn؉EIEHt$IuLЋ$uJL!uEZ_tkH=TXZ1LI}L|$(D$sH H=WHgL$ H H=WH,H $H=ZHH[ H=vWH(DE{H% .H=YH謽1TL-DSHA H?dH%(HD$1HL$D$ xK0HD$dH3%(uH[}ff.fH?At$ HL$ ȶHyDSH5[ff.fATfAUSHH dH%(HD$1G HG0W$GD$D$U0HL$AǾ-H @/!;A; HkHL$A1Dc fS; HCfC 8;HT$ HD$ IL$ udKfu.1ǸC1Ht$dH34%(H []A\DH}UH H81SHKH8UH=TOH=Tiv@H$`dH3 %(HĘ`[]A\A]A^A_fL$H H $A0AŃ]D$ DxsA9nLt$H\$ fE>DxUE9PHLHAԅaAAE)MDAwD$p EHB9Hy H8D$p FHH=ADLD$hD$ I"H|$`HE1AIHHHHރHH9_t?Hv!MI)I9rI)I9rHHHuEDT$ DHuDWAD$p  H H=AHHo H=@HH?BHC H81躧DH@1迧ff.fAWAVAUATUSL$HH $L9uHIHIIdH%(H$@1Ml$PHum$C=? I?LH蓥H9u91LLAׅxKHL蚠HuH荣HMHmuiH$@dH3 %(H@[]A\A]A^A_HپHBIH H81nH "H=BH0rfDH=@DJ1TSUAhSHHx/9w@HEHfWfDEu1H[]fDHIcH蹢H H=BH81莥E11bfHAL$ HL$ DHff.@HAfL$ HL$ Hff.HAL$ HL$ Hff.@U#SHH(dH%(H$1HHH@t$HrHH$CCC D$h;1ɺHH$dH3 %(u H([]腞DHAHL$HL$Hff.AUAATAUHHSHHHHD[DD@H]A\A]ff.@AUATUHSYHx9wRILcHALL胠E1D)xLH舞E1]H[]A\A]DH H@H81)fSE11ɍXHH[ÐPHH)f>f.AUAATAUHSHXHDDHHH[]A\A]ff.fSHHH)HfH`[ff.D@A9w*HfPfHf1fDHHU H>H81HUA@SHH?9wNHAhfWf/Eu**f1H[]f.HIcHqH H>H81PfHAL$ HL$ DHff.@HAfL$ HL$ Hff.HAHL$HL$Hff.SE11ɃHHfK[%HH)f@AUEATAUHՍV1SHc҉HHV~qIEAfvw9|sD'fD)HŃ~@EAfvI9|EU!D9IH:uăH*)HŃu H1[]A\A]DEH پH :H81苟H1[]A\A]ff.E1@~UDEfAvRD9|MF9u'rf.DEfAv+D9|&F9tMAAD)L΃҅u1DHH< ѾHV9H81Ԟ1HDH@LcHL9rMHH9sHHc1H詙1HfHA Hf.AWAVAUATLgUSHH|$dH%(HD$x1L$$HH_WfQH9HHL=\;@AL$H1H8Ml$ĝA$HHHAL$fH9LLt$f.HSAL HD$HtIx@IcL>DL7fKH8H1HD$PHtHH8H1HD$XHtHH7H1͜HD$ Ht(HT$(HtHHLBHH71蛜HD$0Ht(HT$8HtHHLBHH71iHD$@HtHH7H1FHD$HHtHH7H1#A$L%HHH)HTHv fv H9gH$%IHD$L)HTHvA$fv H9HD$xdH3%(HĈ[]A\A]A^A_L6D@LE64@L6$@L5@L5@L5@L5@L5@L5@L5@L5@Lg5@LS5@L?5t@Ldϔff.@H(IAɹ#dH%(H$1HHA8@t$HHzT$H$A@DL$A@A@ D$貔H$dH3%(uH(2ffDUSHox 1H[]H辒HډfATUHSI膒HڅI1uA$1[]A\UHSHHhdH%(HD$X1[1H HHgHHH|$Ht%H|$(t諙H|$(EKEHT$XdH3%(uHh[]ATIUSH轖 H蝖x2Ńtt4I[]A\fDH+y[]A\DH yDUSHdH%(HD$1D$HHt?Hl$ HHH H߹11H膒x"HL$dH3 %(HuH[]H1膖ϑff.@AVAAUAATIULS1fDpHfDhHH߉CHLH3H[]A\A]A^AWMAVMAUL-) !ATIUHSHHt$ ?D$,fjHcMMAUL$HߋT$賗ZY~LHH菕H[]A\A]A^A_ff.ATIUSHHdH%(HD$1贕 H=ΓHCH HHH{1HL$fT$AfD$|LHHiUH;Hk H=~TuH;IL\HSuOHL$dH3 %(u^H[]A\fDƔHfD讔HfH;8H{迍뙸lff.SHH?H{[醍fDSHHHdH %(HL$11@t$fL$HL$DD$A8PSH\$dH3%(uH[׎ODG@xAUIATIUHSHHH?܍xX莓 H=~1HUsMMH}1҅xMH[]A\A]FHH=1ߌH[]A\A]fDÌ8H H1HH H81虓H[]A\A]ATIUHSH赒 H=~ HSsMIH;[]A\~HfAWIAVIAUAATL% UH- SL)H?Ht1LLDAHH9uH[]A\A]A^A_ff.HHUsage: %s [ OPTIONS ] OBJECT { COMMAND | help } %s [ -f[orce] ] -b[atch] filename where OBJECT := { dev | link | resource | system | statistic | help } OPTIONS := { -V[ersion] | -d[etails] | -j[son] | -p[retty] -r[aw]} -%c option requires an argument helpresourcesystemstatistic%s utility, iproute2-%s Unknown option. :Vhdrpjfb:versionjsonprettydetailsrawforcebatch>hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh hhhhhhhhhh6.2.0,-,No device name was supplied Unknown %s '%s'. errorWrong device name Wrong device name - %s Please provide device name. >drv_%s%s %d %s 0x%x %s %u %s %ld %s 0x%lx %s %lu No filter data was supplied to filter option %s There is filter option without data %s filter accepts "%s" characters only Unsupported filter option: %s Found key, but failed to allocate memory to store value This tool doesn't support switches yet Failed to open NETLINK_RDMA socket Failed to send to socket with err %d `        adaptive-moderationparameterUsage: %s dev show [DEV] /var/run/netnsunknownUNKNOWN%s, %u: ifindex%s: ifnamenode_type %s node_typefw %s %04x:%04x:%04x:%04xnode_guid %s node_guidsys_image_guid %s sys_image_guidadaptive-moderation %s caps: <capsshowlistdev commandSG_GAPS_REGVIRTUAL_FUNCTIONRAW_SCATTER_FCSRDMA_NETDEV_OPA_VNICPCI_WRITE_END_PADDINGRESIZE_MAX_WRBAD_PKEY_CNTRBAD_QKEY_CNTRRAW_MULTIAUTO_PATH_MIGCHANGE_PHY_PORTCURR_QP_STATE_MODSHUTDOWN_PORTINIT_TYPEPORT_ACTIVE_EVENTSYS_IMAGE_GUIDRC_RNR_NAK_GENSRQ_RESIZEN_NOTIFY_CQLOCAL_DMA_LKEYMEM_WINDOWUD_IP_CSUMUD_TSOXRCMEM_MGT_EXTENSIONSBLOCK_MULTICAST_LOOPBACKMEM_WINDOW_TYPE_2AMEM_WINDOW_TYPE_2BRC_IP_CSUMRAW_IP_CSUMCROSS_CHANNELMANAGED_FLOW_STEERINGSIGNATURE_HANDOVERON_DEMAND_PAGINGcaswitchrouterrnicusnicusnic_udpunspecified %s dev set [DEV] name DEVNAME %s dev set [DEV] netns NSNAME %s dev set [DEV] adaptive-moderation [on|off] Cannot open network namespace "%s": %s Please provide device new name. UD_AV_PORT_ENFORCE_PORT_ENFORCEUsage: %s link delete NAME Unknown parameter %s netdevnetdev_index %u link %s/subnet_prefix %s subnet_prefixsm_lid %u sm_lidlmc %u lmcphysical_state %s physical_statenetdev %s netdev_indexadddeletelink commandSET_NODE_DESCEXT_INFOVIRTSWITCH_POR_STATE_TABLELINK_WIDTH_2XLINK_SPEED_HDRRESERVEDSMOPT_IPDAUTO_MIGRSL_MAPMKEY_NVRAMPKEY_NVRAMLED_INFOSM_DISABLEDPKEY_SW_EXT_PORT_TRAPCABLE_INFOEXTENDED_SPEEDSCAP_MASK2CMSNMP_TUNNELREINITDEVICE_MGMTVENDOR_CLASSDR_NOTICECAP_MASK_NOTICEBOOT_MGMTLINK_LATENCYCLIENT_REGOTHER_LOCAL_CHANGESLINK_SPPED_WIDTHVENDOR_SPECIFIC_MADSMULT_PKER_TRAPMULT_FDBHIERARCHY_INFONOPSLEEPPOLLINGARMEDLINK_UPLINK_ERROR_RECOVERPHY_TESTOPA_OFFLINEOPA_TESTDOWNACTIVEACTIVE_DEFERUsage: %s link show [DEV/PORT_INDEX] Usage: %s link add NAME type TYPE netdev NETDEV Please provide a link name to add. Please provide a link type name. Please provide a net device name. Usage: %s resource qpcm_idcqmrpdsrqDRIVER[%s]comm %s %s/%d%s/-link %s qp-type %s qp-typeresource commandSMIGSIUCUDRAW_IPV6RAW_ETHERTYPERAW_PACKETXRC_INIXRC_TGTpidsrqnpdncqnlqpnctxnrqpnsq-psnrq-psnpath-mig-statedev-typetransport-typesrc-addrsrc-portdst-addrdst-portcm-idnuserspoll-ctxmrlenmrn resource show [DEV] resource show [qp|cm_id|pd|mr|cq|ctx|srq] resource show qp link [DEV/PORT] resource show qp link [DEV/PORT] [FILTER-NAME FILTER-VALUE] resource show cm_id link [DEV/PORT] resource show cm_id link [DEV/PORT] [FILTER-NAME FILTER-VALUE] resource show cq link [DEV/PORT] resource show cq link [DEV/PORT] [FILTER-NAME FILTER-VALUE] resource show pd dev [DEV] resource show pd dev [DEV] [FILTER-NAME FILTER-VALUE] resource show mr dev [DEV] resource show mr dev [DEV] [FILTER-NAME FILTER-VALUE] resource show ctx dev [DEV] resource show ctx dev [DEV] [FILTER-NAME FILTER-VALUE] resource show srq dev [DEV] resource show srq dev [DEV] [FILTER-NAME FILTER-VALUE] local_dma_lkeyunsafe_global_rkeyiovaDIRECTcqepoll-ctx %s SOFTIRQUNBOUND_WORKQUEUE%s:%u %s:IPoIBTCPUDP---ps %s IDLEADDR_QUERYADDR_RESOLVEDROUTE_QUERYROUTE_RESOLVEDDISCONNECTADDR_BOUNDLISTENDEVICE_REMOVALDESTROYINGMIGRATEDrqpn %d rq-psn %d path-mig-state %s RESETRTRRTSSQDSQEERRREARMnetns %s copy-on-fork %s copy-on-forkexclusivesharedsystem commandUsage: %s system show [ netns ] %s system set netns { shared | exclusive } Usage: %s system set [PARAM] value system set netns { shared | exclusive } valid options are: { shared | exclusive } supportedmodeunbindauto %s statistic show where OBJECT: = { qp } CRITERIA : = { type } Examples: %s statistic qp show %s statistic qp mode %s statistic mode supported optional-counterscntnUnknown auto mode '%s'. Unknown parameter '%s'. on offmode %s cntn %u LQPN: <unsetstatistic commandUsage: %s [ OPTIONS ] statistic { COMMAND | help } %s statistic OBJECT show %s statistic OBJECT show link [ DEV/PORT_INDEX ] [ FILTER-NAME FILTER-VALUE ] %s statistic OBJECT mode %s statistic OBJECT set COUNTER_SCOPE [DEV/PORT_INDEX] auto {CRITERIA | off} %s statistic OBJECT bind COUNTER_SCOPE [DEV/PORT_INDEX] [OBJECT-ID] [COUNTER-ID] %s statistic OBJECT unbind COUNTER_SCOPE [DEV/PORT_INDEX] [COUNTER-ID] %s statistic show link [ DEV/PORT_INDEX ] %s statistic mode [ supported ] %s statistic mode [ supported ] link [ DEV/PORT_INDEX ] %s statistic set link [ DEV/PORT_INDEX ] optional-counters [ OPTIONAL-COUNTERS ] %s statistic unset link [ DEV/PORT_INDEX ] optional-counters COUNTER_SCOPE: = { link | dev } FILTER_NAME: = { cntn | lqpn | pid } %s statistic qp show link mlx5_2/1 %s statistic qp mode link mlx5_0 %s statistic qp set link mlx5_2/1 auto type on %s statistic qp set link mlx5_2/1 auto off %s statistic qp bind link mlx5_2/1 lqpn 178 %s statistic qp bind link mlx5_2/1 lqpn 178 cntn 4 %s statistic qp unbind link mlx5_2/1 cntn 4 %s statistic qp unbind link mlx5_2/1 cntn 4 lqpn 178 %s statistic show link mlx5_2/1 %s statistic mode link mlx5_2/1 %s statistic mode supported %s statistic mode supported link mlx5_2/1 %s statistic set link mlx5_2/1 optional-counters cc_rx_ce_pkts,cc_rx_cnp_pkts %s statistic unset link mlx5_2/1 optional-counters The parameter %s shouldn't include range BASIC%s%d%s%d-%dTM/sys/class/net/%s/%sfopen %s: %s strtol %s: %sFailed to parse %s msecmsecsdefaultallanyCannot find device "%s" HZPROC_NET_PSCHEDPROC_ROOT%s/net/psched%*08x%*08x%08x%08x???inetinet6mplsbridgeany valid%x%s\%03o%Y-%m-%dT%H:%M:%S[%s.%06ld] Timestamp: %s %ld usec NONElink_index%s@%sMissing continuation line Out of memory \ Unterminated quoted string Timestamp: %s %lu us usecusecs%.3gs%.3gms%uusnsecnsecs%.3gus%lldnsCommand failed %s:%d "%s", not "%s" [%d]could not build pathname for property property "%s" in file %s is currently unknown value "%s" in file %s is not a number Error: an IP address is expected rather than "%s" Command line is not complete. Try option "help" Error: argument "%s" is required Error: argument "%s" is wrong: %s Error: duplicate "%s": "%s" is the second value. Error: either "%s" is duplicate, or "%s" is a garbage. BUG: device with ifindex %d has nil ifname Error: %s address is expected rather than "%s". Error: "%s" may be inet prefix, but it is not allowed in this context. Error: %s prefix is expected rather than "%s". Too many arguments to command Cannot open file "%s" for reading: %s Error: argument of "%s" must be one of 22222222222222222222222222222 @@.AeA/proc/net/psched 0x%x %s 0x%x %s #%d %s %d %s #/etc/iproute2/rt_protos/etc/iproute2/rt_protos.d.conf/etc/iproute2/rt_protos.d/%s/etc/iproute2/rt_tables/etc/iproute2/rt_tables.d/etc/iproute2/rt_tables.d/%s/etc/iproute2/rt_scopes/etc/iproute2/rt_realms/etc/iproute2/rt_dsfield0x%02x/etc/iproute2/group/etc/iproute2/nl_protosrtnlunusedusersocktcpdiagnflogxfrmselinuxiscsiauditfiblookupconnectornftip6fwdec-rtueventgenlscsi-transecryptfsrdmacryptolocalmainglobalsitehostnowhereunspecredirectkernelbootstaticgatedmrtzebrabirddnroutedxorpntkdhcpkeepalivedbabelbgpisisospfripeigrpDatabase %s is corrupted at %s /etc/iproute2/protodown_reasons.d/etc/iproute2/protodown_reasons.d/%sif%u*Cannot send dump requestDump terminated :%02x"%s" is invalid lladdr. %xjson object%s %%u%s %%struefalse%#llx%llu%.0f%s%sbitCOLORFGBG-coloralwaysnever /proc/mounts%*s %4095s %127s %*s %*d %*d strdup failed copying pathmkdir failed for %s: %s Failed to find cgroup2 mount /var/run/cgroup2noneFailed to mount cgroup2: %s Invalid cgroup2 path Failed to open cgroup2 mount Failed to get cgroup2 ID: %s Invalid size of cgroup2 ID Invalid cgroup2 ID Failed to open cgroup2 by ID /proc/self/fd/%d/proc/%s/statusName:/proc/%d/commFailed to open mounts file: %s Failed to allocate memory for cgroup2 path Failed to setup cgroup2 directory Failed to mount cgroup2. Are CGROUPS enabled in your kernel? Failed to read value of symbolic link %s Error: too many labels. json_writer.cself->depth > 0\t\n\r\f\b\\\"self->depth == 0null%g%hhu%hu%lu%lx%ldjsonw_endjsonw_destroyErrorWarningInvalid extack attribute EOF on netlink Cannot talk to rtnetlinksender address length == %d Truncated message !!!malformed message: len=%d ERROR truncated RTNETLINK answers: %s Unexpected reply!!! Message truncated !!!Remnant of size %d DONE truncated RTNETLINK answersCannot open netlink socketSO_SNDBUFSO_RCVBUFCannot bind netlink socketCannot getsocknameWrong address length %d Wrong address family %d NETLINK_LISTEN_ALL_NSIDSender address length == %d rtnl_from_file: fread!!!Deficit %d, rta_len=%d U8U16U32U64FLAGNESTEDNESTED_ARRAYNUL_STRINGBINARYS8S16S32S64BITFIELD32 policy[%u]:attr[%u]: type=%s policy:%u maxattr:%u range:[%lld,%lld] range:[%llu,%llu] min len:%u max len:%uextack attribute %d failed validation netlink receive error %s (%d) malloc error: not enough buffer Invalid offset for NLMSGERR_ATTR_OFFS Error: Buffer too small for object. Dump was interrupted and may be inconsistent. rtnl-from_file: truncated message !!!malformed message: len=%d @%lu addattr_l ERROR: message exceeded bound of %d addraw_l ERROR: message exceeded bound of %d rta_addattr32: Error! max allowed bound %d exceeded rta_addattr_l: Error! max allowed bound %d exceeded Pp`P@0 Failed to send datakernel answers: %s ;|Q$LZL c9\@9|A4:AL:B:B:C:lC:C ; D ;Md>O>O>,QH?Q?ET G Y }>ET G Y }8AfL }FJG B(A0A8G  8A0A(B BBBA @ xFJE D(D0G@y 0A(A BBBK 0P FDC G0s  AABE  Ѐ ܀EG r AA HEG r AA EG r AA ( EDD0} AAA (0 EDD0} AAA \ EG r AA ( tEDD0} AAA  8 ED0o AG  DEgH=FNL E(NqH]A\ (A ABBD L؅Q(`$QJJS INKXAJeHp A LBBB B(A0D8D 8A0A(B BBBI 0,FIF G|  AABD P`$YFJG B(A0A8G   8A0A(B BBBA L0BBB B(A0A8G 8A0A(B BBBF 8FJA A(L (A ABBK P@ԎFJB B(F0A8G h 8A0A(B BBBD L0BBB B(A0A8G 8A0A(B BBBE 8pFJA A(L (A ABBK P DFJB B(F0A8G h 8A0A(B BBBD 4tuBDD w AMA \FBDBQD I(LpWxAIxDp_ (A ABBA L`BEB B(A0D8J9 8A0A(B BBBC 0DFIF G  AABF Px,|FJG B(A0A8G = 8A0A(B BBBG HXBEE B(D0C8JG 8A0A(B BBBH 8ܡ2FJA A(L (A ABBA LTFJB B(F0A8G ] 8A0A(B BBBG H`u A kHP] A HHEB|JHA mEQ P AA 4K D (PԦEAG0 AAB |Hp A (H`u A H`u A H A H`u A  K A ( H`u A DH`u A `H`u A |hHP^ J ܬH`u A PH`u A ĭHp A HT`(l<xPdx0BNC G0  AABA (\AMG0 AAA ?E9L0\FJG B(A0A8G  8A0A(B BBBH AA{LHBJB B(A0A8G  8A0A(B BBBG  EG r AA 8\nED k AK \nED k AK nED k AK @ED o AG ED k AK xED o AG $<ET G W(0DADG0p AAB ,\ػ:EC DHM G GEG0H AK HFBB B(A0A8GPY 8A0A(B BBBH <xBBE A(D0E (D BBBC H<XFJB G(A0A8G  8A0A(B BBBB EG0 AE LHFJB G(A0A8G+ 8A0A(B BBBI L\FBE H(D0A8G 8A0A(B BBBG LLFJG B(A0A8G5 8A0A(B BBBA 0h,FIA L  AABJ d"K A HpBEE D(D0} (C BBBF \(A DBB0@FIF G|  AABD LtpYFJG B(A0A8G   8A0A(B BBBA LBBB B(A0A8DE 8A0A(B BBBC 0FIF G|  AABD PHLYFJG B(A0A8G   8A0A(B BBBA ,Xo AC BEO B 0FIF G|  AABD PYFJG B(A0A8G   8A0A(B BBBA T 0hQAAD w FAD DCAPEFQJ D(A0G\ANA 0A(A BBBE F(EAD0q AAC 09(DEAD0f AAF @p$bFEE I(D0DP 0A(A BBBA 0PFAA D0a  AABG   ( EAD0e AAG (< EAD0d AAH 8h |FEA D(G@v (A ABBE 0 FDD G0u  AABB |]EG J AA MEG z AA !QEG ~ AA 8D! FED A(FP (A ABBA !$8!FBE D(JP (A ABBE 0!4BFD Gz  AABG 8"FEI G(D@Q (A ABBJ @"dHR X"ER} AA |"X4EAU"|4EAP"7EAK"7EAK"7EAK# 2Hi #4/EW L F@#D4T#P?FGD N ABF SAB#X]E` K #B0#KEDQ T CAF DIAH#FEI E(F0L (D ABBD D(G DBB(<$8EAGc AAF (h$EHG^ AAD $0HN$8$$$|J($`EDF M CAA ((%EDD T CAA dT%PFEB E(D0D8Fp 8O0A(B BBBE 8 8A0A(B BBBF %D%FBB B(A0A8DPs8A0A(B BBBH&FBB E(A0C8G 8A0A(B BBBA 8d&jMFD x FBI ACBAX&FEN B(D0D8FPSXN`qXAPIXe`P8F0A(B BBBP&XOBI B(D0D8J@Z 8A0A(B BBBF P(P'EFD` AAG P|'hFBE A(D0F 0A(A BBBE WJ_AL'FEB B(A0D8Dg 8A0A(B BBBG H (dFEB B(A0A8D@ 8C0A(B BBBA 0l(8FAD D0k  AABA (-Eg8(FBG D(D@ (A ABBA (<.( )XeEJJ AAD H8)eFHD A(G0Q (D ABBD c(D ABBH)aFED D(D0Y (D ABBG W(D ABB )ED m AI 0)pFDD G@P  AABG (*KI D i G 0L*xFDD G@P  AABG *dIT C YP*FBB B(A0A8G I 7 8A0A(B BBBA H*l FBE E(A0A8DP 8D0A(B BBBK D+@&H]H\+XFBE B(A0A8Dp 8A0A(B BBBG +$4+`JAG l FAK GAAA+0B,lB,B$0,,ECF YCA(X,:FFD _ ABA , &H], , 1,@ ,L ',h ~Le G EL - FEB D(A0w (A BFFH N(A DBEH\- IBLE E(D0A8G 8A0A(B BBBD H- BJL E(A0A8G 8A0A(B BBBD L- )BBB B(A0A8G I  8A0A(B BBBA LD. BBB B(A0A8G I  8A0A(B BBBA H.` BGE L(A0A8G 8A0A(B BBBD P.4DBBB B(A0A8G I  8A0A(B BBBA <4/0FAA G0m  AABH P DABHt/FEE B(A0A8DP 8A0A(B BBBH H/dFEA D(F@l (A ABBH ^(D ABBH 0GFEE B(A0A8DP 8A0A(B BBBH HX0FEA D(F@l (A ABBH ^(D ABBH0PGFEE B(A0A8DP 8A0A(B BBBH 80TFJD X ABA N EBK H,1FEB B(D0A8DP 8A0A(B BBBC ,x1cMHG N AAD p41oFNF ~ ABE KABH1JFEE B(A0A8DP 8A0A(B BBBH H,21FEB B(D0A8DP 8A0A(B BBBC (x2FJD ~ ABK <2EGF0v AAF d DAG RDAH20GFEE B(A0A8DP 8A0A(B BBBH P034FAA D0X  CABF t  CABF f  CABD L3!FEE B(A0A8DP 8A0A(B BBBK 3L$3AADD uAA4)H$40BBH E(A0D8D@ 8D0A(B BBBF <p4RBE A(D0n(A ABBFL4DxFBB B(A0A8G' 8A0A(B BBBA <5t-BNA C(G  (A ABBA @5d;Hr(X5FAA } ABH 5 N5\ N05 FAA F0t  AABJ 5D!b5!Qp A 6"FBB E(A0A8DPi 8J0F(B BBBJ  8A0A(B BBBC j 8A0A(B BBBL L 8J0F(B BBBL Y 8J0F(B BBBO H6d#FBB H(A0D8Nc 8A0A(B BBBF 7$tPh H Y E 07$%D7 %1TP\7H% p7D%!7`%`7\%BEE E(D0C8G@j 8C0A(B BBBK e 8C0A(B BBBO 7% 8%:Eh K A08%0HM K K<P8%zEDF m AAJ R AAD DIH<8&jEDF ` AAG K AAK DIH\8D&FEE D(D0h (C BBBG V (G EEDE I(C BBB\09&FEE D(D0h (C BBBG V (G EEDE I(C BBB\9&FEE D(C0j (C BBBF \ (D BEDE H(C BBB\9'FEE D(C0j (C BBBF \ (D BEDE H(C BBB\P:D'FEE D(D0h (C BBBG V (G EEDE I(C BBB\:'FEE D(D0h (C BBBG V (G EEDE I(C BBB\;'FEE D(D0h (C BBBG V (G EEDE I(C BBB\p;(FEE D(D0h (C BBBG V (G EEDE I(C BBBX;D(FED D(F@r (C ABBE h (F ABBE I(C ABB0,<(|FNP GpG  AABA l`<(FEE D(D0t (C BBBK V (G EEDE I (C BBBF L(C BBB0<4)|FNP GpG  AABA =)"=)"@,=)FEE D(D0FC 0A(A BBBG @p=d*FEE D(D0FC 0A(A BBBG \= +FEE D(D0e (C BBBJ V (G EEDE F(C BBB>P+((>l+-L<>+FBL E(D0C8G` 8A0A(B BBBD >,Xe C i(>h-EC I2 E 4>.jFDD G#  AABD ?0$? 0<@D>>Es A \D(>.ET G I|D8>TEr I (D|>:EDG Q GAG D>'D>D>E>E>(E>PE>dE?xE>E?E?$E ?&EDG IGA$E(?%EDF IGAF0?*EG UD$$F@?$ECG IFA$LFH?&EDG IGA$tFP?&EDG IGA$FX?%EDF IGA$F`?%EDF IGA$Fh?&EDG IGA$Gp?&EDG IGA$EAD M AAA (RfOFAD v ABD (RfEDG AAA 4S`g{FDA s ABG R FBF ( `,:YӼ*$K쉿26ĺ3ՅDݗ@mh.G}05d(G4B!FZbw_; GBv5:m1_ .fʂFi#G^b(NfƳ,Fei =:sw9t/LDx -Fm&99eOGVS\b 2ފ[|LD]maǚ]7 ^8`M<88fӺQm7:hRo Xh CZDtA C0D*E\1orv:W(7R,&}BF=x#9'zuiڊBB9°}&$rIkd tz8^eܖoq:S' |D6lAk= ꭉVITA:GHW݈֭k[^NNI%l5&o=F)rlaeYtpsNP4%˛ LG@ Wb Hq;9@XWR !"qԤjX[M @Y#c)vWDUѯ)jqHWkX2JX fѰVC^Na_2c Uع`!qխ8i}&".8RPeVOF38.Vrj>j"}C[jFwg&(,ptߜo?$(EUH;@.*ur#yOu5V+lGd2h\g%ZzZ_ly1Tˢi'Lx3%}}\JUf>~$ovOknHY{2QO7 xE!<,| S0|BS\PHȧ8YKGV^KU?!Z>ƻ+< 3;Ih8}|<,a*e% ocǍZTwAX9ԈMGƯPo bpk}(κA!u+ħ{M.d[EvIǽŞ]DUAE7`FzͧH0>O}+r <?5)IpbjO"0 Hhou/.85CAػM6fXdpJl)ă.cH [[U5ʂi_'Y٫d jĎv/Fl:aa0ΟT0re 3j\Qo+J ;.좲Ľ{Vj&YñXxQ5t2J8}Bmm /׳@IWPBX&Ej0U7jqBU1TŅ]sDCGhԄ[>K@SOϏǪHWW bɳ֮M7&-cCt!4u)*Xh›$CLbj,<85H H) ?Tt6~(:t(ZpY6}OVt&2G5:Ig@+x_f epKJ}5/㠦D ^|e=T)ϵ@8tUA&NvrOkG[PusWsb:9)9e"Mzʯ#!ޑ)5-ڵ}z$!&pX!hgi+ ݱЩ6snQ;ϬQpdg G+BmWA%N엲 KDֹCu`[2פNY1X XfBE^FusÐ5F"Ќeito wA>?+nDLj+ۧt0B'n@.J"+R((2|p٦E4dhaA^_T S!9F#B༩ wӉJ,46i +Yw7=,ģ'Pb(A%Odh_EF34]w9b_vH{6JB z4Dv=biλ"}x3Ӯou]DkO,t.֨;ݫ6$H=HP}q/K4K'A{mub'TX[0EP `j|n29hl(ZEIť- Kzmv L=?gJަjX`y< cN肎rB@O*]^8cō! ,9ng/vQ]X&6>yGu= 1( GB;j~K'*alA  i lp!sWQP,R"uA9<),U[1 u_:|9~_8M -oăBFԛT#\ԑg?Xs/1{UMOFu2$W? ۅQػ04}ɐI;䞓k)T/vF 5(C$M9U^ 3.d 4y<ֽ0Vi")Px^ҳ`d&FT"-QJRv.Xɒ { '^]ּ|ȇWa$F(.;9Ne6$?+n/v3XS ^:J /MMzI*ISj cڙelJϙGh?8C{O;f|b0]QVcp$cksBvftVX;2:׌'QJ6;R+ݸ]Bdc$}dmQƼ⏋2eFG-\B mK<_^)ֺ']'Wo<"Yf~dOatdG by@gh97<0r]FÏmS#vNb2-kD,Cm4%lI@y[xVjuR%aH]sDOU6C@ ٤u /#a(|}|Vn&47Vc3a Ο.ZaDؽ=n}ґ)HT4Gxs3Ex>}GgojJiDvht MoC%cTHUmu2N] rryĀD92ݞt0GM#]iaZr&s{MBŤ| g À"> d-?)95S9 v??7ڇpXG`}"ox\-7zy "Zrnu Gx P(_3?)A ٢WIlrb |M\9+2?췧Y0qdPٹ_.LD$ˢeНL37F~C&-Lؐ{f J/&@)L(?s6˔:_ ΝdQ-"ض₏KveEnׄFNcYѝ]w8T.DnP86AoLl 7ivc>dnuV4mTkmF*bZ-ٖf̑<;[]TKZȉVo@,z谏+﨑\;.Xt/dR'wl7*dR6E q-r  YD1gn%?o99ƌ2+3mWgYZ.shstrtab.interp.note.gnu.property.note.ABI-tag.note.gnu.build-id.gnu.hash.dynsym.dynstr.gnu.version.gnu.version_r.rela.dyn.rela.plt.init.plt.sec.text.fini.rodata.eh_frame_hdr.eh_frame.init_array.fini_array.data.rel.ro.dynamic.got.data.bss.gnu.build.attributes.gnu_debuglink.gnu_debugdata  & 4$Go00DQ xxpYHao004nohh}B77 DDEEMMVVUl   t0 hU]"]]"]]"]@+ "@@"@"@9 @"@L c@0 p(/>qedr-abi.h000064400000010323152526504440006407 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* QLogic qedr NIC Driver * Copyright (c) 2015-2016 QLogic Corporation * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and /or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef __QEDR_USER_H__ #define __QEDR_USER_H__ #include #define QEDR_ABI_VERSION (8) /* user kernel communication data structures. */ enum qedr_alloc_ucontext_flags { QEDR_ALLOC_UCTX_EDPM_MODE = 1 << 0, QEDR_ALLOC_UCTX_DB_REC = 1 << 1, QEDR_SUPPORT_DPM_SIZES = 1 << 2, }; struct qedr_alloc_ucontext_req { __u32 context_flags; __u32 reserved; }; #define QEDR_LDPM_MAX_SIZE (8192) #define QEDR_EDPM_TRANS_SIZE (64) #define QEDR_EDPM_MAX_SIZE (ROCE_REQ_MAX_INLINE_DATA_SIZE) enum qedr_rdma_dpm_type { QEDR_DPM_TYPE_NONE = 0, QEDR_DPM_TYPE_ROCE_ENHANCED = 1 << 0, QEDR_DPM_TYPE_ROCE_LEGACY = 1 << 1, QEDR_DPM_TYPE_IWARP_LEGACY = 1 << 2, QEDR_DPM_TYPE_ROCE_EDPM_MODE = 1 << 3, QEDR_DPM_SIZES_SET = 1 << 4, }; struct qedr_alloc_ucontext_resp { __aligned_u64 db_pa; __u32 db_size; __u32 max_send_wr; __u32 max_recv_wr; __u32 max_srq_wr; __u32 sges_per_send_wr; __u32 sges_per_recv_wr; __u32 sges_per_srq_wr; __u32 max_cqes; __u8 dpm_flags; __u8 wids_enabled; __u16 wid_count; __u16 ldpm_limit_size; __u8 edpm_trans_size; __u8 reserved; __u16 edpm_limit_size; __u8 padding[6]; }; struct qedr_alloc_pd_ureq { __aligned_u64 rsvd1; }; struct qedr_alloc_pd_uresp { __u32 pd_id; __u32 reserved; }; struct qedr_create_cq_ureq { __aligned_u64 addr; __aligned_u64 len; }; struct qedr_create_cq_uresp { __u32 db_offset; __u16 icid; __u16 reserved; __aligned_u64 db_rec_addr; }; struct qedr_create_qp_ureq { __u32 qp_handle_hi; __u32 qp_handle_lo; /* SQ */ /* user space virtual address of SQ buffer */ __aligned_u64 sq_addr; /* length of SQ buffer */ __aligned_u64 sq_len; /* RQ */ /* user space virtual address of RQ buffer */ __aligned_u64 rq_addr; /* length of RQ buffer */ __aligned_u64 rq_len; }; struct qedr_create_qp_uresp { __u32 qp_id; __u32 atomic_supported; /* SQ */ __u32 sq_db_offset; __u16 sq_icid; /* RQ */ __u32 rq_db_offset; __u16 rq_icid; __u32 rq_db2_offset; __u32 reserved; /* address of SQ doorbell recovery user entry */ __aligned_u64 sq_db_rec_addr; /* address of RQ doorbell recovery user entry */ __aligned_u64 rq_db_rec_addr; }; struct qedr_create_srq_ureq { /* user space virtual address of producer pair */ __aligned_u64 prod_pair_addr; /* user space virtual address of SRQ buffer */ __aligned_u64 srq_addr; /* length of SRQ buffer */ __aligned_u64 srq_len; }; struct qedr_create_srq_uresp { __u16 srq_id; __u16 reserved0; __u32 reserved1; }; /* doorbell recovery entry allocated and populated by userspace doorbelling * entities and mapped to kernel. Kernel uses this to register doorbell * information with doorbell drop recovery mechanism. */ struct qedr_user_db_rec { __aligned_u64 db_data; /* doorbell data */ }; #endif /* __QEDR_USER_H__ */ rdma_user_ioctl.h000064400000007247152526504440010111 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2016 Mellanox Technologies, LTD. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef RDMA_USER_IOCTL_H #define RDMA_USER_IOCTL_H #include #include #include /* Legacy name, for user space application which already use it */ #define IB_IOCTL_MAGIC RDMA_IOCTL_MAGIC /* * General blocks assignments * It is closed on purpose - do not expose it to user space * #define MAD_CMD_BASE 0x00 * #define HFI1_CMD_BAS 0xE0 */ /* MAD specific section */ #define IB_USER_MAD_REGISTER_AGENT _IOWR(RDMA_IOCTL_MAGIC, 0x01, struct ib_user_mad_reg_req) #define IB_USER_MAD_UNREGISTER_AGENT _IOW(RDMA_IOCTL_MAGIC, 0x02, __u32) #define IB_USER_MAD_ENABLE_PKEY _IO(RDMA_IOCTL_MAGIC, 0x03) #define IB_USER_MAD_REGISTER_AGENT2 _IOWR(RDMA_IOCTL_MAGIC, 0x04, struct ib_user_mad_reg_req2) /* HFI specific section */ /* allocate HFI and context */ #define HFI1_IOCTL_ASSIGN_CTXT _IOWR(RDMA_IOCTL_MAGIC, 0xE1, struct hfi1_user_info) /* find out what resources we got */ #define HFI1_IOCTL_CTXT_INFO _IOW(RDMA_IOCTL_MAGIC, 0xE2, struct hfi1_ctxt_info) /* set up userspace */ #define HFI1_IOCTL_USER_INFO _IOW(RDMA_IOCTL_MAGIC, 0xE3, struct hfi1_base_info) /* update expected TID entries */ #define HFI1_IOCTL_TID_UPDATE _IOWR(RDMA_IOCTL_MAGIC, 0xE4, struct hfi1_tid_info) /* free expected TID entries */ #define HFI1_IOCTL_TID_FREE _IOWR(RDMA_IOCTL_MAGIC, 0xE5, struct hfi1_tid_info) /* force an update of PIO credit */ #define HFI1_IOCTL_CREDIT_UPD _IO(RDMA_IOCTL_MAGIC, 0xE6) /* control receipt of packets */ #define HFI1_IOCTL_RECV_CTRL _IOW(RDMA_IOCTL_MAGIC, 0xE8, int) /* set the kind of polling we want */ #define HFI1_IOCTL_POLL_TYPE _IOW(RDMA_IOCTL_MAGIC, 0xE9, int) /* ack & clear user status bits */ #define HFI1_IOCTL_ACK_EVENT _IOW(RDMA_IOCTL_MAGIC, 0xEA, unsigned long) /* set context's pkey */ #define HFI1_IOCTL_SET_PKEY _IOW(RDMA_IOCTL_MAGIC, 0xEB, __u16) /* reset context's HW send context */ #define HFI1_IOCTL_CTXT_RESET _IO(RDMA_IOCTL_MAGIC, 0xEC) /* read TID cache invalidations */ #define HFI1_IOCTL_TID_INVAL_READ _IOWR(RDMA_IOCTL_MAGIC, 0xED, struct hfi1_tid_info) /* get the version of the user cdev */ #define HFI1_IOCTL_GET_VERS _IOR(RDMA_IOCTL_MAGIC, 0xEE, int) #endif /* RDMA_USER_IOCTL_H */ bnxt_re-abi.h000064400000006672152526504440007131 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR BSD-2-Clause) */ /* * Broadcom NetXtreme-E RoCE driver. * * Copyright (c) 2016 - 2017, Broadcom. All rights reserved. The term * Broadcom refers to Broadcom Limited and/or its subsidiaries. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * BSD license below: * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * 1. Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * 2. Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * * THIS SOFTWARE IS PROVIDED BY THE AUTHOR AND CONTRIBUTORS ``AS IS'' * AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, * THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR * PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE AUTHOR OR CONTRIBUTORS * BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR * CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF * SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR * BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, * WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE * OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN * IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. * * Description: Uverbs ABI header file */ #ifndef __BNXT_RE_UVERBS_ABI_H__ #define __BNXT_RE_UVERBS_ABI_H__ #include #define BNXT_RE_ABI_VERSION 1 #define BNXT_RE_CHIP_ID0_CHIP_NUM_SFT 0x00 #define BNXT_RE_CHIP_ID0_CHIP_REV_SFT 0x10 #define BNXT_RE_CHIP_ID0_CHIP_MET_SFT 0x18 enum { BNXT_RE_UCNTX_CMASK_HAVE_CCTX = 0x1ULL, BNXT_RE_UCNTX_CMASK_HAVE_MODE = 0x02ULL, }; enum bnxt_re_wqe_mode { BNXT_QPLIB_WQE_MODE_STATIC = 0x00, BNXT_QPLIB_WQE_MODE_VARIABLE = 0x01, BNXT_QPLIB_WQE_MODE_INVALID = 0x02, }; struct bnxt_re_uctx_resp { __u32 dev_id; __u32 max_qp; __u32 pg_size; __u32 cqe_sz; __u32 max_cqd; __u32 rsvd; __aligned_u64 comp_mask; __u32 chip_id0; __u32 chip_id1; __u32 mode; __u32 rsvd1; /* padding */ }; /* * This struct is placed after the ib_uverbs_alloc_pd_resp struct, which is * not 8 byted aligned. To avoid undesired padding in various cases we have to * set this struct to packed. */ struct bnxt_re_pd_resp { __u32 pdid; __u32 dpi; __u64 dbr; } __attribute__((packed, aligned(4))); struct bnxt_re_cq_req { __aligned_u64 cq_va; __aligned_u64 cq_handle; }; struct bnxt_re_cq_resp { __u32 cqid; __u32 tail; __u32 phase; __u32 rsvd; }; struct bnxt_re_qp_req { __aligned_u64 qpsva; __aligned_u64 qprva; __aligned_u64 qp_handle; }; struct bnxt_re_qp_resp { __u32 qpid; __u32 rsvd; }; struct bnxt_re_srq_req { __aligned_u64 srqva; __aligned_u64 srq_handle; }; struct bnxt_re_srq_resp { __u32 srqid; }; enum bnxt_re_shpg_offt { BNXT_RE_BEG_RESV_OFFT = 0x00, BNXT_RE_AVID_OFFT = 0x10, BNXT_RE_AVID_SIZE = 0x04, BNXT_RE_END_RESV_OFFT = 0xFF0 }; #endif /* __BNXT_RE_UVERBS_ABI_H__*/ rdma_netlink.h000064400000035213152526504440007377 0ustar00/* SPDX-License-Identifier: GPL-2.0 WITH Linux-syscall-note */ #ifndef _RDMA_NETLINK_H #define _RDMA_NETLINK_H #include enum { RDMA_NL_IWCM = 2, RDMA_NL_RSVD, RDMA_NL_LS, /* RDMA Local Services */ RDMA_NL_NLDEV, /* RDMA device interface */ RDMA_NL_NUM_CLIENTS }; enum { RDMA_NL_GROUP_IWPM = 2, RDMA_NL_GROUP_LS, RDMA_NL_NUM_GROUPS }; #define RDMA_NL_GET_CLIENT(type) ((type & (((1 << 6) - 1) << 10)) >> 10) #define RDMA_NL_GET_OP(type) (type & ((1 << 10) - 1)) #define RDMA_NL_GET_TYPE(client, op) ((client << 10) + op) /* The minimum version that the iwpm kernel supports */ #define IWPM_UABI_VERSION_MIN 3 /* The latest version that the iwpm kernel supports */ #define IWPM_UABI_VERSION 4 /* iwarp port mapper message flags */ enum { /* Do not map the port for this IWPM request */ IWPM_FLAGS_NO_PORT_MAP = (1 << 0), }; /* iwarp port mapper op-codes */ enum { RDMA_NL_IWPM_REG_PID = 0, RDMA_NL_IWPM_ADD_MAPPING, RDMA_NL_IWPM_QUERY_MAPPING, RDMA_NL_IWPM_REMOVE_MAPPING, RDMA_NL_IWPM_REMOTE_INFO, RDMA_NL_IWPM_HANDLE_ERR, RDMA_NL_IWPM_MAPINFO, RDMA_NL_IWPM_MAPINFO_NUM, RDMA_NL_IWPM_HELLO, RDMA_NL_IWPM_NUM_OPS }; enum { IWPM_NLA_REG_PID_UNSPEC = 0, IWPM_NLA_REG_PID_SEQ, IWPM_NLA_REG_IF_NAME, IWPM_NLA_REG_IBDEV_NAME, IWPM_NLA_REG_ULIB_NAME, IWPM_NLA_REG_PID_MAX }; enum { IWPM_NLA_RREG_PID_UNSPEC = 0, IWPM_NLA_RREG_PID_SEQ, IWPM_NLA_RREG_IBDEV_NAME, IWPM_NLA_RREG_ULIB_NAME, IWPM_NLA_RREG_ULIB_VER, IWPM_NLA_RREG_PID_ERR, IWPM_NLA_RREG_PID_MAX }; enum { IWPM_NLA_MANAGE_MAPPING_UNSPEC = 0, IWPM_NLA_MANAGE_MAPPING_SEQ, IWPM_NLA_MANAGE_ADDR, IWPM_NLA_MANAGE_FLAGS, IWPM_NLA_MANAGE_MAPPING_MAX }; enum { IWPM_NLA_RMANAGE_MAPPING_UNSPEC = 0, IWPM_NLA_RMANAGE_MAPPING_SEQ, IWPM_NLA_RMANAGE_ADDR, IWPM_NLA_RMANAGE_MAPPED_LOC_ADDR, /* The following maintains bisectability of rdma-core */ IWPM_NLA_MANAGE_MAPPED_LOC_ADDR = IWPM_NLA_RMANAGE_MAPPED_LOC_ADDR, IWPM_NLA_RMANAGE_MAPPING_ERR, IWPM_NLA_RMANAGE_MAPPING_MAX }; #define IWPM_NLA_MAPINFO_SEND_MAX 3 #define IWPM_NLA_REMOVE_MAPPING_MAX 3 enum { IWPM_NLA_QUERY_MAPPING_UNSPEC = 0, IWPM_NLA_QUERY_MAPPING_SEQ, IWPM_NLA_QUERY_LOCAL_ADDR, IWPM_NLA_QUERY_REMOTE_ADDR, IWPM_NLA_QUERY_FLAGS, IWPM_NLA_QUERY_MAPPING_MAX, }; enum { IWPM_NLA_RQUERY_MAPPING_UNSPEC = 0, IWPM_NLA_RQUERY_MAPPING_SEQ, IWPM_NLA_RQUERY_LOCAL_ADDR, IWPM_NLA_RQUERY_REMOTE_ADDR, IWPM_NLA_RQUERY_MAPPED_LOC_ADDR, IWPM_NLA_RQUERY_MAPPED_REM_ADDR, IWPM_NLA_RQUERY_MAPPING_ERR, IWPM_NLA_RQUERY_MAPPING_MAX }; enum { IWPM_NLA_MAPINFO_REQ_UNSPEC = 0, IWPM_NLA_MAPINFO_ULIB_NAME, IWPM_NLA_MAPINFO_ULIB_VER, IWPM_NLA_MAPINFO_REQ_MAX }; enum { IWPM_NLA_MAPINFO_UNSPEC = 0, IWPM_NLA_MAPINFO_LOCAL_ADDR, IWPM_NLA_MAPINFO_MAPPED_ADDR, IWPM_NLA_MAPINFO_FLAGS, IWPM_NLA_MAPINFO_MAX }; enum { IWPM_NLA_MAPINFO_NUM_UNSPEC = 0, IWPM_NLA_MAPINFO_SEQ, IWPM_NLA_MAPINFO_SEND_NUM, IWPM_NLA_MAPINFO_ACK_NUM, IWPM_NLA_MAPINFO_NUM_MAX }; enum { IWPM_NLA_ERR_UNSPEC = 0, IWPM_NLA_ERR_SEQ, IWPM_NLA_ERR_CODE, IWPM_NLA_ERR_MAX }; enum { IWPM_NLA_HELLO_UNSPEC = 0, IWPM_NLA_HELLO_ABI_VERSION, IWPM_NLA_HELLO_MAX }; /* For RDMA_NLDEV_ATTR_DEV_NODE_TYPE */ enum { /* IB values map to NodeInfo:NodeType. */ RDMA_NODE_IB_CA = 1, RDMA_NODE_IB_SWITCH, RDMA_NODE_IB_ROUTER, RDMA_NODE_RNIC, RDMA_NODE_USNIC, RDMA_NODE_USNIC_UDP, RDMA_NODE_UNSPECIFIED, }; /* * Local service operations: * RESOLVE - The client requests the local service to resolve a path. * SET_TIMEOUT - The local service requests the client to set the timeout. * IP_RESOLVE - The client requests the local service to resolve an IP to GID. */ enum { RDMA_NL_LS_OP_RESOLVE = 0, RDMA_NL_LS_OP_SET_TIMEOUT, RDMA_NL_LS_OP_IP_RESOLVE, RDMA_NL_LS_NUM_OPS }; /* Local service netlink message flags */ #define RDMA_NL_LS_F_ERR 0x0100 /* Failed response */ /* * Local service resolve operation family header. * The layout for the resolve operation: * nlmsg header * family header * attributes */ /* * Local service path use: * Specify how the path(s) will be used. * ALL - For connected CM operation (6 pathrecords) * UNIDIRECTIONAL - For unidirectional UD (1 pathrecord) * GMP - For miscellaneous GMP like operation (at least 1 reversible * pathrecord) */ enum { LS_RESOLVE_PATH_USE_ALL = 0, LS_RESOLVE_PATH_USE_UNIDIRECTIONAL, LS_RESOLVE_PATH_USE_GMP, LS_RESOLVE_PATH_USE_MAX }; #define LS_DEVICE_NAME_MAX 64 struct rdma_ls_resolve_header { __u8 device_name[LS_DEVICE_NAME_MAX]; __u8 port_num; __u8 path_use; }; struct rdma_ls_ip_resolve_header { __u32 ifindex; }; /* Local service attribute type */ #define RDMA_NLA_F_MANDATORY (1 << 13) #define RDMA_NLA_TYPE_MASK (~(NLA_F_NESTED | NLA_F_NET_BYTEORDER | \ RDMA_NLA_F_MANDATORY)) /* * Local service attributes: * Attr Name Size Byte order * ----------------------------------------------------- * PATH_RECORD struct ib_path_rec_data * TIMEOUT u32 cpu * SERVICE_ID u64 cpu * DGID u8[16] BE * SGID u8[16] BE * TCLASS u8 * PKEY u16 cpu * QOS_CLASS u16 cpu * IPV4 u32 BE * IPV6 u8[16] BE */ enum { LS_NLA_TYPE_UNSPEC = 0, LS_NLA_TYPE_PATH_RECORD, LS_NLA_TYPE_TIMEOUT, LS_NLA_TYPE_SERVICE_ID, LS_NLA_TYPE_DGID, LS_NLA_TYPE_SGID, LS_NLA_TYPE_TCLASS, LS_NLA_TYPE_PKEY, LS_NLA_TYPE_QOS_CLASS, LS_NLA_TYPE_IPV4, LS_NLA_TYPE_IPV6, LS_NLA_TYPE_MAX }; /* Local service DGID/SGID attribute: big endian */ struct rdma_nla_ls_gid { __u8 gid[16]; }; enum rdma_nldev_command { RDMA_NLDEV_CMD_UNSPEC, RDMA_NLDEV_CMD_GET, /* can dump */ RDMA_NLDEV_CMD_SET, RDMA_NLDEV_CMD_NEWLINK, RDMA_NLDEV_CMD_DELLINK, RDMA_NLDEV_CMD_PORT_GET, /* can dump */ RDMA_NLDEV_CMD_SYS_GET, RDMA_NLDEV_CMD_SYS_SET, /* 8 is free to use */ RDMA_NLDEV_CMD_RES_GET = 9, /* can dump */ RDMA_NLDEV_CMD_RES_QP_GET, /* can dump */ RDMA_NLDEV_CMD_RES_CM_ID_GET, /* can dump */ RDMA_NLDEV_CMD_RES_CQ_GET, /* can dump */ RDMA_NLDEV_CMD_RES_MR_GET, /* can dump */ RDMA_NLDEV_CMD_RES_PD_GET, /* can dump */ RDMA_NLDEV_CMD_GET_CHARDEV, RDMA_NLDEV_CMD_STAT_SET, RDMA_NLDEV_CMD_STAT_GET, /* can dump */ RDMA_NLDEV_CMD_STAT_DEL, RDMA_NLDEV_CMD_RES_QP_GET_RAW, RDMA_NLDEV_CMD_RES_CQ_GET_RAW, RDMA_NLDEV_CMD_RES_MR_GET_RAW, RDMA_NLDEV_CMD_RES_CTX_GET, /* can dump */ RDMA_NLDEV_CMD_RES_SRQ_GET, /* can dump */ RDMA_NLDEV_CMD_STAT_GET_STATUS, RDMA_NLDEV_NUM_OPS }; enum rdma_nldev_print_type { RDMA_NLDEV_PRINT_TYPE_UNSPEC, RDMA_NLDEV_PRINT_TYPE_HEX, }; enum rdma_nldev_attr { /* don't change the order or add anything between, this is ABI! */ RDMA_NLDEV_ATTR_UNSPEC, /* Pad attribute for 64b alignment */ RDMA_NLDEV_ATTR_PAD = RDMA_NLDEV_ATTR_UNSPEC, /* Identifier for ib_device */ RDMA_NLDEV_ATTR_DEV_INDEX, /* u32 */ RDMA_NLDEV_ATTR_DEV_NAME, /* string */ /* * Device index together with port index are identifiers * for port/link properties. * * For RDMA_NLDEV_CMD_GET commamnd, port index will return number * of available ports in ib_device, while for port specific operations, * it will be real port index as it appears in sysfs. Port index follows * sysfs notation and starts from 1 for the first port. */ RDMA_NLDEV_ATTR_PORT_INDEX, /* u32 */ /* * Device and port capabilities * * When used for port info, first 32-bits are CapabilityMask followed by * 16-bit CapabilityMask2. */ RDMA_NLDEV_ATTR_CAP_FLAGS, /* u64 */ /* * FW version */ RDMA_NLDEV_ATTR_FW_VERSION, /* string */ /* * Node GUID (in host byte order) associated with the RDMA device. */ RDMA_NLDEV_ATTR_NODE_GUID, /* u64 */ /* * System image GUID (in host byte order) associated with * this RDMA device and other devices which are part of a * single system. */ RDMA_NLDEV_ATTR_SYS_IMAGE_GUID, /* u64 */ /* * Subnet prefix (in host byte order) */ RDMA_NLDEV_ATTR_SUBNET_PREFIX, /* u64 */ /* * Local Identifier (LID), * According to IB specification, It is 16-bit address assigned * by the Subnet Manager. Extended to be 32-bit for OmniPath users. */ RDMA_NLDEV_ATTR_LID, /* u32 */ RDMA_NLDEV_ATTR_SM_LID, /* u32 */ /* * LID mask control (LMC) */ RDMA_NLDEV_ATTR_LMC, /* u8 */ RDMA_NLDEV_ATTR_PORT_STATE, /* u8 */ RDMA_NLDEV_ATTR_PORT_PHYS_STATE, /* u8 */ RDMA_NLDEV_ATTR_DEV_NODE_TYPE, /* u8 */ RDMA_NLDEV_ATTR_RES_SUMMARY, /* nested table */ RDMA_NLDEV_ATTR_RES_SUMMARY_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_RES_SUMMARY_ENTRY_NAME, /* string */ RDMA_NLDEV_ATTR_RES_SUMMARY_ENTRY_CURR, /* u64 */ RDMA_NLDEV_ATTR_RES_QP, /* nested table */ RDMA_NLDEV_ATTR_RES_QP_ENTRY, /* nested table */ /* * Local QPN */ RDMA_NLDEV_ATTR_RES_LQPN, /* u32 */ /* * Remote QPN, * Applicable for RC and UC only IBTA 11.2.5.3 QUERY QUEUE PAIR */ RDMA_NLDEV_ATTR_RES_RQPN, /* u32 */ /* * Receive Queue PSN, * Applicable for RC and UC only 11.2.5.3 QUERY QUEUE PAIR */ RDMA_NLDEV_ATTR_RES_RQ_PSN, /* u32 */ /* * Send Queue PSN */ RDMA_NLDEV_ATTR_RES_SQ_PSN, /* u32 */ RDMA_NLDEV_ATTR_RES_PATH_MIG_STATE, /* u8 */ /* * QP types as visible to RDMA/core, the reserved QPT * are not exported through this interface. */ RDMA_NLDEV_ATTR_RES_TYPE, /* u8 */ RDMA_NLDEV_ATTR_RES_STATE, /* u8 */ /* * Process ID which created object, * in case of kernel origin, PID won't exist. */ RDMA_NLDEV_ATTR_RES_PID, /* u32 */ /* * The name of process created following resource. * It will exist only for kernel objects. * For user created objects, the user is supposed * to read /proc/PID/comm file. */ RDMA_NLDEV_ATTR_RES_KERN_NAME, /* string */ RDMA_NLDEV_ATTR_RES_CM_ID, /* nested table */ RDMA_NLDEV_ATTR_RES_CM_ID_ENTRY, /* nested table */ /* * rdma_cm_id port space. */ RDMA_NLDEV_ATTR_RES_PS, /* u32 */ /* * Source and destination socket addresses */ RDMA_NLDEV_ATTR_RES_SRC_ADDR, /* __kernel_sockaddr_storage */ RDMA_NLDEV_ATTR_RES_DST_ADDR, /* __kernel_sockaddr_storage */ RDMA_NLDEV_ATTR_RES_CQ, /* nested table */ RDMA_NLDEV_ATTR_RES_CQ_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_RES_CQE, /* u32 */ RDMA_NLDEV_ATTR_RES_USECNT, /* u64 */ RDMA_NLDEV_ATTR_RES_POLL_CTX, /* u8 */ RDMA_NLDEV_ATTR_RES_MR, /* nested table */ RDMA_NLDEV_ATTR_RES_MR_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_RES_RKEY, /* u32 */ RDMA_NLDEV_ATTR_RES_LKEY, /* u32 */ RDMA_NLDEV_ATTR_RES_IOVA, /* u64 */ RDMA_NLDEV_ATTR_RES_MRLEN, /* u64 */ RDMA_NLDEV_ATTR_RES_PD, /* nested table */ RDMA_NLDEV_ATTR_RES_PD_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_RES_LOCAL_DMA_LKEY, /* u32 */ RDMA_NLDEV_ATTR_RES_UNSAFE_GLOBAL_RKEY, /* u32 */ /* * Provides logical name and index of netdevice which is * connected to physical port. This information is relevant * for RoCE and iWARP. * * The netdevices which are associated with containers are * supposed to be exported together with GID table once it * will be exposed through the netlink. Because the * associated netdevices are properties of GIDs. */ RDMA_NLDEV_ATTR_NDEV_INDEX, /* u32 */ RDMA_NLDEV_ATTR_NDEV_NAME, /* string */ /* * driver-specific attributes. */ RDMA_NLDEV_ATTR_DRIVER, /* nested table */ RDMA_NLDEV_ATTR_DRIVER_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_DRIVER_STRING, /* string */ /* * u8 values from enum rdma_nldev_print_type */ RDMA_NLDEV_ATTR_DRIVER_PRINT_TYPE, /* u8 */ RDMA_NLDEV_ATTR_DRIVER_S32, /* s32 */ RDMA_NLDEV_ATTR_DRIVER_U32, /* u32 */ RDMA_NLDEV_ATTR_DRIVER_S64, /* s64 */ RDMA_NLDEV_ATTR_DRIVER_U64, /* u64 */ /* * Indexes to get/set secific entry, * for QP use RDMA_NLDEV_ATTR_RES_LQPN */ RDMA_NLDEV_ATTR_RES_PDN, /* u32 */ RDMA_NLDEV_ATTR_RES_CQN, /* u32 */ RDMA_NLDEV_ATTR_RES_MRN, /* u32 */ RDMA_NLDEV_ATTR_RES_CM_IDN, /* u32 */ RDMA_NLDEV_ATTR_RES_CTXN, /* u32 */ /* * Identifies the rdma driver. eg: "rxe" or "siw" */ RDMA_NLDEV_ATTR_LINK_TYPE, /* string */ /* * net namespace mode for rdma subsystem: * either shared or exclusive among multiple net namespaces. */ RDMA_NLDEV_SYS_ATTR_NETNS_MODE, /* u8 */ /* * Device protocol, e.g. ib, iw, usnic, roce and opa */ RDMA_NLDEV_ATTR_DEV_PROTOCOL, /* string */ /* * File descriptor handle of the net namespace object */ RDMA_NLDEV_NET_NS_FD, /* u32 */ /* * Information about a chardev. * CHARDEV_TYPE is the name of the chardev ABI (ie uverbs, umad, etc) * CHARDEV_ABI signals the ABI revision (historical) * CHARDEV_NAME is the kernel name for the /dev/ file (no directory) * CHARDEV is the 64 bit dev_t for the inode */ RDMA_NLDEV_ATTR_CHARDEV_TYPE, /* string */ RDMA_NLDEV_ATTR_CHARDEV_NAME, /* string */ RDMA_NLDEV_ATTR_CHARDEV_ABI, /* u64 */ RDMA_NLDEV_ATTR_CHARDEV, /* u64 */ RDMA_NLDEV_ATTR_UVERBS_DRIVER_ID, /* u64 */ /* * Counter-specific attributes. */ RDMA_NLDEV_ATTR_STAT_MODE, /* u32 */ RDMA_NLDEV_ATTR_STAT_RES, /* u32 */ RDMA_NLDEV_ATTR_STAT_AUTO_MODE_MASK, /* u32 */ RDMA_NLDEV_ATTR_STAT_COUNTER, /* nested table */ RDMA_NLDEV_ATTR_STAT_COUNTER_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_STAT_COUNTER_ID, /* u32 */ RDMA_NLDEV_ATTR_STAT_HWCOUNTERS, /* nested table */ RDMA_NLDEV_ATTR_STAT_HWCOUNTER_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_STAT_HWCOUNTER_ENTRY_NAME, /* string */ RDMA_NLDEV_ATTR_STAT_HWCOUNTER_ENTRY_VALUE, /* u64 */ /* * CQ adaptive moderatio (DIM) */ RDMA_NLDEV_ATTR_DEV_DIM, /* u8 */ RDMA_NLDEV_ATTR_RES_RAW, /* binary */ RDMA_NLDEV_ATTR_RES_CTX, /* nested table */ RDMA_NLDEV_ATTR_RES_CTX_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_RES_SRQ, /* nested table */ RDMA_NLDEV_ATTR_RES_SRQ_ENTRY, /* nested table */ RDMA_NLDEV_ATTR_RES_SRQN, /* u32 */ RDMA_NLDEV_ATTR_MIN_RANGE, /* u32 */ RDMA_NLDEV_ATTR_MAX_RANGE, /* u32 */ RDMA_NLDEV_SYS_ATTR_COPY_ON_FORK, /* u8 */ RDMA_NLDEV_ATTR_STAT_HWCOUNTER_INDEX, /* u32 */ RDMA_NLDEV_ATTR_STAT_HWCOUNTER_DYNAMIC, /* u8 */ /* * Always the end */ RDMA_NLDEV_ATTR_MAX }; /* * Supported counter bind modes. All modes are mutual-exclusive. */ enum rdma_nl_counter_mode { RDMA_COUNTER_MODE_NONE, /* * A qp is bound with a counter automatically during initialization * based on the auto mode (e.g., qp type, ...) */ RDMA_COUNTER_MODE_AUTO, /* * Which qp are bound with which counter is explicitly specified * by the user */ RDMA_COUNTER_MODE_MANUAL, /* * Always the end */ RDMA_COUNTER_MODE_MAX, }; /* * Supported criteria in counter auto mode. * Currently only "qp type" is supported */ enum rdma_nl_counter_mask { RDMA_COUNTER_MASK_QP_TYPE = 1, RDMA_COUNTER_MASK_PID = 1 << 1, }; #endif /* _RDMA_NETLINK_H */ mthca-abi.h000064400000005757152526504440006567 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2005 Topspin Communications. All rights reserved. * Copyright (c) 2005, 2006 Cisco Systems. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef MTHCA_ABI_USER_H #define MTHCA_ABI_USER_H #include /* * Increment this value if any changes that break userspace ABI * compatibility are made. */ #define MTHCA_UVERBS_ABI_VERSION 1 /* * Make sure that all structs defined in this file remain laid out so * that they pack the same way on 32-bit and 64-bit architectures (to * avoid incompatibility between 32-bit userspace and 64-bit kernels). * In particular do not use pointer types -- pass pointers in __u64 * instead. */ struct mthca_alloc_ucontext_resp { __u32 qp_tab_size; __u32 uarc_size; }; struct mthca_alloc_pd_resp { __u32 pdn; __u32 reserved; }; /* * Mark the memory region with a DMA attribute that causes * in-flight DMA to be flushed when the region is written to: */ #define MTHCA_MR_DMASYNC 0x1 struct mthca_reg_mr { __u32 mr_attrs; __u32 reserved; }; struct mthca_create_cq { __u32 lkey; __u32 pdn; __aligned_u64 arm_db_page; __aligned_u64 set_db_page; __u32 arm_db_index; __u32 set_db_index; }; struct mthca_create_cq_resp { __u32 cqn; __u32 reserved; }; struct mthca_resize_cq { __u32 lkey; __u32 reserved; }; struct mthca_create_srq { __u32 lkey; __u32 db_index; __aligned_u64 db_page; }; struct mthca_create_srq_resp { __u32 srqn; __u32 reserved; }; struct mthca_create_qp { __u32 lkey; __u32 reserved; __aligned_u64 sq_db_page; __aligned_u64 rq_db_page; __u32 sq_db_index; __u32 rq_db_index; }; #endif /* MTHCA_ABI_USER_H */ rdma_user_cm.h000064400000015734152526504440007376 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2005-2006 Intel Corporation. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef RDMA_USER_CM_H #define RDMA_USER_CM_H #include #include #include #include #include #define RDMA_USER_CM_ABI_VERSION 4 #define RDMA_MAX_PRIVATE_DATA 256 enum { RDMA_USER_CM_CMD_CREATE_ID, RDMA_USER_CM_CMD_DESTROY_ID, RDMA_USER_CM_CMD_BIND_IP, RDMA_USER_CM_CMD_RESOLVE_IP, RDMA_USER_CM_CMD_RESOLVE_ROUTE, RDMA_USER_CM_CMD_QUERY_ROUTE, RDMA_USER_CM_CMD_CONNECT, RDMA_USER_CM_CMD_LISTEN, RDMA_USER_CM_CMD_ACCEPT, RDMA_USER_CM_CMD_REJECT, RDMA_USER_CM_CMD_DISCONNECT, RDMA_USER_CM_CMD_INIT_QP_ATTR, RDMA_USER_CM_CMD_GET_EVENT, RDMA_USER_CM_CMD_GET_OPTION, RDMA_USER_CM_CMD_SET_OPTION, RDMA_USER_CM_CMD_NOTIFY, RDMA_USER_CM_CMD_JOIN_IP_MCAST, RDMA_USER_CM_CMD_LEAVE_MCAST, RDMA_USER_CM_CMD_MIGRATE_ID, RDMA_USER_CM_CMD_QUERY, RDMA_USER_CM_CMD_BIND, RDMA_USER_CM_CMD_RESOLVE_ADDR, RDMA_USER_CM_CMD_JOIN_MCAST }; /* See IBTA Annex A11, servies ID bytes 4 & 5 */ enum rdma_ucm_port_space { RDMA_PS_IPOIB = 0x0002, RDMA_PS_IB = 0x013F, RDMA_PS_TCP = 0x0106, RDMA_PS_UDP = 0x0111, }; /* * command ABI structures. */ struct rdma_ucm_cmd_hdr { __u32 cmd; __u16 in; __u16 out; }; struct rdma_ucm_create_id { __aligned_u64 uid; __aligned_u64 response; __u16 ps; /* use enum rdma_ucm_port_space */ __u8 qp_type; __u8 reserved[5]; }; struct rdma_ucm_create_id_resp { __u32 id; }; struct rdma_ucm_destroy_id { __aligned_u64 response; __u32 id; __u32 reserved; }; struct rdma_ucm_destroy_id_resp { __u32 events_reported; }; struct rdma_ucm_bind_ip { __aligned_u64 response; struct sockaddr_in6 addr; __u32 id; }; struct rdma_ucm_bind { __u32 id; __u16 addr_size; __u16 reserved; struct __kernel_sockaddr_storage addr; }; struct rdma_ucm_resolve_ip { struct sockaddr_in6 src_addr; struct sockaddr_in6 dst_addr; __u32 id; __u32 timeout_ms; }; struct rdma_ucm_resolve_addr { __u32 id; __u32 timeout_ms; __u16 src_size; __u16 dst_size; __u32 reserved; struct __kernel_sockaddr_storage src_addr; struct __kernel_sockaddr_storage dst_addr; }; struct rdma_ucm_resolve_route { __u32 id; __u32 timeout_ms; }; enum { RDMA_USER_CM_QUERY_ADDR, RDMA_USER_CM_QUERY_PATH, RDMA_USER_CM_QUERY_GID }; struct rdma_ucm_query { __aligned_u64 response; __u32 id; __u32 option; }; struct rdma_ucm_query_route_resp { __aligned_u64 node_guid; struct ib_user_path_rec ib_route[2]; struct sockaddr_in6 src_addr; struct sockaddr_in6 dst_addr; __u32 num_paths; __u8 port_num; __u8 reserved[3]; __u32 ibdev_index; __u32 reserved1; }; struct rdma_ucm_query_addr_resp { __aligned_u64 node_guid; __u8 port_num; __u8 reserved; __u16 pkey; __u16 src_size; __u16 dst_size; struct __kernel_sockaddr_storage src_addr; struct __kernel_sockaddr_storage dst_addr; __u32 ibdev_index; __u32 reserved1; }; struct rdma_ucm_query_path_resp { __u32 num_paths; __u32 reserved; struct ib_path_rec_data path_data[]; }; struct rdma_ucm_conn_param { __u32 qp_num; __u32 qkey; __u8 private_data[RDMA_MAX_PRIVATE_DATA]; __u8 private_data_len; __u8 srq; __u8 responder_resources; __u8 initiator_depth; __u8 flow_control; __u8 retry_count; __u8 rnr_retry_count; __u8 valid; }; struct rdma_ucm_ud_param { __u32 qp_num; __u32 qkey; struct ib_uverbs_ah_attr ah_attr; __u8 private_data[RDMA_MAX_PRIVATE_DATA]; __u8 private_data_len; __u8 reserved[7]; }; struct rdma_ucm_ece { __u32 vendor_id; __u32 attr_mod; }; struct rdma_ucm_connect { struct rdma_ucm_conn_param conn_param; __u32 id; __u32 reserved; struct rdma_ucm_ece ece; }; struct rdma_ucm_listen { __u32 id; __u32 backlog; }; struct rdma_ucm_accept { __aligned_u64 uid; struct rdma_ucm_conn_param conn_param; __u32 id; __u32 reserved; struct rdma_ucm_ece ece; }; struct rdma_ucm_reject { __u32 id; __u8 private_data_len; __u8 reason; __u8 reserved[2]; __u8 private_data[RDMA_MAX_PRIVATE_DATA]; }; struct rdma_ucm_disconnect { __u32 id; }; struct rdma_ucm_init_qp_attr { __aligned_u64 response; __u32 id; __u32 qp_state; }; struct rdma_ucm_notify { __u32 id; __u32 event; }; struct rdma_ucm_join_ip_mcast { __aligned_u64 response; /* rdma_ucm_create_id_resp */ __aligned_u64 uid; struct sockaddr_in6 addr; __u32 id; }; /* Multicast join flags */ enum { RDMA_MC_JOIN_FLAG_FULLMEMBER, RDMA_MC_JOIN_FLAG_SENDONLY_FULLMEMBER, RDMA_MC_JOIN_FLAG_RESERVED, }; struct rdma_ucm_join_mcast { __aligned_u64 response; /* rdma_ucma_create_id_resp */ __aligned_u64 uid; __u32 id; __u16 addr_size; __u16 join_flags; struct __kernel_sockaddr_storage addr; }; struct rdma_ucm_get_event { __aligned_u64 response; }; struct rdma_ucm_event_resp { __aligned_u64 uid; __u32 id; __u32 event; __u32 status; /* * NOTE: This union is not aligned to 8 bytes so none of the union * members may contain a u64 or anything with higher alignment than 4. */ union { struct rdma_ucm_conn_param conn; struct rdma_ucm_ud_param ud; } param; __u32 reserved; struct rdma_ucm_ece ece; }; /* Option levels */ enum { RDMA_OPTION_ID = 0, RDMA_OPTION_IB = 1 }; /* Option details */ enum { RDMA_OPTION_ID_TOS = 0, RDMA_OPTION_ID_REUSEADDR = 1, RDMA_OPTION_ID_AFONLY = 2, RDMA_OPTION_ID_ACK_TIMEOUT = 3 }; enum { RDMA_OPTION_IB_PATH = 1 }; struct rdma_ucm_set_option { __aligned_u64 optval; __u32 id; __u32 level; __u32 optname; __u32 optlen; }; struct rdma_ucm_migrate_id { __aligned_u64 response; __u32 id; __u32 fd; }; struct rdma_ucm_migrate_resp { __u32 events_reported; }; #endif /* RDMA_USER_CM_H */ ib_user_ioctl_verbs.h000064400000017312152526504440010753 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2017-2018, Mellanox Technologies inc. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef IB_USER_IOCTL_VERBS_H #define IB_USER_IOCTL_VERBS_H #include #include #ifndef RDMA_UAPI_PTR #define RDMA_UAPI_PTR(_type, _name) __aligned_u64 _name #endif #define IB_UVERBS_ACCESS_OPTIONAL_FIRST (1 << 20) #define IB_UVERBS_ACCESS_OPTIONAL_LAST (1 << 29) enum ib_uverbs_core_support { IB_UVERBS_CORE_SUPPORT_OPTIONAL_MR_ACCESS = 1 << 0, }; enum ib_uverbs_access_flags { IB_UVERBS_ACCESS_LOCAL_WRITE = 1 << 0, IB_UVERBS_ACCESS_REMOTE_WRITE = 1 << 1, IB_UVERBS_ACCESS_REMOTE_READ = 1 << 2, IB_UVERBS_ACCESS_REMOTE_ATOMIC = 1 << 3, IB_UVERBS_ACCESS_MW_BIND = 1 << 4, IB_UVERBS_ACCESS_ZERO_BASED = 1 << 5, IB_UVERBS_ACCESS_ON_DEMAND = 1 << 6, IB_UVERBS_ACCESS_HUGETLB = 1 << 7, IB_UVERBS_ACCESS_FLUSH_GLOBAL = 1 << 8, IB_UVERBS_ACCESS_FLUSH_PERSISTENT = 1 << 9, IB_UVERBS_ACCESS_RELAXED_ORDERING = IB_UVERBS_ACCESS_OPTIONAL_FIRST, IB_UVERBS_ACCESS_OPTIONAL_RANGE = ((IB_UVERBS_ACCESS_OPTIONAL_LAST << 1) - 1) & ~(IB_UVERBS_ACCESS_OPTIONAL_FIRST - 1) }; enum ib_uverbs_srq_type { IB_UVERBS_SRQT_BASIC, IB_UVERBS_SRQT_XRC, IB_UVERBS_SRQT_TM, }; enum ib_uverbs_wq_type { IB_UVERBS_WQT_RQ, }; enum ib_uverbs_wq_flags { IB_UVERBS_WQ_FLAGS_CVLAN_STRIPPING = 1 << 0, IB_UVERBS_WQ_FLAGS_SCATTER_FCS = 1 << 1, IB_UVERBS_WQ_FLAGS_DELAY_DROP = 1 << 2, IB_UVERBS_WQ_FLAGS_PCI_WRITE_END_PADDING = 1 << 3, }; enum ib_uverbs_qp_type { IB_UVERBS_QPT_RC = 2, IB_UVERBS_QPT_UC, IB_UVERBS_QPT_UD, IB_UVERBS_QPT_RAW_PACKET = 8, IB_UVERBS_QPT_XRC_INI, IB_UVERBS_QPT_XRC_TGT, IB_UVERBS_QPT_DRIVER = 0xFF, }; enum ib_uverbs_qp_create_flags { IB_UVERBS_QP_CREATE_BLOCK_MULTICAST_LOOPBACK = 1 << 1, IB_UVERBS_QP_CREATE_SCATTER_FCS = 1 << 8, IB_UVERBS_QP_CREATE_CVLAN_STRIPPING = 1 << 9, IB_UVERBS_QP_CREATE_PCI_WRITE_END_PADDING = 1 << 11, IB_UVERBS_QP_CREATE_SQ_SIG_ALL = 1 << 12, }; enum ib_uverbs_query_port_cap_flags { IB_UVERBS_PCF_SM = 1 << 1, IB_UVERBS_PCF_NOTICE_SUP = 1 << 2, IB_UVERBS_PCF_TRAP_SUP = 1 << 3, IB_UVERBS_PCF_OPT_IPD_SUP = 1 << 4, IB_UVERBS_PCF_AUTO_MIGR_SUP = 1 << 5, IB_UVERBS_PCF_SL_MAP_SUP = 1 << 6, IB_UVERBS_PCF_MKEY_NVRAM = 1 << 7, IB_UVERBS_PCF_PKEY_NVRAM = 1 << 8, IB_UVERBS_PCF_LED_INFO_SUP = 1 << 9, IB_UVERBS_PCF_SM_DISABLED = 1 << 10, IB_UVERBS_PCF_SYS_IMAGE_GUID_SUP = 1 << 11, IB_UVERBS_PCF_PKEY_SW_EXT_PORT_TRAP_SUP = 1 << 12, IB_UVERBS_PCF_EXTENDED_SPEEDS_SUP = 1 << 14, IB_UVERBS_PCF_CM_SUP = 1 << 16, IB_UVERBS_PCF_SNMP_TUNNEL_SUP = 1 << 17, IB_UVERBS_PCF_REINIT_SUP = 1 << 18, IB_UVERBS_PCF_DEVICE_MGMT_SUP = 1 << 19, IB_UVERBS_PCF_VENDOR_CLASS_SUP = 1 << 20, IB_UVERBS_PCF_DR_NOTICE_SUP = 1 << 21, IB_UVERBS_PCF_CAP_MASK_NOTICE_SUP = 1 << 22, IB_UVERBS_PCF_BOOT_MGMT_SUP = 1 << 23, IB_UVERBS_PCF_LINK_LATENCY_SUP = 1 << 24, IB_UVERBS_PCF_CLIENT_REG_SUP = 1 << 25, /* * IsOtherLocalChangesNoticeSupported is aliased by IP_BASED_GIDS and * is inaccessible */ IB_UVERBS_PCF_LINK_SPEED_WIDTH_TABLE_SUP = 1 << 27, IB_UVERBS_PCF_VENDOR_SPECIFIC_MADS_TABLE_SUP = 1 << 28, IB_UVERBS_PCF_MCAST_PKEY_TRAP_SUPPRESSION_SUP = 1 << 29, IB_UVERBS_PCF_MCAST_FDB_TOP_SUP = 1 << 30, IB_UVERBS_PCF_HIERARCHY_INFO_SUP = 1ULL << 31, /* NOTE this is an internal flag, not an IBA flag */ IB_UVERBS_PCF_IP_BASED_GIDS = 1 << 26, }; enum ib_uverbs_query_port_flags { IB_UVERBS_QPF_GRH_REQUIRED = 1 << 0, }; enum ib_uverbs_flow_action_esp_keymat { IB_UVERBS_FLOW_ACTION_ESP_KEYMAT_AES_GCM, }; enum ib_uverbs_flow_action_esp_keymat_aes_gcm_iv_algo { IB_UVERBS_FLOW_ACTION_IV_ALGO_SEQ, }; struct ib_uverbs_flow_action_esp_keymat_aes_gcm { __aligned_u64 iv; __u32 iv_algo; /* Use enum ib_uverbs_flow_action_esp_keymat_aes_gcm_iv_algo */ __u32 salt; __u32 icv_len; __u32 key_len; __u32 aes_key[256 / 32]; }; enum ib_uverbs_flow_action_esp_replay { IB_UVERBS_FLOW_ACTION_ESP_REPLAY_NONE, IB_UVERBS_FLOW_ACTION_ESP_REPLAY_BMP, }; struct ib_uverbs_flow_action_esp_replay_bmp { __u32 size; }; enum ib_uverbs_flow_action_esp_flags { IB_UVERBS_FLOW_ACTION_ESP_FLAGS_INLINE_CRYPTO = 0UL << 0, /* Default */ IB_UVERBS_FLOW_ACTION_ESP_FLAGS_FULL_OFFLOAD = 1UL << 0, IB_UVERBS_FLOW_ACTION_ESP_FLAGS_TUNNEL = 0UL << 1, /* Default */ IB_UVERBS_FLOW_ACTION_ESP_FLAGS_TRANSPORT = 1UL << 1, IB_UVERBS_FLOW_ACTION_ESP_FLAGS_DECRYPT = 0UL << 2, /* Default */ IB_UVERBS_FLOW_ACTION_ESP_FLAGS_ENCRYPT = 1UL << 2, IB_UVERBS_FLOW_ACTION_ESP_FLAGS_ESN_NEW_WINDOW = 1UL << 3, }; struct ib_uverbs_flow_action_esp_encap { /* This struct represents a list of pointers to flow_xxxx_filter that * encapsulates the payload in ESP tunnel mode. */ RDMA_UAPI_PTR(void *, val_ptr); /* pointer to a flow_xxxx_filter */ RDMA_UAPI_PTR(struct ib_uverbs_flow_action_esp_encap *, next_ptr); __u16 len; /* Len of the filter struct val_ptr points to */ __u16 type; /* Use flow_spec_type enum */ }; struct ib_uverbs_flow_action_esp { __u32 spi; __u32 seq; __u32 tfc_pad; __u32 flags; __aligned_u64 hard_limit_pkts; }; enum ib_uverbs_read_counters_flags { /* prefer read values from driver cache */ IB_UVERBS_READ_COUNTERS_PREFER_CACHED = 1 << 0, }; enum ib_uverbs_advise_mr_advice { IB_UVERBS_ADVISE_MR_ADVICE_PREFETCH, IB_UVERBS_ADVISE_MR_ADVICE_PREFETCH_WRITE, }; enum ib_uverbs_advise_mr_flag { IB_UVERBS_ADVISE_MR_FLAG_FLUSH = 1 << 0, }; struct ib_uverbs_query_port_resp_ex { struct ib_uverbs_query_port_resp legacy_resp; __u16 port_cap_flags2; __u8 reserved[6]; }; struct ib_uverbs_qp_cap { __u32 max_send_wr; __u32 max_recv_wr; __u32 max_send_sge; __u32 max_recv_sge; __u32 max_inline_data; }; enum rdma_driver_id { RDMA_DRIVER_UNKNOWN, RDMA_DRIVER_MLX5, RDMA_DRIVER_MLX4, RDMA_DRIVER_CXGB3, RDMA_DRIVER_CXGB4, RDMA_DRIVER_MTHCA, RDMA_DRIVER_BNXT_RE, RDMA_DRIVER_OCRDMA, RDMA_DRIVER_NES, RDMA_DRIVER_I40IW, RDMA_DRIVER_IRDMA = RDMA_DRIVER_I40IW, RDMA_DRIVER_VMW_PVRDMA, RDMA_DRIVER_QEDR, RDMA_DRIVER_HNS, RDMA_DRIVER_USNIC, RDMA_DRIVER_RXE, RDMA_DRIVER_HFI1, RDMA_DRIVER_QIB, RDMA_DRIVER_EFA, RDMA_DRIVER_SIW, __RH_RESERVED_RDMA_DRIVER_ERDMA, RDMA_DRIVER_MANA, }; enum ib_uverbs_gid_type { IB_UVERBS_GID_TYPE_IB, IB_UVERBS_GID_TYPE_ROCE_V1, IB_UVERBS_GID_TYPE_ROCE_V2, }; struct ib_uverbs_gid_entry { __aligned_u64 gid[2]; __u32 gid_index; __u32 port_num; __u32 gid_type; __u32 netdev_ifindex; /* It is 0 if there is no netdev associated with it */ }; #endif mana-abi.h000064400000002241152526504440006370 0ustar00/* SPDX-License-Identifier: (GPL-2.0 WITH Linux-syscall-note) */ /* * Copyright (c) 2022, Microsoft Corporation. All rights reserved. */ #ifndef MANA_ABI_USER_H #define MANA_ABI_USER_H #include #include /* * Increment this value if any changes that break userspace ABI * compatibility are made. */ #define MANA_IB_UVERBS_ABI_VERSION 1 struct mana_ib_create_cq { __aligned_u64 buf_addr; }; struct mana_ib_create_qp { __aligned_u64 sq_buf_addr; __u32 sq_buf_size; __u32 port; }; struct mana_ib_create_qp_resp { __u32 sqid; __u32 cqid; __u32 tx_vp_offset; __u32 reserved; }; struct mana_ib_create_wq { __aligned_u64 wq_buf_addr; __u32 wq_buf_size; __u32 reserved; }; /* RX Hash function flags */ enum mana_ib_rx_hash_function_flags { MANA_IB_RX_HASH_FUNC_TOEPLITZ = 1 << 0, }; struct mana_ib_create_qp_rss { __aligned_u64 rx_hash_fields_mask; __u8 rx_hash_function; __u8 reserved[7]; __u32 rx_hash_key_len; __u8 rx_hash_key[40]; __u32 port; }; struct rss_resp_entry { __u32 cqid; __u32 wqid; }; struct mana_ib_create_qp_rss_resp { __aligned_u64 num_entries; struct rss_resp_entry entries[64]; }; #endif mlx4-abi.h000064400000011775152526504440006354 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2007 Cisco Systems, Inc. All rights reserved. * Copyright (c) 2007, 2008 Mellanox Technologies. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef MLX4_ABI_USER_H #define MLX4_ABI_USER_H #include /* * Increment this value if any changes that break userspace ABI * compatibility are made. */ #define MLX4_IB_UVERBS_NO_DEV_CAPS_ABI_VERSION 3 #define MLX4_IB_UVERBS_ABI_VERSION 4 /* * Make sure that all structs defined in this file remain laid out so * that they pack the same way on 32-bit and 64-bit architectures (to * avoid incompatibility between 32-bit userspace and 64-bit kernels). * In particular do not use pointer types -- pass pointers in __u64 * instead. */ struct mlx4_ib_alloc_ucontext_resp_v3 { __u32 qp_tab_size; __u16 bf_reg_size; __u16 bf_regs_per_page; }; enum { MLX4_USER_DEV_CAP_LARGE_CQE = 1L << 0, }; struct mlx4_ib_alloc_ucontext_resp { __u32 dev_caps; __u32 qp_tab_size; __u16 bf_reg_size; __u16 bf_regs_per_page; __u32 cqe_size; }; struct mlx4_ib_alloc_pd_resp { __u32 pdn; __u32 reserved; }; struct mlx4_ib_create_cq { __aligned_u64 buf_addr; __aligned_u64 db_addr; }; struct mlx4_ib_create_cq_resp { __u32 cqn; __u32 reserved; }; struct mlx4_ib_resize_cq { __aligned_u64 buf_addr; }; struct mlx4_ib_create_srq { __aligned_u64 buf_addr; __aligned_u64 db_addr; }; struct mlx4_ib_create_srq_resp { __u32 srqn; __u32 reserved; }; struct mlx4_ib_create_qp_rss { __aligned_u64 rx_hash_fields_mask; /* Use enum mlx4_ib_rx_hash_fields */ __u8 rx_hash_function; /* Use enum mlx4_ib_rx_hash_function_flags */ __u8 reserved[7]; __u8 rx_hash_key[40]; __u32 comp_mask; __u32 reserved1; }; struct mlx4_ib_create_qp { __aligned_u64 buf_addr; __aligned_u64 db_addr; __u8 log_sq_bb_count; __u8 log_sq_stride; __u8 sq_no_prefetch; __u8 reserved; __u32 inl_recv_sz; }; struct mlx4_ib_create_wq { __aligned_u64 buf_addr; __aligned_u64 db_addr; __u8 log_range_size; __u8 reserved[3]; __u32 comp_mask; }; struct mlx4_ib_modify_wq { __u32 comp_mask; __u32 reserved; }; struct mlx4_ib_create_rwq_ind_tbl_resp { __u32 response_length; __u32 reserved; }; /* RX Hash function flags */ enum mlx4_ib_rx_hash_function_flags { MLX4_IB_RX_HASH_FUNC_TOEPLITZ = 1 << 0, }; /* * RX Hash flags, these flags allows to set which incoming packet's field should * participates in RX Hash. Each flag represent certain packet's field, * when the flag is set the field that is represented by the flag will * participate in RX Hash calculation. */ enum mlx4_ib_rx_hash_fields { MLX4_IB_RX_HASH_SRC_IPV4 = 1 << 0, MLX4_IB_RX_HASH_DST_IPV4 = 1 << 1, MLX4_IB_RX_HASH_SRC_IPV6 = 1 << 2, MLX4_IB_RX_HASH_DST_IPV6 = 1 << 3, MLX4_IB_RX_HASH_SRC_PORT_TCP = 1 << 4, MLX4_IB_RX_HASH_DST_PORT_TCP = 1 << 5, MLX4_IB_RX_HASH_SRC_PORT_UDP = 1 << 6, MLX4_IB_RX_HASH_DST_PORT_UDP = 1 << 7, MLX4_IB_RX_HASH_INNER = 1ULL << 31, }; struct mlx4_ib_rss_caps { __aligned_u64 rx_hash_fields_mask; /* enum mlx4_ib_rx_hash_fields */ __u8 rx_hash_function; /* enum mlx4_ib_rx_hash_function_flags */ __u8 reserved[7]; }; enum query_device_resp_mask { MLX4_IB_QUERY_DEV_RESP_MASK_CORE_CLOCK_OFFSET = 1UL << 0, }; struct mlx4_ib_tso_caps { __u32 max_tso; /* Maximum tso payload size in bytes */ /* Corresponding bit will be set if qp type from * 'enum ib_qp_type' is supported. */ __u32 supported_qpts; }; struct mlx4_uverbs_ex_query_device_resp { __u32 comp_mask; __u32 response_length; __aligned_u64 hca_core_clock_offset; __u32 max_inl_recv_sz; __u32 reserved; struct mlx4_ib_rss_caps rss_caps; struct mlx4_ib_tso_caps tso_caps; }; #endif /* MLX4_ABI_USER_H */ cxgb4-abi.h000064400000006062152526504440006470 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2009-2010 Chelsio, Inc. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef CXGB4_ABI_USER_H #define CXGB4_ABI_USER_H #include #define C4IW_UVERBS_ABI_VERSION 3 /* * Make sure that all structs defined in this file remain laid out so * that they pack the same way on 32-bit and 64-bit architectures (to * avoid incompatibility between 32-bit userspace and 64-bit kernels). * In particular do not use pointer types -- pass pointers in __aligned_u64 * instead. */ enum { C4IW_64B_CQE = (1 << 0) }; struct c4iw_create_cq { __u32 flags; __u32 reserved; }; struct c4iw_create_cq_resp { __aligned_u64 key; __aligned_u64 gts_key; __aligned_u64 memsize; __u32 cqid; __u32 size; __u32 qid_mask; __u32 flags; }; enum { C4IW_QPF_ONCHIP = (1 << 0), C4IW_QPF_WRITE_W_IMM = (1 << 1) }; struct c4iw_create_qp_resp { __aligned_u64 ma_sync_key; __aligned_u64 sq_key; __aligned_u64 rq_key; __aligned_u64 sq_db_gts_key; __aligned_u64 rq_db_gts_key; __aligned_u64 sq_memsize; __aligned_u64 rq_memsize; __u32 sqid; __u32 rqid; __u32 sq_size; __u32 rq_size; __u32 qid_mask; __u32 flags; }; struct c4iw_create_srq_resp { __aligned_u64 srq_key; __aligned_u64 srq_db_gts_key; __aligned_u64 srq_memsize; __u32 srqid; __u32 srq_size; __u32 rqt_abs_idx; __u32 qid_mask; __u32 flags; __u32 reserved; /* explicit padding */ }; enum { /* HW supports SRQ_LIMIT_REACHED event */ T4_SRQ_LIMIT_SUPPORT = 1 << 0, }; struct c4iw_alloc_ucontext_resp { __aligned_u64 status_page_key; __u32 status_page_size; __u32 reserved; /* explicit padding (optional for i386) */ }; struct c4iw_alloc_pd_resp { __u32 pdid; }; #endif /* CXGB4_ABI_USER_H */ ib_user_ioctl_cmds.h000064400000022326152526504440010561 0ustar00/* * Copyright (c) 2018, Mellanox Technologies inc. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef IB_USER_IOCTL_CMDS_H #define IB_USER_IOCTL_CMDS_H #define UVERBS_ID_NS_MASK 0xF000 #define UVERBS_ID_NS_SHIFT 12 #define UVERBS_UDATA_DRIVER_DATA_NS 1 #define UVERBS_UDATA_DRIVER_DATA_FLAG (1UL << UVERBS_ID_NS_SHIFT) enum uverbs_default_objects { UVERBS_OBJECT_DEVICE, /* No instances of DEVICE are allowed */ UVERBS_OBJECT_PD, UVERBS_OBJECT_COMP_CHANNEL, UVERBS_OBJECT_CQ, UVERBS_OBJECT_QP, UVERBS_OBJECT_SRQ, UVERBS_OBJECT_AH, UVERBS_OBJECT_MR, UVERBS_OBJECT_MW, UVERBS_OBJECT_FLOW, UVERBS_OBJECT_XRCD, UVERBS_OBJECT_RWQ_IND_TBL, UVERBS_OBJECT_WQ, UVERBS_OBJECT_FLOW_ACTION, UVERBS_OBJECT_DM, UVERBS_OBJECT_COUNTERS, UVERBS_OBJECT_ASYNC_EVENT, }; enum { UVERBS_ATTR_UHW_IN = UVERBS_UDATA_DRIVER_DATA_FLAG, UVERBS_ATTR_UHW_OUT, }; enum uverbs_methods_device { UVERBS_METHOD_INVOKE_WRITE, UVERBS_METHOD_INFO_HANDLES, UVERBS_METHOD_QUERY_PORT, UVERBS_METHOD_GET_CONTEXT, UVERBS_METHOD_QUERY_CONTEXT, UVERBS_METHOD_QUERY_GID_TABLE, UVERBS_METHOD_QUERY_GID_ENTRY, }; enum uverbs_attrs_invoke_write_cmd_attr_ids { UVERBS_ATTR_CORE_IN, UVERBS_ATTR_CORE_OUT, UVERBS_ATTR_WRITE_CMD, }; enum uverbs_attrs_query_port_cmd_attr_ids { UVERBS_ATTR_QUERY_PORT_PORT_NUM, UVERBS_ATTR_QUERY_PORT_RESP, }; enum uverbs_attrs_get_context_attr_ids { UVERBS_ATTR_GET_CONTEXT_NUM_COMP_VECTORS, UVERBS_ATTR_GET_CONTEXT_CORE_SUPPORT, }; enum uverbs_attrs_query_context_attr_ids { UVERBS_ATTR_QUERY_CONTEXT_NUM_COMP_VECTORS, UVERBS_ATTR_QUERY_CONTEXT_CORE_SUPPORT, }; enum uverbs_attrs_create_cq_cmd_attr_ids { UVERBS_ATTR_CREATE_CQ_HANDLE, UVERBS_ATTR_CREATE_CQ_CQE, UVERBS_ATTR_CREATE_CQ_USER_HANDLE, UVERBS_ATTR_CREATE_CQ_COMP_CHANNEL, UVERBS_ATTR_CREATE_CQ_COMP_VECTOR, UVERBS_ATTR_CREATE_CQ_FLAGS, UVERBS_ATTR_CREATE_CQ_RESP_CQE, UVERBS_ATTR_CREATE_CQ_EVENT_FD, }; enum uverbs_attrs_destroy_cq_cmd_attr_ids { UVERBS_ATTR_DESTROY_CQ_HANDLE, UVERBS_ATTR_DESTROY_CQ_RESP, }; enum uverbs_attrs_create_flow_action_esp { UVERBS_ATTR_CREATE_FLOW_ACTION_ESP_HANDLE, UVERBS_ATTR_FLOW_ACTION_ESP_ATTRS, UVERBS_ATTR_FLOW_ACTION_ESP_ESN, UVERBS_ATTR_FLOW_ACTION_ESP_KEYMAT, UVERBS_ATTR_FLOW_ACTION_ESP_REPLAY, UVERBS_ATTR_FLOW_ACTION_ESP_ENCAP, }; enum uverbs_attrs_modify_flow_action_esp { UVERBS_ATTR_MODIFY_FLOW_ACTION_ESP_HANDLE = UVERBS_ATTR_CREATE_FLOW_ACTION_ESP_HANDLE, }; enum uverbs_attrs_destroy_flow_action_esp { UVERBS_ATTR_DESTROY_FLOW_ACTION_HANDLE, }; enum uverbs_attrs_create_qp_cmd_attr_ids { UVERBS_ATTR_CREATE_QP_HANDLE, UVERBS_ATTR_CREATE_QP_XRCD_HANDLE, UVERBS_ATTR_CREATE_QP_PD_HANDLE, UVERBS_ATTR_CREATE_QP_SRQ_HANDLE, UVERBS_ATTR_CREATE_QP_SEND_CQ_HANDLE, UVERBS_ATTR_CREATE_QP_RECV_CQ_HANDLE, UVERBS_ATTR_CREATE_QP_IND_TABLE_HANDLE, UVERBS_ATTR_CREATE_QP_USER_HANDLE, UVERBS_ATTR_CREATE_QP_CAP, UVERBS_ATTR_CREATE_QP_TYPE, UVERBS_ATTR_CREATE_QP_FLAGS, UVERBS_ATTR_CREATE_QP_SOURCE_QPN, UVERBS_ATTR_CREATE_QP_EVENT_FD, UVERBS_ATTR_CREATE_QP_RESP_CAP, UVERBS_ATTR_CREATE_QP_RESP_QP_NUM, }; enum uverbs_attrs_destroy_qp_cmd_attr_ids { UVERBS_ATTR_DESTROY_QP_HANDLE, UVERBS_ATTR_DESTROY_QP_RESP, }; enum uverbs_methods_qp { UVERBS_METHOD_QP_CREATE, UVERBS_METHOD_QP_DESTROY, }; enum uverbs_attrs_create_srq_cmd_attr_ids { UVERBS_ATTR_CREATE_SRQ_HANDLE, UVERBS_ATTR_CREATE_SRQ_PD_HANDLE, UVERBS_ATTR_CREATE_SRQ_XRCD_HANDLE, UVERBS_ATTR_CREATE_SRQ_CQ_HANDLE, UVERBS_ATTR_CREATE_SRQ_USER_HANDLE, UVERBS_ATTR_CREATE_SRQ_MAX_WR, UVERBS_ATTR_CREATE_SRQ_MAX_SGE, UVERBS_ATTR_CREATE_SRQ_LIMIT, UVERBS_ATTR_CREATE_SRQ_MAX_NUM_TAGS, UVERBS_ATTR_CREATE_SRQ_TYPE, UVERBS_ATTR_CREATE_SRQ_EVENT_FD, UVERBS_ATTR_CREATE_SRQ_RESP_MAX_WR, UVERBS_ATTR_CREATE_SRQ_RESP_MAX_SGE, UVERBS_ATTR_CREATE_SRQ_RESP_SRQ_NUM, }; enum uverbs_attrs_destroy_srq_cmd_attr_ids { UVERBS_ATTR_DESTROY_SRQ_HANDLE, UVERBS_ATTR_DESTROY_SRQ_RESP, }; enum uverbs_methods_srq { UVERBS_METHOD_SRQ_CREATE, UVERBS_METHOD_SRQ_DESTROY, }; enum uverbs_methods_cq { UVERBS_METHOD_CQ_CREATE, UVERBS_METHOD_CQ_DESTROY, }; enum uverbs_attrs_create_wq_cmd_attr_ids { UVERBS_ATTR_CREATE_WQ_HANDLE, UVERBS_ATTR_CREATE_WQ_PD_HANDLE, UVERBS_ATTR_CREATE_WQ_CQ_HANDLE, UVERBS_ATTR_CREATE_WQ_USER_HANDLE, UVERBS_ATTR_CREATE_WQ_TYPE, UVERBS_ATTR_CREATE_WQ_EVENT_FD, UVERBS_ATTR_CREATE_WQ_MAX_WR, UVERBS_ATTR_CREATE_WQ_MAX_SGE, UVERBS_ATTR_CREATE_WQ_FLAGS, UVERBS_ATTR_CREATE_WQ_RESP_MAX_WR, UVERBS_ATTR_CREATE_WQ_RESP_MAX_SGE, UVERBS_ATTR_CREATE_WQ_RESP_WQ_NUM, }; enum uverbs_attrs_destroy_wq_cmd_attr_ids { UVERBS_ATTR_DESTROY_WQ_HANDLE, UVERBS_ATTR_DESTROY_WQ_RESP, }; enum uverbs_methods_wq { UVERBS_METHOD_WQ_CREATE, UVERBS_METHOD_WQ_DESTROY, }; enum uverbs_methods_actions_flow_action_ops { UVERBS_METHOD_FLOW_ACTION_ESP_CREATE, UVERBS_METHOD_FLOW_ACTION_DESTROY, UVERBS_METHOD_FLOW_ACTION_ESP_MODIFY, }; enum uverbs_attrs_alloc_dm_cmd_attr_ids { UVERBS_ATTR_ALLOC_DM_HANDLE, UVERBS_ATTR_ALLOC_DM_LENGTH, UVERBS_ATTR_ALLOC_DM_ALIGNMENT, }; enum uverbs_attrs_free_dm_cmd_attr_ids { UVERBS_ATTR_FREE_DM_HANDLE, }; enum uverbs_methods_dm { UVERBS_METHOD_DM_ALLOC, UVERBS_METHOD_DM_FREE, }; enum uverbs_attrs_reg_dm_mr_cmd_attr_ids { UVERBS_ATTR_REG_DM_MR_HANDLE, UVERBS_ATTR_REG_DM_MR_OFFSET, UVERBS_ATTR_REG_DM_MR_LENGTH, UVERBS_ATTR_REG_DM_MR_PD_HANDLE, UVERBS_ATTR_REG_DM_MR_ACCESS_FLAGS, UVERBS_ATTR_REG_DM_MR_DM_HANDLE, UVERBS_ATTR_REG_DM_MR_RESP_LKEY, UVERBS_ATTR_REG_DM_MR_RESP_RKEY, }; enum uverbs_methods_mr { UVERBS_METHOD_DM_MR_REG, UVERBS_METHOD_MR_DESTROY, UVERBS_METHOD_ADVISE_MR, UVERBS_METHOD_QUERY_MR, }; enum uverbs_attrs_mr_destroy_ids { UVERBS_ATTR_DESTROY_MR_HANDLE, }; enum uverbs_attrs_advise_mr_cmd_attr_ids { UVERBS_ATTR_ADVISE_MR_PD_HANDLE, UVERBS_ATTR_ADVISE_MR_ADVICE, UVERBS_ATTR_ADVISE_MR_FLAGS, UVERBS_ATTR_ADVISE_MR_SGE_LIST, }; enum uverbs_attrs_query_mr_cmd_attr_ids { UVERBS_ATTR_QUERY_MR_HANDLE, UVERBS_ATTR_QUERY_MR_RESP_LKEY, UVERBS_ATTR_QUERY_MR_RESP_RKEY, UVERBS_ATTR_QUERY_MR_RESP_LENGTH, UVERBS_ATTR_QUERY_MR_RESP_IOVA, }; enum uverbs_attrs_create_counters_cmd_attr_ids { UVERBS_ATTR_CREATE_COUNTERS_HANDLE, }; enum uverbs_attrs_destroy_counters_cmd_attr_ids { UVERBS_ATTR_DESTROY_COUNTERS_HANDLE, }; enum uverbs_attrs_read_counters_cmd_attr_ids { UVERBS_ATTR_READ_COUNTERS_HANDLE, UVERBS_ATTR_READ_COUNTERS_BUFF, UVERBS_ATTR_READ_COUNTERS_FLAGS, }; enum uverbs_methods_actions_counters_ops { UVERBS_METHOD_COUNTERS_CREATE, UVERBS_METHOD_COUNTERS_DESTROY, UVERBS_METHOD_COUNTERS_READ, }; enum uverbs_attrs_info_handles_id { UVERBS_ATTR_INFO_OBJECT_ID, UVERBS_ATTR_INFO_TOTAL_HANDLES, UVERBS_ATTR_INFO_HANDLES_LIST, }; enum uverbs_methods_pd { UVERBS_METHOD_PD_DESTROY, }; enum uverbs_attrs_pd_destroy_ids { UVERBS_ATTR_DESTROY_PD_HANDLE, }; enum uverbs_methods_mw { UVERBS_METHOD_MW_DESTROY, }; enum uverbs_attrs_mw_destroy_ids { UVERBS_ATTR_DESTROY_MW_HANDLE, }; enum uverbs_methods_xrcd { UVERBS_METHOD_XRCD_DESTROY, }; enum uverbs_attrs_xrcd_destroy_ids { UVERBS_ATTR_DESTROY_XRCD_HANDLE, }; enum uverbs_methods_ah { UVERBS_METHOD_AH_DESTROY, }; enum uverbs_attrs_ah_destroy_ids { UVERBS_ATTR_DESTROY_AH_HANDLE, }; enum uverbs_methods_rwq_ind_tbl { UVERBS_METHOD_RWQ_IND_TBL_DESTROY, }; enum uverbs_attrs_rwq_ind_tbl_destroy_ids { UVERBS_ATTR_DESTROY_RWQ_IND_TBL_HANDLE, }; enum uverbs_methods_flow { UVERBS_METHOD_FLOW_DESTROY, }; enum uverbs_attrs_flow_destroy_ids { UVERBS_ATTR_DESTROY_FLOW_HANDLE, }; enum uverbs_method_async_event { UVERBS_METHOD_ASYNC_EVENT_ALLOC, }; enum uverbs_attrs_async_event_create { UVERBS_ATTR_ASYNC_EVENT_ALLOC_FD_HANDLE, }; enum uverbs_attrs_query_gid_table_cmd_attr_ids { UVERBS_ATTR_QUERY_GID_TABLE_ENTRY_SIZE, UVERBS_ATTR_QUERY_GID_TABLE_FLAGS, UVERBS_ATTR_QUERY_GID_TABLE_RESP_ENTRIES, UVERBS_ATTR_QUERY_GID_TABLE_RESP_NUM_ENTRIES, }; enum uverbs_attrs_query_gid_entry_cmd_attr_ids { UVERBS_ATTR_QUERY_GID_ENTRY_PORT, UVERBS_ATTR_QUERY_GID_ENTRY_GID_INDEX, UVERBS_ATTR_QUERY_GID_ENTRY_FLAGS, UVERBS_ATTR_QUERY_GID_ENTRY_RESP_ENTRY, }; #endif vmw_pvrdma-abi.h000064400000017513152526504440007646 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR BSD-2-Clause) */ /* * Copyright (c) 2012-2016 VMware, Inc. All rights reserved. * * This program is free software; you can redistribute it and/or * modify it under the terms of EITHER the GNU General Public License * version 2 as published by the Free Software Foundation or the BSD * 2-Clause License. This program is distributed in the hope that it * will be useful, but WITHOUT ANY WARRANTY; WITHOUT EVEN THE IMPLIED * WARRANTY OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. * See the GNU General Public License version 2 for more details at * http://www.gnu.org/licenses/old-licenses/gpl-2.0.en.html. * * You should have received a copy of the GNU General Public License * along with this program available in the file COPYING in the main * directory of this source tree. * * The BSD 2-Clause License * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS * FOR A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE * COPYRIGHT HOLDER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, * INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES * (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR * SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS INTERRUPTION) * HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN CONTRACT, * STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) * ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED * OF THE POSSIBILITY OF SUCH DAMAGE. */ #ifndef __VMW_PVRDMA_ABI_H__ #define __VMW_PVRDMA_ABI_H__ #include #define PVRDMA_UVERBS_ABI_VERSION 3 /* ABI Version. */ #define PVRDMA_UAR_HANDLE_MASK 0x00FFFFFF /* Bottom 24 bits. */ #define PVRDMA_UAR_QP_OFFSET 0 /* QP doorbell. */ #define PVRDMA_UAR_QP_SEND (1 << 30) /* Send bit. */ #define PVRDMA_UAR_QP_RECV (1 << 31) /* Recv bit. */ #define PVRDMA_UAR_CQ_OFFSET 4 /* CQ doorbell. */ #define PVRDMA_UAR_CQ_ARM_SOL (1 << 29) /* Arm solicited bit. */ #define PVRDMA_UAR_CQ_ARM (1 << 30) /* Arm bit. */ #define PVRDMA_UAR_CQ_POLL (1 << 31) /* Poll bit. */ #define PVRDMA_UAR_SRQ_OFFSET 8 /* SRQ doorbell. */ #define PVRDMA_UAR_SRQ_RECV (1 << 30) /* Recv bit. */ enum pvrdma_wr_opcode { PVRDMA_WR_RDMA_WRITE, PVRDMA_WR_RDMA_WRITE_WITH_IMM, PVRDMA_WR_SEND, PVRDMA_WR_SEND_WITH_IMM, PVRDMA_WR_RDMA_READ, PVRDMA_WR_ATOMIC_CMP_AND_SWP, PVRDMA_WR_ATOMIC_FETCH_AND_ADD, PVRDMA_WR_LSO, PVRDMA_WR_SEND_WITH_INV, PVRDMA_WR_RDMA_READ_WITH_INV, PVRDMA_WR_LOCAL_INV, PVRDMA_WR_FAST_REG_MR, PVRDMA_WR_MASKED_ATOMIC_CMP_AND_SWP, PVRDMA_WR_MASKED_ATOMIC_FETCH_AND_ADD, PVRDMA_WR_BIND_MW, PVRDMA_WR_REG_SIG_MR, PVRDMA_WR_ERROR, }; enum pvrdma_wc_status { PVRDMA_WC_SUCCESS, PVRDMA_WC_LOC_LEN_ERR, PVRDMA_WC_LOC_QP_OP_ERR, PVRDMA_WC_LOC_EEC_OP_ERR, PVRDMA_WC_LOC_PROT_ERR, PVRDMA_WC_WR_FLUSH_ERR, PVRDMA_WC_MW_BIND_ERR, PVRDMA_WC_BAD_RESP_ERR, PVRDMA_WC_LOC_ACCESS_ERR, PVRDMA_WC_REM_INV_REQ_ERR, PVRDMA_WC_REM_ACCESS_ERR, PVRDMA_WC_REM_OP_ERR, PVRDMA_WC_RETRY_EXC_ERR, PVRDMA_WC_RNR_RETRY_EXC_ERR, PVRDMA_WC_LOC_RDD_VIOL_ERR, PVRDMA_WC_REM_INV_RD_REQ_ERR, PVRDMA_WC_REM_ABORT_ERR, PVRDMA_WC_INV_EECN_ERR, PVRDMA_WC_INV_EEC_STATE_ERR, PVRDMA_WC_FATAL_ERR, PVRDMA_WC_RESP_TIMEOUT_ERR, PVRDMA_WC_GENERAL_ERR, }; enum pvrdma_wc_opcode { PVRDMA_WC_SEND, PVRDMA_WC_RDMA_WRITE, PVRDMA_WC_RDMA_READ, PVRDMA_WC_COMP_SWAP, PVRDMA_WC_FETCH_ADD, PVRDMA_WC_BIND_MW, PVRDMA_WC_LSO, PVRDMA_WC_LOCAL_INV, PVRDMA_WC_FAST_REG_MR, PVRDMA_WC_MASKED_COMP_SWAP, PVRDMA_WC_MASKED_FETCH_ADD, PVRDMA_WC_RECV = 1 << 7, PVRDMA_WC_RECV_RDMA_WITH_IMM, }; enum pvrdma_wc_flags { PVRDMA_WC_GRH = 1 << 0, PVRDMA_WC_WITH_IMM = 1 << 1, PVRDMA_WC_WITH_INVALIDATE = 1 << 2, PVRDMA_WC_IP_CSUM_OK = 1 << 3, PVRDMA_WC_WITH_SMAC = 1 << 4, PVRDMA_WC_WITH_VLAN = 1 << 5, PVRDMA_WC_WITH_NETWORK_HDR_TYPE = 1 << 6, PVRDMA_WC_FLAGS_MAX = PVRDMA_WC_WITH_NETWORK_HDR_TYPE, }; enum pvrdma_network_type { PVRDMA_NETWORK_IB, PVRDMA_NETWORK_ROCE_V1 = PVRDMA_NETWORK_IB, PVRDMA_NETWORK_IPV4, PVRDMA_NETWORK_IPV6 }; struct pvrdma_alloc_ucontext_resp { __u32 qp_tab_size; __u32 reserved; }; struct pvrdma_alloc_pd_resp { __u32 pdn; __u32 reserved; }; struct pvrdma_create_cq { __aligned_u64 buf_addr; __u32 buf_size; __u32 reserved; }; struct pvrdma_create_cq_resp { __u32 cqn; __u32 reserved; }; struct pvrdma_resize_cq { __aligned_u64 buf_addr; __u32 buf_size; __u32 reserved; }; struct pvrdma_create_srq { __aligned_u64 buf_addr; __u32 buf_size; __u32 reserved; }; struct pvrdma_create_srq_resp { __u32 srqn; __u32 reserved; }; struct pvrdma_create_qp { __aligned_u64 rbuf_addr; __aligned_u64 sbuf_addr; __u32 rbuf_size; __u32 sbuf_size; __aligned_u64 qp_addr; }; struct pvrdma_create_qp_resp { __u32 qpn; __u32 qp_handle; }; /* PVRDMA masked atomic compare and swap */ struct pvrdma_ex_cmp_swap { __aligned_u64 swap_val; __aligned_u64 compare_val; __aligned_u64 swap_mask; __aligned_u64 compare_mask; }; /* PVRDMA masked atomic fetch and add */ struct pvrdma_ex_fetch_add { __aligned_u64 add_val; __aligned_u64 field_boundary; }; /* PVRDMA address vector. */ struct pvrdma_av { __u32 port_pd; __u32 sl_tclass_flowlabel; __u8 dgid[16]; __u8 src_path_bits; __u8 gid_index; __u8 stat_rate; __u8 hop_limit; __u8 dmac[6]; __u8 reserved[6]; }; /* PVRDMA scatter/gather entry */ struct pvrdma_sge { __aligned_u64 addr; __u32 length; __u32 lkey; }; /* PVRDMA receive queue work request */ struct pvrdma_rq_wqe_hdr { __aligned_u64 wr_id; /* wr id */ __u32 num_sge; /* size of s/g array */ __u32 total_len; /* reserved */ }; /* Use pvrdma_sge (ib_sge) for receive queue s/g array elements. */ /* PVRDMA send queue work request */ struct pvrdma_sq_wqe_hdr { __aligned_u64 wr_id; /* wr id */ __u32 num_sge; /* size of s/g array */ __u32 total_len; /* reserved */ __u32 opcode; /* operation type */ __u32 send_flags; /* wr flags */ union { __be32 imm_data; __u32 invalidate_rkey; } ex; __u32 reserved; union { struct { __aligned_u64 remote_addr; __u32 rkey; __u8 reserved[4]; } rdma; struct { __aligned_u64 remote_addr; __aligned_u64 compare_add; __aligned_u64 swap; __u32 rkey; __u32 reserved; } atomic; struct { __aligned_u64 remote_addr; __u32 log_arg_sz; __u32 rkey; union { struct pvrdma_ex_cmp_swap cmp_swap; struct pvrdma_ex_fetch_add fetch_add; } wr_data; } masked_atomics; struct { __aligned_u64 iova_start; __aligned_u64 pl_pdir_dma; __u32 page_shift; __u32 page_list_len; __u32 length; __u32 access_flags; __u32 rkey; __u32 reserved; } fast_reg; struct { __u32 remote_qpn; __u32 remote_qkey; struct pvrdma_av av; } ud; } wr; }; /* Use pvrdma_sge (ib_sge) for send queue s/g array elements. */ /* Completion queue element. */ struct pvrdma_cqe { __aligned_u64 wr_id; __aligned_u64 qp; __u32 opcode; __u32 status; __u32 byte_len; __be32 imm_data; __u32 src_qp; __u32 wc_flags; __u32 vendor_err; __u16 pkey_index; __u16 slid; __u8 sl; __u8 dlid_path_bits; __u8 port_num; __u8 smac[6]; __u8 network_hdr_type; __u8 reserved2[6]; /* Pad to next power of 2 (64). */ }; #endif /* __VMW_PVRDMA_ABI_H__ */ ib_user_verbs.h000064400000070445152526504440007567 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2005 Topspin Communications. All rights reserved. * Copyright (c) 2005, 2006 Cisco Systems. All rights reserved. * Copyright (c) 2005 PathScale, Inc. All rights reserved. * Copyright (c) 2006 Mellanox Technologies. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef IB_USER_VERBS_H #define IB_USER_VERBS_H #include /* * Increment this value if any changes that break userspace ABI * compatibility are made. */ #define IB_USER_VERBS_ABI_VERSION 6 #define IB_USER_VERBS_CMD_THRESHOLD 50 enum ib_uverbs_write_cmds { IB_USER_VERBS_CMD_GET_CONTEXT, IB_USER_VERBS_CMD_QUERY_DEVICE, IB_USER_VERBS_CMD_QUERY_PORT, IB_USER_VERBS_CMD_ALLOC_PD, IB_USER_VERBS_CMD_DEALLOC_PD, IB_USER_VERBS_CMD_CREATE_AH, IB_USER_VERBS_CMD_MODIFY_AH, IB_USER_VERBS_CMD_QUERY_AH, IB_USER_VERBS_CMD_DESTROY_AH, IB_USER_VERBS_CMD_REG_MR, IB_USER_VERBS_CMD_REG_SMR, IB_USER_VERBS_CMD_REREG_MR, IB_USER_VERBS_CMD_QUERY_MR, IB_USER_VERBS_CMD_DEREG_MR, IB_USER_VERBS_CMD_ALLOC_MW, IB_USER_VERBS_CMD_BIND_MW, IB_USER_VERBS_CMD_DEALLOC_MW, IB_USER_VERBS_CMD_CREATE_COMP_CHANNEL, IB_USER_VERBS_CMD_CREATE_CQ, IB_USER_VERBS_CMD_RESIZE_CQ, IB_USER_VERBS_CMD_DESTROY_CQ, IB_USER_VERBS_CMD_POLL_CQ, IB_USER_VERBS_CMD_PEEK_CQ, IB_USER_VERBS_CMD_REQ_NOTIFY_CQ, IB_USER_VERBS_CMD_CREATE_QP, IB_USER_VERBS_CMD_QUERY_QP, IB_USER_VERBS_CMD_MODIFY_QP, IB_USER_VERBS_CMD_DESTROY_QP, IB_USER_VERBS_CMD_POST_SEND, IB_USER_VERBS_CMD_POST_RECV, IB_USER_VERBS_CMD_ATTACH_MCAST, IB_USER_VERBS_CMD_DETACH_MCAST, IB_USER_VERBS_CMD_CREATE_SRQ, IB_USER_VERBS_CMD_MODIFY_SRQ, IB_USER_VERBS_CMD_QUERY_SRQ, IB_USER_VERBS_CMD_DESTROY_SRQ, IB_USER_VERBS_CMD_POST_SRQ_RECV, IB_USER_VERBS_CMD_OPEN_XRCD, IB_USER_VERBS_CMD_CLOSE_XRCD, IB_USER_VERBS_CMD_CREATE_XSRQ, IB_USER_VERBS_CMD_OPEN_QP, }; enum { IB_USER_VERBS_EX_CMD_QUERY_DEVICE = IB_USER_VERBS_CMD_QUERY_DEVICE, IB_USER_VERBS_EX_CMD_CREATE_CQ = IB_USER_VERBS_CMD_CREATE_CQ, IB_USER_VERBS_EX_CMD_CREATE_QP = IB_USER_VERBS_CMD_CREATE_QP, IB_USER_VERBS_EX_CMD_MODIFY_QP = IB_USER_VERBS_CMD_MODIFY_QP, IB_USER_VERBS_EX_CMD_CREATE_FLOW = IB_USER_VERBS_CMD_THRESHOLD, IB_USER_VERBS_EX_CMD_DESTROY_FLOW, IB_USER_VERBS_EX_CMD_CREATE_WQ, IB_USER_VERBS_EX_CMD_MODIFY_WQ, IB_USER_VERBS_EX_CMD_DESTROY_WQ, IB_USER_VERBS_EX_CMD_CREATE_RWQ_IND_TBL, IB_USER_VERBS_EX_CMD_DESTROY_RWQ_IND_TBL, IB_USER_VERBS_EX_CMD_MODIFY_CQ }; /* see IBA A19.4.1.1 Placement Types */ enum ib_placement_type { IB_FLUSH_GLOBAL = 1U << 0, IB_FLUSH_PERSISTENT = 1U << 1, }; /* see IBA A19.4.1.2 Selectivity Level */ enum ib_selectivity_level { IB_FLUSH_RANGE = 0, IB_FLUSH_MR, }; /* * Make sure that all structs defined in this file remain laid out so * that they pack the same way on 32-bit and 64-bit architectures (to * avoid incompatibility between 32-bit userspace and 64-bit kernels). * Specifically: * - Do not use pointer types -- pass pointers in __u64 instead. * - Make sure that any structure larger than 4 bytes is padded to a * multiple of 8 bytes. Otherwise the structure size will be * different between 32-bit and 64-bit architectures. */ struct ib_uverbs_async_event_desc { __aligned_u64 element; __u32 event_type; /* enum ib_event_type */ __u32 reserved; }; struct ib_uverbs_comp_event_desc { __aligned_u64 cq_handle; }; struct ib_uverbs_cq_moderation_caps { __u16 max_cq_moderation_count; __u16 max_cq_moderation_period; __u32 reserved; }; /* * All commands from userspace should start with a __u32 command field * followed by __u16 in_words and out_words fields (which give the * length of the command block and response buffer if any in 32-bit * words). The kernel driver will read these fields first and read * the rest of the command struct based on these value. */ #define IB_USER_VERBS_CMD_COMMAND_MASK 0xff #define IB_USER_VERBS_CMD_FLAG_EXTENDED 0x80000000u struct ib_uverbs_cmd_hdr { __u32 command; __u16 in_words; __u16 out_words; }; struct ib_uverbs_ex_cmd_hdr { __aligned_u64 response; __u16 provider_in_words; __u16 provider_out_words; __u32 cmd_hdr_reserved; }; struct ib_uverbs_get_context { __aligned_u64 response; __aligned_u64 driver_data[]; }; struct ib_uverbs_get_context_resp { __u32 async_fd; __u32 num_comp_vectors; __aligned_u64 driver_data[]; }; struct ib_uverbs_query_device { __aligned_u64 response; __aligned_u64 driver_data[]; }; struct ib_uverbs_query_device_resp { __aligned_u64 fw_ver; __be64 node_guid; __be64 sys_image_guid; __aligned_u64 max_mr_size; __aligned_u64 page_size_cap; __u32 vendor_id; __u32 vendor_part_id; __u32 hw_ver; __u32 max_qp; __u32 max_qp_wr; __u32 device_cap_flags; __u32 max_sge; __u32 max_sge_rd; __u32 max_cq; __u32 max_cqe; __u32 max_mr; __u32 max_pd; __u32 max_qp_rd_atom; __u32 max_ee_rd_atom; __u32 max_res_rd_atom; __u32 max_qp_init_rd_atom; __u32 max_ee_init_rd_atom; __u32 atomic_cap; __u32 max_ee; __u32 max_rdd; __u32 max_mw; __u32 max_raw_ipv6_qp; __u32 max_raw_ethy_qp; __u32 max_mcast_grp; __u32 max_mcast_qp_attach; __u32 max_total_mcast_qp_attach; __u32 max_ah; __u32 max_fmr; __u32 max_map_per_fmr; __u32 max_srq; __u32 max_srq_wr; __u32 max_srq_sge; __u16 max_pkeys; __u8 local_ca_ack_delay; __u8 phys_port_cnt; __u8 reserved[4]; }; struct ib_uverbs_ex_query_device { __u32 comp_mask; __u32 reserved; }; struct ib_uverbs_odp_caps { __aligned_u64 general_caps; struct { __u32 rc_odp_caps; __u32 uc_odp_caps; __u32 ud_odp_caps; } per_transport_caps; __u32 reserved; }; struct ib_uverbs_rss_caps { /* Corresponding bit will be set if qp type from * 'enum ib_qp_type' is supported, e.g. * supported_qpts |= 1 << IB_QPT_UD */ __u32 supported_qpts; __u32 max_rwq_indirection_tables; __u32 max_rwq_indirection_table_size; __u32 reserved; }; struct ib_uverbs_tm_caps { /* Max size of rendezvous request message */ __u32 max_rndv_hdr_size; /* Max number of entries in tag matching list */ __u32 max_num_tags; /* TM flags */ __u32 flags; /* Max number of outstanding list operations */ __u32 max_ops; /* Max number of SGE in tag matching entry */ __u32 max_sge; __u32 reserved; }; struct ib_uverbs_ex_query_device_resp { struct ib_uverbs_query_device_resp base; __u32 comp_mask; __u32 response_length; struct ib_uverbs_odp_caps odp_caps; __aligned_u64 timestamp_mask; __aligned_u64 hca_core_clock; /* in KHZ */ __aligned_u64 device_cap_flags_ex; struct ib_uverbs_rss_caps rss_caps; __u32 max_wq_type_rq; __u32 raw_packet_caps; struct ib_uverbs_tm_caps tm_caps; struct ib_uverbs_cq_moderation_caps cq_moderation_caps; __aligned_u64 max_dm_size; __u32 xrc_odp_caps; __u32 reserved; }; struct ib_uverbs_query_port { __aligned_u64 response; __u8 port_num; __u8 reserved[7]; __aligned_u64 driver_data[]; }; struct ib_uverbs_query_port_resp { __u32 port_cap_flags; /* see ib_uverbs_query_port_cap_flags */ __u32 max_msg_sz; __u32 bad_pkey_cntr; __u32 qkey_viol_cntr; __u32 gid_tbl_len; __u16 pkey_tbl_len; __u16 lid; __u16 sm_lid; __u8 state; __u8 max_mtu; __u8 active_mtu; __u8 lmc; __u8 max_vl_num; __u8 sm_sl; __u8 subnet_timeout; __u8 init_type_reply; __u8 active_width; __u8 active_speed; __u8 phys_state; __u8 link_layer; __u8 flags; /* see ib_uverbs_query_port_flags */ __u8 reserved; }; struct ib_uverbs_alloc_pd { __aligned_u64 response; __aligned_u64 driver_data[]; }; struct ib_uverbs_alloc_pd_resp { __u32 pd_handle; __u32 driver_data[]; }; struct ib_uverbs_dealloc_pd { __u32 pd_handle; }; struct ib_uverbs_open_xrcd { __aligned_u64 response; __u32 fd; __u32 oflags; __aligned_u64 driver_data[]; }; struct ib_uverbs_open_xrcd_resp { __u32 xrcd_handle; __u32 driver_data[]; }; struct ib_uverbs_close_xrcd { __u32 xrcd_handle; }; struct ib_uverbs_reg_mr { __aligned_u64 response; __aligned_u64 start; __aligned_u64 length; __aligned_u64 hca_va; __u32 pd_handle; __u32 access_flags; __aligned_u64 driver_data[]; }; struct ib_uverbs_reg_mr_resp { __u32 mr_handle; __u32 lkey; __u32 rkey; __u32 driver_data[]; }; struct ib_uverbs_rereg_mr { __aligned_u64 response; __u32 mr_handle; __u32 flags; __aligned_u64 start; __aligned_u64 length; __aligned_u64 hca_va; __u32 pd_handle; __u32 access_flags; __aligned_u64 driver_data[]; }; struct ib_uverbs_rereg_mr_resp { __u32 lkey; __u32 rkey; __aligned_u64 driver_data[]; }; struct ib_uverbs_dereg_mr { __u32 mr_handle; }; struct ib_uverbs_alloc_mw { __aligned_u64 response; __u32 pd_handle; __u8 mw_type; __u8 reserved[3]; __aligned_u64 driver_data[]; }; struct ib_uverbs_alloc_mw_resp { __u32 mw_handle; __u32 rkey; __aligned_u64 driver_data[]; }; struct ib_uverbs_dealloc_mw { __u32 mw_handle; }; struct ib_uverbs_create_comp_channel { __aligned_u64 response; }; struct ib_uverbs_create_comp_channel_resp { __u32 fd; }; struct ib_uverbs_create_cq { __aligned_u64 response; __aligned_u64 user_handle; __u32 cqe; __u32 comp_vector; __s32 comp_channel; __u32 reserved; __aligned_u64 driver_data[]; }; enum ib_uverbs_ex_create_cq_flags { IB_UVERBS_CQ_FLAGS_TIMESTAMP_COMPLETION = 1 << 0, IB_UVERBS_CQ_FLAGS_IGNORE_OVERRUN = 1 << 1, }; struct ib_uverbs_ex_create_cq { __aligned_u64 user_handle; __u32 cqe; __u32 comp_vector; __s32 comp_channel; __u32 comp_mask; __u32 flags; /* bitmask of ib_uverbs_ex_create_cq_flags */ __u32 reserved; }; struct ib_uverbs_create_cq_resp { __u32 cq_handle; __u32 cqe; __aligned_u64 driver_data[0]; }; struct ib_uverbs_ex_create_cq_resp { struct ib_uverbs_create_cq_resp base; __u32 comp_mask; __u32 response_length; }; struct ib_uverbs_resize_cq { __aligned_u64 response; __u32 cq_handle; __u32 cqe; __aligned_u64 driver_data[]; }; struct ib_uverbs_resize_cq_resp { __u32 cqe; __u32 reserved; __aligned_u64 driver_data[]; }; struct ib_uverbs_poll_cq { __aligned_u64 response; __u32 cq_handle; __u32 ne; }; enum ib_uverbs_wc_opcode { IB_UVERBS_WC_SEND = 0, IB_UVERBS_WC_RDMA_WRITE = 1, IB_UVERBS_WC_RDMA_READ = 2, IB_UVERBS_WC_COMP_SWAP = 3, IB_UVERBS_WC_FETCH_ADD = 4, IB_UVERBS_WC_BIND_MW = 5, IB_UVERBS_WC_LOCAL_INV = 6, IB_UVERBS_WC_TSO = 7, IB_UVERBS_WC_FLUSH = 8, IB_UVERBS_WC_ATOMIC_WRITE = 9, }; struct ib_uverbs_wc { __aligned_u64 wr_id; __u32 status; __u32 opcode; __u32 vendor_err; __u32 byte_len; union { __be32 imm_data; __u32 invalidate_rkey; } ex; __u32 qp_num; __u32 src_qp; __u32 wc_flags; __u16 pkey_index; __u16 slid; __u8 sl; __u8 dlid_path_bits; __u8 port_num; __u8 reserved; }; struct ib_uverbs_poll_cq_resp { __u32 count; __u32 reserved; struct ib_uverbs_wc wc[]; }; struct ib_uverbs_req_notify_cq { __u32 cq_handle; __u32 solicited_only; }; struct ib_uverbs_destroy_cq { __aligned_u64 response; __u32 cq_handle; __u32 reserved; }; struct ib_uverbs_destroy_cq_resp { __u32 comp_events_reported; __u32 async_events_reported; }; struct ib_uverbs_global_route { __u8 dgid[16]; __u32 flow_label; __u8 sgid_index; __u8 hop_limit; __u8 traffic_class; __u8 reserved; }; struct ib_uverbs_ah_attr { struct ib_uverbs_global_route grh; __u16 dlid; __u8 sl; __u8 src_path_bits; __u8 static_rate; __u8 is_global; __u8 port_num; __u8 reserved; }; struct ib_uverbs_qp_attr { __u32 qp_attr_mask; __u32 qp_state; __u32 cur_qp_state; __u32 path_mtu; __u32 path_mig_state; __u32 qkey; __u32 rq_psn; __u32 sq_psn; __u32 dest_qp_num; __u32 qp_access_flags; struct ib_uverbs_ah_attr ah_attr; struct ib_uverbs_ah_attr alt_ah_attr; /* ib_qp_cap */ __u32 max_send_wr; __u32 max_recv_wr; __u32 max_send_sge; __u32 max_recv_sge; __u32 max_inline_data; __u16 pkey_index; __u16 alt_pkey_index; __u8 en_sqd_async_notify; __u8 sq_draining; __u8 max_rd_atomic; __u8 max_dest_rd_atomic; __u8 min_rnr_timer; __u8 port_num; __u8 timeout; __u8 retry_cnt; __u8 rnr_retry; __u8 alt_port_num; __u8 alt_timeout; __u8 reserved[5]; }; struct ib_uverbs_create_qp { __aligned_u64 response; __aligned_u64 user_handle; __u32 pd_handle; __u32 send_cq_handle; __u32 recv_cq_handle; __u32 srq_handle; __u32 max_send_wr; __u32 max_recv_wr; __u32 max_send_sge; __u32 max_recv_sge; __u32 max_inline_data; __u8 sq_sig_all; __u8 qp_type; __u8 is_srq; __u8 reserved; __aligned_u64 driver_data[]; }; enum ib_uverbs_create_qp_mask { IB_UVERBS_CREATE_QP_MASK_IND_TABLE = 1UL << 0, }; enum { IB_UVERBS_CREATE_QP_SUP_COMP_MASK = IB_UVERBS_CREATE_QP_MASK_IND_TABLE, }; struct ib_uverbs_ex_create_qp { __aligned_u64 user_handle; __u32 pd_handle; __u32 send_cq_handle; __u32 recv_cq_handle; __u32 srq_handle; __u32 max_send_wr; __u32 max_recv_wr; __u32 max_send_sge; __u32 max_recv_sge; __u32 max_inline_data; __u8 sq_sig_all; __u8 qp_type; __u8 is_srq; __u8 reserved; __u32 comp_mask; __u32 create_flags; __u32 rwq_ind_tbl_handle; __u32 source_qpn; }; struct ib_uverbs_open_qp { __aligned_u64 response; __aligned_u64 user_handle; __u32 pd_handle; __u32 qpn; __u8 qp_type; __u8 reserved[7]; __aligned_u64 driver_data[]; }; /* also used for open response */ struct ib_uverbs_create_qp_resp { __u32 qp_handle; __u32 qpn; __u32 max_send_wr; __u32 max_recv_wr; __u32 max_send_sge; __u32 max_recv_sge; __u32 max_inline_data; __u32 reserved; __u32 driver_data[0]; }; struct ib_uverbs_ex_create_qp_resp { struct ib_uverbs_create_qp_resp base; __u32 comp_mask; __u32 response_length; }; /* * This struct needs to remain a multiple of 8 bytes to keep the * alignment of the modify QP parameters. */ struct ib_uverbs_qp_dest { __u8 dgid[16]; __u32 flow_label; __u16 dlid; __u16 reserved; __u8 sgid_index; __u8 hop_limit; __u8 traffic_class; __u8 sl; __u8 src_path_bits; __u8 static_rate; __u8 is_global; __u8 port_num; }; struct ib_uverbs_query_qp { __aligned_u64 response; __u32 qp_handle; __u32 attr_mask; __aligned_u64 driver_data[]; }; struct ib_uverbs_query_qp_resp { struct ib_uverbs_qp_dest dest; struct ib_uverbs_qp_dest alt_dest; __u32 max_send_wr; __u32 max_recv_wr; __u32 max_send_sge; __u32 max_recv_sge; __u32 max_inline_data; __u32 qkey; __u32 rq_psn; __u32 sq_psn; __u32 dest_qp_num; __u32 qp_access_flags; __u16 pkey_index; __u16 alt_pkey_index; __u8 qp_state; __u8 cur_qp_state; __u8 path_mtu; __u8 path_mig_state; __u8 sq_draining; __u8 max_rd_atomic; __u8 max_dest_rd_atomic; __u8 min_rnr_timer; __u8 port_num; __u8 timeout; __u8 retry_cnt; __u8 rnr_retry; __u8 alt_port_num; __u8 alt_timeout; __u8 sq_sig_all; __u8 reserved[5]; __aligned_u64 driver_data[]; }; struct ib_uverbs_modify_qp { struct ib_uverbs_qp_dest dest; struct ib_uverbs_qp_dest alt_dest; __u32 qp_handle; __u32 attr_mask; __u32 qkey; __u32 rq_psn; __u32 sq_psn; __u32 dest_qp_num; __u32 qp_access_flags; __u16 pkey_index; __u16 alt_pkey_index; __u8 qp_state; __u8 cur_qp_state; __u8 path_mtu; __u8 path_mig_state; __u8 en_sqd_async_notify; __u8 max_rd_atomic; __u8 max_dest_rd_atomic; __u8 min_rnr_timer; __u8 port_num; __u8 timeout; __u8 retry_cnt; __u8 rnr_retry; __u8 alt_port_num; __u8 alt_timeout; __u8 reserved[2]; __aligned_u64 driver_data[0]; }; struct ib_uverbs_ex_modify_qp { struct ib_uverbs_modify_qp base; __u32 rate_limit; __u32 reserved; }; struct ib_uverbs_ex_modify_qp_resp { __u32 comp_mask; __u32 response_length; }; struct ib_uverbs_destroy_qp { __aligned_u64 response; __u32 qp_handle; __u32 reserved; }; struct ib_uverbs_destroy_qp_resp { __u32 events_reported; }; /* * The ib_uverbs_sge structure isn't used anywhere, since we assume * the ib_sge structure is packed the same way on 32-bit and 64-bit * architectures in both kernel and user space. It's just here to * document the ABI. */ struct ib_uverbs_sge { __aligned_u64 addr; __u32 length; __u32 lkey; }; enum ib_uverbs_wr_opcode { IB_UVERBS_WR_RDMA_WRITE = 0, IB_UVERBS_WR_RDMA_WRITE_WITH_IMM = 1, IB_UVERBS_WR_SEND = 2, IB_UVERBS_WR_SEND_WITH_IMM = 3, IB_UVERBS_WR_RDMA_READ = 4, IB_UVERBS_WR_ATOMIC_CMP_AND_SWP = 5, IB_UVERBS_WR_ATOMIC_FETCH_AND_ADD = 6, IB_UVERBS_WR_LOCAL_INV = 7, IB_UVERBS_WR_BIND_MW = 8, IB_UVERBS_WR_SEND_WITH_INV = 9, IB_UVERBS_WR_TSO = 10, IB_UVERBS_WR_RDMA_READ_WITH_INV = 11, IB_UVERBS_WR_MASKED_ATOMIC_CMP_AND_SWP = 12, IB_UVERBS_WR_MASKED_ATOMIC_FETCH_AND_ADD = 13, IB_UVERBS_WR_FLUSH = 14, IB_UVERBS_WR_ATOMIC_WRITE = 15, /* Review enum ib_wr_opcode before modifying this */ }; struct ib_uverbs_send_wr { __aligned_u64 wr_id; __u32 num_sge; __u32 opcode; /* see enum ib_uverbs_wr_opcode */ __u32 send_flags; union { __be32 imm_data; __u32 invalidate_rkey; } ex; union { struct { __aligned_u64 remote_addr; __u32 rkey; __u32 reserved; } rdma; struct { __aligned_u64 remote_addr; __aligned_u64 compare_add; __aligned_u64 swap; __u32 rkey; __u32 reserved; } atomic; struct { __u32 ah; __u32 remote_qpn; __u32 remote_qkey; __u32 reserved; } ud; } wr; }; struct ib_uverbs_post_send { __aligned_u64 response; __u32 qp_handle; __u32 wr_count; __u32 sge_count; __u32 wqe_size; struct ib_uverbs_send_wr send_wr[]; }; struct ib_uverbs_post_send_resp { __u32 bad_wr; }; struct ib_uverbs_recv_wr { __aligned_u64 wr_id; __u32 num_sge; __u32 reserved; }; struct ib_uverbs_post_recv { __aligned_u64 response; __u32 qp_handle; __u32 wr_count; __u32 sge_count; __u32 wqe_size; struct ib_uverbs_recv_wr recv_wr[]; }; struct ib_uverbs_post_recv_resp { __u32 bad_wr; }; struct ib_uverbs_post_srq_recv { __aligned_u64 response; __u32 srq_handle; __u32 wr_count; __u32 sge_count; __u32 wqe_size; struct ib_uverbs_recv_wr recv[]; }; struct ib_uverbs_post_srq_recv_resp { __u32 bad_wr; }; struct ib_uverbs_create_ah { __aligned_u64 response; __aligned_u64 user_handle; __u32 pd_handle; __u32 reserved; struct ib_uverbs_ah_attr attr; __aligned_u64 driver_data[]; }; struct ib_uverbs_create_ah_resp { __u32 ah_handle; __u32 driver_data[]; }; struct ib_uverbs_destroy_ah { __u32 ah_handle; }; struct ib_uverbs_attach_mcast { __u8 gid[16]; __u32 qp_handle; __u16 mlid; __u16 reserved; __aligned_u64 driver_data[]; }; struct ib_uverbs_detach_mcast { __u8 gid[16]; __u32 qp_handle; __u16 mlid; __u16 reserved; __aligned_u64 driver_data[]; }; struct ib_uverbs_flow_spec_hdr { __u32 type; __u16 size; __u16 reserved; /* followed by flow_spec */ __aligned_u64 flow_spec_data[0]; }; struct ib_uverbs_flow_eth_filter { __u8 dst_mac[6]; __u8 src_mac[6]; __be16 ether_type; __be16 vlan_tag; }; struct ib_uverbs_flow_spec_eth { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_eth_filter val; struct ib_uverbs_flow_eth_filter mask; }; struct ib_uverbs_flow_ipv4_filter { __be32 src_ip; __be32 dst_ip; __u8 proto; __u8 tos; __u8 ttl; __u8 flags; }; struct ib_uverbs_flow_spec_ipv4 { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_ipv4_filter val; struct ib_uverbs_flow_ipv4_filter mask; }; struct ib_uverbs_flow_tcp_udp_filter { __be16 dst_port; __be16 src_port; }; struct ib_uverbs_flow_spec_tcp_udp { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_tcp_udp_filter val; struct ib_uverbs_flow_tcp_udp_filter mask; }; struct ib_uverbs_flow_ipv6_filter { __u8 src_ip[16]; __u8 dst_ip[16]; __be32 flow_label; __u8 next_hdr; __u8 traffic_class; __u8 hop_limit; __u8 reserved; }; struct ib_uverbs_flow_spec_ipv6 { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_ipv6_filter val; struct ib_uverbs_flow_ipv6_filter mask; }; struct ib_uverbs_flow_spec_action_tag { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; __u32 tag_id; __u32 reserved1; }; struct ib_uverbs_flow_spec_action_drop { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; }; struct ib_uverbs_flow_spec_action_handle { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; __u32 handle; __u32 reserved1; }; struct ib_uverbs_flow_spec_action_count { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; __u32 handle; __u32 reserved1; }; struct ib_uverbs_flow_tunnel_filter { __be32 tunnel_id; }; struct ib_uverbs_flow_spec_tunnel { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_tunnel_filter val; struct ib_uverbs_flow_tunnel_filter mask; }; struct ib_uverbs_flow_spec_esp_filter { __u32 spi; __u32 seq; }; struct ib_uverbs_flow_spec_esp { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_spec_esp_filter val; struct ib_uverbs_flow_spec_esp_filter mask; }; struct ib_uverbs_flow_gre_filter { /* c_ks_res0_ver field is bits 0-15 in offset 0 of a standard GRE header: * bit 0 - C - checksum bit. * bit 1 - reserved. set to 0. * bit 2 - key bit. * bit 3 - sequence number bit. * bits 4:12 - reserved. set to 0. * bits 13:15 - GRE version. */ __be16 c_ks_res0_ver; __be16 protocol; __be32 key; }; struct ib_uverbs_flow_spec_gre { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_gre_filter val; struct ib_uverbs_flow_gre_filter mask; }; struct ib_uverbs_flow_mpls_filter { /* The field includes the entire MPLS label: * bits 0:19 - label field. * bits 20:22 - traffic class field. * bits 23 - bottom of stack bit. * bits 24:31 - ttl field. */ __be32 label; }; struct ib_uverbs_flow_spec_mpls { union { struct ib_uverbs_flow_spec_hdr hdr; struct { __u32 type; __u16 size; __u16 reserved; }; }; struct ib_uverbs_flow_mpls_filter val; struct ib_uverbs_flow_mpls_filter mask; }; struct ib_uverbs_flow_attr { __u32 type; __u16 size; __u16 priority; __u8 num_of_specs; __u8 reserved[2]; __u8 port; __u32 flags; /* Following are the optional layers according to user request * struct ib_flow_spec_xxx * struct ib_flow_spec_yyy */ struct ib_uverbs_flow_spec_hdr flow_specs[]; }; struct ib_uverbs_create_flow { __u32 comp_mask; __u32 qp_handle; struct ib_uverbs_flow_attr flow_attr; }; struct ib_uverbs_create_flow_resp { __u32 comp_mask; __u32 flow_handle; }; struct ib_uverbs_destroy_flow { __u32 comp_mask; __u32 flow_handle; }; struct ib_uverbs_create_srq { __aligned_u64 response; __aligned_u64 user_handle; __u32 pd_handle; __u32 max_wr; __u32 max_sge; __u32 srq_limit; __aligned_u64 driver_data[]; }; struct ib_uverbs_create_xsrq { __aligned_u64 response; __aligned_u64 user_handle; __u32 srq_type; __u32 pd_handle; __u32 max_wr; __u32 max_sge; __u32 srq_limit; __u32 max_num_tags; __u32 xrcd_handle; __u32 cq_handle; __aligned_u64 driver_data[]; }; struct ib_uverbs_create_srq_resp { __u32 srq_handle; __u32 max_wr; __u32 max_sge; __u32 srqn; __u32 driver_data[]; }; struct ib_uverbs_modify_srq { __u32 srq_handle; __u32 attr_mask; __u32 max_wr; __u32 srq_limit; __aligned_u64 driver_data[]; }; struct ib_uverbs_query_srq { __aligned_u64 response; __u32 srq_handle; __u32 reserved; __aligned_u64 driver_data[]; }; struct ib_uverbs_query_srq_resp { __u32 max_wr; __u32 max_sge; __u32 srq_limit; __u32 reserved; }; struct ib_uverbs_destroy_srq { __aligned_u64 response; __u32 srq_handle; __u32 reserved; }; struct ib_uverbs_destroy_srq_resp { __u32 events_reported; }; struct ib_uverbs_ex_create_wq { __u32 comp_mask; __u32 wq_type; __aligned_u64 user_handle; __u32 pd_handle; __u32 cq_handle; __u32 max_wr; __u32 max_sge; __u32 create_flags; /* Use enum ib_wq_flags */ __u32 reserved; }; struct ib_uverbs_ex_create_wq_resp { __u32 comp_mask; __u32 response_length; __u32 wq_handle; __u32 max_wr; __u32 max_sge; __u32 wqn; }; struct ib_uverbs_ex_destroy_wq { __u32 comp_mask; __u32 wq_handle; }; struct ib_uverbs_ex_destroy_wq_resp { __u32 comp_mask; __u32 response_length; __u32 events_reported; __u32 reserved; }; struct ib_uverbs_ex_modify_wq { __u32 attr_mask; __u32 wq_handle; __u32 wq_state; __u32 curr_wq_state; __u32 flags; /* Use enum ib_wq_flags */ __u32 flags_mask; /* Use enum ib_wq_flags */ }; /* Prevent memory allocation rather than max expected size */ #define IB_USER_VERBS_MAX_LOG_IND_TBL_SIZE 0x0d struct ib_uverbs_ex_create_rwq_ind_table { __u32 comp_mask; __u32 log_ind_tbl_size; /* Following are the wq handles according to log_ind_tbl_size * wq_handle1 * wq_handle2 */ __u32 wq_handles[]; }; struct ib_uverbs_ex_create_rwq_ind_table_resp { __u32 comp_mask; __u32 response_length; __u32 ind_tbl_handle; __u32 ind_tbl_num; }; struct ib_uverbs_ex_destroy_rwq_ind_table { __u32 comp_mask; __u32 ind_tbl_handle; }; struct ib_uverbs_cq_moderation { __u16 cq_count; __u16 cq_period; }; struct ib_uverbs_ex_modify_cq { __u32 cq_handle; __u32 attr_mask; struct ib_uverbs_cq_moderation attr; __u32 reserved; }; #define IB_DEVICE_NAME_MAX 64 /* * bits 9, 15, 16, 19, 22, 27, 30, 31, 32, 33, 35 and 37 may be set by old * kernels and should not be used. */ enum ib_uverbs_device_cap_flags { IB_UVERBS_DEVICE_RESIZE_MAX_WR = 1 << 0, IB_UVERBS_DEVICE_BAD_PKEY_CNTR = 1 << 1, IB_UVERBS_DEVICE_BAD_QKEY_CNTR = 1 << 2, IB_UVERBS_DEVICE_RAW_MULTI = 1 << 3, IB_UVERBS_DEVICE_AUTO_PATH_MIG = 1 << 4, IB_UVERBS_DEVICE_CHANGE_PHY_PORT = 1 << 5, IB_UVERBS_DEVICE_UD_AV_PORT_ENFORCE = 1 << 6, IB_UVERBS_DEVICE_CURR_QP_STATE_MOD = 1 << 7, IB_UVERBS_DEVICE_SHUTDOWN_PORT = 1 << 8, /* IB_UVERBS_DEVICE_INIT_TYPE = 1 << 9, (not in use) */ IB_UVERBS_DEVICE_PORT_ACTIVE_EVENT = 1 << 10, IB_UVERBS_DEVICE_SYS_IMAGE_GUID = 1 << 11, IB_UVERBS_DEVICE_RC_RNR_NAK_GEN = 1 << 12, IB_UVERBS_DEVICE_SRQ_RESIZE = 1 << 13, IB_UVERBS_DEVICE_N_NOTIFY_CQ = 1 << 14, IB_UVERBS_DEVICE_MEM_WINDOW = 1 << 17, IB_UVERBS_DEVICE_UD_IP_CSUM = 1 << 18, IB_UVERBS_DEVICE_XRC = 1 << 20, IB_UVERBS_DEVICE_MEM_MGT_EXTENSIONS = 1 << 21, IB_UVERBS_DEVICE_MEM_WINDOW_TYPE_2A = 1 << 23, IB_UVERBS_DEVICE_MEM_WINDOW_TYPE_2B = 1 << 24, IB_UVERBS_DEVICE_RC_IP_CSUM = 1 << 25, /* Deprecated. Please use IB_UVERBS_RAW_PACKET_CAP_IP_CSUM. */ IB_UVERBS_DEVICE_RAW_IP_CSUM = 1 << 26, IB_UVERBS_DEVICE_MANAGED_FLOW_STEERING = 1 << 29, /* Deprecated. Please use IB_UVERBS_RAW_PACKET_CAP_SCATTER_FCS. */ IB_UVERBS_DEVICE_RAW_SCATTER_FCS = 1ULL << 34, IB_UVERBS_DEVICE_PCI_WRITE_END_PADDING = 1ULL << 36, /* Flush placement types */ IB_UVERBS_DEVICE_FLUSH_GLOBAL = 1ULL << 38, IB_UVERBS_DEVICE_FLUSH_PERSISTENT = 1ULL << 39, /* Atomic write attributes */ IB_UVERBS_DEVICE_ATOMIC_WRITE = 1ULL << 40, }; enum ib_uverbs_raw_packet_caps { IB_UVERBS_RAW_PACKET_CAP_CVLAN_STRIPPING = 1 << 0, IB_UVERBS_RAW_PACKET_CAP_SCATTER_FCS = 1 << 1, IB_UVERBS_RAW_PACKET_CAP_IP_CSUM = 1 << 2, IB_UVERBS_RAW_PACKET_CAP_DELAY_DROP = 1 << 3, }; #endif /* IB_USER_VERBS_H */ ocrdma-abi.h000064400000010024152526504440006717 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR BSD-2-Clause) */ /* This file is part of the Emulex RoCE Device Driver for * RoCE (RDMA over Converged Ethernet) adapters. * Copyright (C) 2012-2015 Emulex. All rights reserved. * EMULEX and SLI are trademarks of Emulex. * www.emulex.com * * This software is available to you under a choice of one of two licenses. * You may choose to be licensed under the terms of the GNU General Public * License (GPL) Version 2, available from the file COPYING in the main * directory of this source tree, or the BSD license below: * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * - Redistributions of source code must retain the above copyright notice, * this list of conditions and the following disclaimer. * * - Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the distribution. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS "AS IS" * AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO,THE * IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE * ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT HOLDER OR CONTRIBUTORS BE * LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR * CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF * SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR * BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, * WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR * OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF * ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. * * Contact Information: * linux-drivers@emulex.com * * Emulex * 3333 Susan Street * Costa Mesa, CA 92626 */ #ifndef OCRDMA_ABI_USER_H #define OCRDMA_ABI_USER_H #include #define OCRDMA_ABI_VERSION 2 #define OCRDMA_BE_ROCE_ABI_VERSION 1 /* user kernel communication data structures. */ struct ocrdma_alloc_ucontext_resp { __u32 dev_id; __u32 wqe_size; __u32 max_inline_data; __u32 dpp_wqe_size; __aligned_u64 ah_tbl_page; __u32 ah_tbl_len; __u32 rqe_size; __u8 fw_ver[32]; /* for future use/new features in progress */ __aligned_u64 rsvd1; __aligned_u64 rsvd2; }; struct ocrdma_alloc_pd_ureq { __u32 rsvd[2]; }; struct ocrdma_alloc_pd_uresp { __u32 id; __u32 dpp_enabled; __u32 dpp_page_addr_hi; __u32 dpp_page_addr_lo; __u32 rsvd[2]; }; struct ocrdma_create_cq_ureq { __u32 dpp_cq; __u32 rsvd; /* pad */ }; #define MAX_CQ_PAGES 8 struct ocrdma_create_cq_uresp { __u32 cq_id; __u32 page_size; __u32 num_pages; __u32 max_hw_cqe; __aligned_u64 page_addr[MAX_CQ_PAGES]; __aligned_u64 db_page_addr; __u32 db_page_size; __u32 phase_change; /* for future use/new features in progress */ __aligned_u64 rsvd1; __aligned_u64 rsvd2; }; #define MAX_QP_PAGES 8 #define MAX_UD_AV_PAGES 8 struct ocrdma_create_qp_ureq { __u8 enable_dpp_cq; __u8 rsvd; __u16 dpp_cq_id; __u32 rsvd1; /* pad */ }; struct ocrdma_create_qp_uresp { __u16 qp_id; __u16 sq_dbid; __u16 rq_dbid; __u16 resv0; /* pad */ __u32 sq_page_size; __u32 rq_page_size; __u32 num_sq_pages; __u32 num_rq_pages; __aligned_u64 sq_page_addr[MAX_QP_PAGES]; __aligned_u64 rq_page_addr[MAX_QP_PAGES]; __aligned_u64 db_page_addr; __u32 db_page_size; __u32 dpp_credit; __u32 dpp_offset; __u32 num_wqe_allocated; __u32 num_rqe_allocated; __u32 db_sq_offset; __u32 db_rq_offset; __u32 db_shift; __aligned_u64 rsvd[11]; }; struct ocrdma_create_srq_uresp { __u16 rq_dbid; __u16 resv0; /* pad */ __u32 resv1; __u32 rq_page_size; __u32 num_rq_pages; __aligned_u64 rq_page_addr[MAX_QP_PAGES]; __aligned_u64 db_page_addr; __u32 db_page_size; __u32 num_rqe_allocated; __u32 db_rq_offset; __u32 db_shift; __aligned_u64 rsvd2; __aligned_u64 rsvd3; }; #endif /* OCRDMA_ABI_USER_H */ rvt-abi.h000064400000003321152526504440006267 0ustar00/* SPDX-License-Identifier: (GPL-2.0 OR BSD-3-Clause) */ /* * This file contains defines, structures, etc. that are used * to communicate between kernel and user code. */ #ifndef RVT_ABI_USER_H #define RVT_ABI_USER_H #include #include #ifndef RDMA_ATOMIC_UAPI #define RDMA_ATOMIC_UAPI(_type, _name) struct{ _type val; } _name #endif struct rvt_wqe_sge { __aligned_u64 addr; __u32 length; __u32 lkey; }; /* * This structure is used to contain the head pointer, tail pointer, * and completion queue entries as a single memory allocation so * it can be mmap'ed into user space. */ struct rvt_cq_wc { /* index of next entry to fill */ RDMA_ATOMIC_UAPI(__u32, head); /* index of next ib_poll_cq() entry */ RDMA_ATOMIC_UAPI(__u32, tail); /* these are actually size ibcq.cqe + 1 */ struct ib_uverbs_wc uqueue[]; }; /* * Receive work request queue entry. * The size of the sg_list is determined when the QP (or SRQ) is created * and stored in qp->r_rq.max_sge (or srq->rq.max_sge). */ struct rvt_rwqe { __u64 wr_id; __u8 num_sge; __u8 padding[7]; struct rvt_wqe_sge sg_list[]; }; /* * This structure is used to contain the head pointer, tail pointer, * and receive work queue entries as a single memory allocation so * it can be mmap'ed into user space. * Note that the wq array elements are variable size so you can't * just index into the array to get the N'th element; * use get_rwqe_ptr() for user space and rvt_get_rwqe_ptr() * for kernel space. */ struct rvt_rwq { /* new work requests posted to the head */ RDMA_ATOMIC_UAPI(__u32, head); /* receives pull requests from here. */ RDMA_ATOMIC_UAPI(__u32, tail); struct rvt_rwqe wq[]; }; #endif /* RVT_ABI_USER_H */ hfi/hfi1_ioctl.h000064400000014732152526504440007522 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR BSD-3-Clause) */ /* * * This file is provided under a dual BSD/GPLv2 license. When using or * redistributing this file, you may do so under either license. * * GPL LICENSE SUMMARY * * Copyright(c) 2015 Intel Corporation. * * This program is free software; you can redistribute it and/or modify * it under the terms of version 2 of the GNU General Public License as * published by the Free Software Foundation. * * This program is distributed in the hope that it will be useful, but * WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU * General Public License for more details. * * BSD LICENSE * * Copyright(c) 2015 Intel Corporation. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * - Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * - Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * - Neither the name of Intel Corporation nor the names of its * contributors may be used to endorse or promote products derived * from this software without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR * A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT * OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT * LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. * */ #ifndef _LINUX__HFI1_IOCTL_H #define _LINUX__HFI1_IOCTL_H #include /* * This structure is passed to the driver to tell it where * user code buffers are, sizes, etc. The offsets and sizes of the * fields must remain unchanged, for binary compatibility. It can * be extended, if userversion is changed so user code can tell, if needed */ struct hfi1_user_info { /* * version of user software, to detect compatibility issues. * Should be set to HFI1_USER_SWVERSION. */ __u32 userversion; __u32 pad; /* * If two or more processes wish to share a context, each process * must set the subcontext_cnt and subcontext_id to the same * values. The only restriction on the subcontext_id is that * it be unique for a given node. */ __u16 subctxt_cnt; __u16 subctxt_id; /* 128bit UUID passed in by PSM. */ __u8 uuid[16]; }; struct hfi1_ctxt_info { __aligned_u64 runtime_flags; /* chip/drv runtime flags (HFI1_CAP_*) */ __u32 rcvegr_size; /* size of each eager buffer */ __u16 num_active; /* number of active units */ __u16 unit; /* unit (chip) assigned to caller */ __u16 ctxt; /* ctxt on unit assigned to caller */ __u16 subctxt; /* subctxt on unit assigned to caller */ __u16 rcvtids; /* number of Rcv TIDs for this context */ __u16 credits; /* number of PIO credits for this context */ __u16 numa_node; /* NUMA node of the assigned device */ __u16 rec_cpu; /* cpu # for affinity (0xffff if none) */ __u16 send_ctxt; /* send context in use by this user context */ __u16 egrtids; /* number of RcvArray entries for Eager Rcvs */ __u16 rcvhdrq_cnt; /* number of RcvHdrQ entries */ __u16 rcvhdrq_entsize; /* size (in bytes) for each RcvHdrQ entry */ __u16 sdma_ring_size; /* number of entries in SDMA request ring */ }; struct hfi1_tid_info { /* virtual address of first page in transfer */ __aligned_u64 vaddr; /* pointer to tid array. this array is big enough */ __aligned_u64 tidlist; /* number of tids programmed by this request */ __u32 tidcnt; /* length of transfer buffer programmed by this request */ __u32 length; }; /* * This structure is returned by the driver immediately after * open to get implementation-specific info, and info specific to this * instance. * * This struct must have explicit pad fields where type sizes * may result in different alignments between 32 and 64 bit * programs, since the 64 bit * bit kernel requires the user code * to have matching offsets */ struct hfi1_base_info { /* version of hardware, for feature checking. */ __u32 hw_version; /* version of software, for feature checking. */ __u32 sw_version; /* Job key */ __u16 jkey; __u16 padding1; /* * The special QP (queue pair) value that identifies PSM * protocol packet from standard IB packets. */ __u32 bthqp; /* PIO credit return address, */ __aligned_u64 sc_credits_addr; /* * Base address of write-only pio buffers for this process. * Each buffer has sendpio_credits*64 bytes. */ __aligned_u64 pio_bufbase_sop; /* * Base address of write-only pio buffers for this process. * Each buffer has sendpio_credits*64 bytes. */ __aligned_u64 pio_bufbase; /* address where receive buffer queue is mapped into */ __aligned_u64 rcvhdr_bufbase; /* base address of Eager receive buffers. */ __aligned_u64 rcvegr_bufbase; /* base address of SDMA completion ring */ __aligned_u64 sdma_comp_bufbase; /* * User register base for init code, not to be used directly by * protocol or applications. Always maps real chip register space. * the register addresses are: * ur_rcvhdrhead, ur_rcvhdrtail, ur_rcvegrhead, ur_rcvegrtail, * ur_rcvtidflow */ __aligned_u64 user_regbase; /* notification events */ __aligned_u64 events_bufbase; /* status page */ __aligned_u64 status_bufbase; /* rcvhdrtail update */ __aligned_u64 rcvhdrtail_base; /* * shared memory pages for subctxts if ctxt is shared; these cover * all the processes in the group sharing a single context. * all have enough space for the num_subcontexts value on this job. */ __aligned_u64 subctxt_uregbase; __aligned_u64 subctxt_rcvegrbuf; __aligned_u64 subctxt_rcvhdrbuf; }; #endif /* _LINIUX__HFI1_IOCTL_H */ hfi/hfi1_user.h000064400000022122152526504440007356 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR BSD-3-Clause) */ /* * * This file is provided under a dual BSD/GPLv2 license. When using or * redistributing this file, you may do so under either license. * * GPL LICENSE SUMMARY * * Copyright(c) 2015 - 2020 Intel Corporation. * * This program is free software; you can redistribute it and/or modify * it under the terms of version 2 of the GNU General Public License as * published by the Free Software Foundation. * * This program is distributed in the hope that it will be useful, but * WITHOUT ANY WARRANTY; without even the implied warranty of * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU * General Public License for more details. * * BSD LICENSE * * Copyright(c) 2015 Intel Corporation. * * Redistribution and use in source and binary forms, with or without * modification, are permitted provided that the following conditions * are met: * * - Redistributions of source code must retain the above copyright * notice, this list of conditions and the following disclaimer. * - Redistributions in binary form must reproduce the above copyright * notice, this list of conditions and the following disclaimer in * the documentation and/or other materials provided with the * distribution. * - Neither the name of Intel Corporation nor the names of its * contributors may be used to endorse or promote products derived * from this software without specific prior written permission. * * THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS * "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT * LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR * A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT * OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, * SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT * LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, * DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY * THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT * (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE * OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. * */ /* * This file contains defines, structures, etc. that are used * to communicate between kernel and user code. */ #ifndef _LINUX__HFI1_USER_H #define _LINUX__HFI1_USER_H #include #include /* * This version number is given to the driver by the user code during * initialization in the spu_userversion field of hfi1_user_info, so * the driver can check for compatibility with user code. * * The major version changes when data structures change in an incompatible * way. The driver must be the same for initialization to succeed. */ #define HFI1_USER_SWMAJOR 6 /* * Minor version differences are always compatible * a within a major version, however if user software is larger * than driver software, some new features and/or structure fields * may not be implemented; the user code must deal with this if it * cares, or it must abort after initialization reports the difference. */ #define HFI1_USER_SWMINOR 3 /* * We will encode the major/minor inside a single 32bit version number. */ #define HFI1_SWMAJOR_SHIFT 16 /* * Set of HW and driver capability/feature bits. * These bit values are used to configure enabled/disabled HW and * driver features. The same set of bits are communicated to user * space. */ #define HFI1_CAP_DMA_RTAIL (1UL << 0) /* Use DMA'ed RTail value */ #define HFI1_CAP_SDMA (1UL << 1) /* Enable SDMA support */ #define HFI1_CAP_SDMA_AHG (1UL << 2) /* Enable SDMA AHG support */ #define HFI1_CAP_EXTENDED_PSN (1UL << 3) /* Enable Extended PSN support */ #define HFI1_CAP_HDRSUPP (1UL << 4) /* Enable Header Suppression */ #define HFI1_CAP_TID_RDMA (1UL << 5) /* Enable TID RDMA operations */ #define HFI1_CAP_USE_SDMA_HEAD (1UL << 6) /* DMA Hdr Q tail vs. use CSR */ #define HFI1_CAP_MULTI_PKT_EGR (1UL << 7) /* Enable multi-packet Egr buffs*/ #define HFI1_CAP_NODROP_RHQ_FULL (1UL << 8) /* Don't drop on Hdr Q full */ #define HFI1_CAP_NODROP_EGR_FULL (1UL << 9) /* Don't drop on EGR buffs full */ #define HFI1_CAP_TID_UNMAP (1UL << 10) /* Disable Expected TID caching */ #define HFI1_CAP_PRINT_UNIMPL (1UL << 11) /* Show for unimplemented feats */ #define HFI1_CAP_ALLOW_PERM_JKEY (1UL << 12) /* Allow use of permissive JKEY */ #define HFI1_CAP_NO_INTEGRITY (1UL << 13) /* Enable ctxt integrity checks */ #define HFI1_CAP_PKEY_CHECK (1UL << 14) /* Enable ctxt PKey checking */ #define HFI1_CAP_STATIC_RATE_CTRL (1UL << 15) /* Allow PBC.StaticRateControl */ #define HFI1_CAP_OPFN (1UL << 16) /* Enable the OPFN protocol */ #define HFI1_CAP_SDMA_HEAD_CHECK (1UL << 17) /* SDMA head checking */ #define HFI1_CAP_EARLY_CREDIT_RETURN (1UL << 18) /* early credit return */ #define HFI1_CAP_AIP (1UL << 19) /* Enable accelerated IP */ #define HFI1_RCVHDR_ENTSIZE_2 (1UL << 0) #define HFI1_RCVHDR_ENTSIZE_16 (1UL << 1) #define HFI1_RCVDHR_ENTSIZE_32 (1UL << 2) #define _HFI1_EVENT_FROZEN_BIT 0 #define _HFI1_EVENT_LINKDOWN_BIT 1 #define _HFI1_EVENT_LID_CHANGE_BIT 2 #define _HFI1_EVENT_LMC_CHANGE_BIT 3 #define _HFI1_EVENT_SL2VL_CHANGE_BIT 4 #define _HFI1_EVENT_TID_MMU_NOTIFY_BIT 5 #define _HFI1_MAX_EVENT_BIT _HFI1_EVENT_TID_MMU_NOTIFY_BIT #define HFI1_EVENT_FROZEN (1UL << _HFI1_EVENT_FROZEN_BIT) #define HFI1_EVENT_LINKDOWN (1UL << _HFI1_EVENT_LINKDOWN_BIT) #define HFI1_EVENT_LID_CHANGE (1UL << _HFI1_EVENT_LID_CHANGE_BIT) #define HFI1_EVENT_LMC_CHANGE (1UL << _HFI1_EVENT_LMC_CHANGE_BIT) #define HFI1_EVENT_SL2VL_CHANGE (1UL << _HFI1_EVENT_SL2VL_CHANGE_BIT) #define HFI1_EVENT_TID_MMU_NOTIFY (1UL << _HFI1_EVENT_TID_MMU_NOTIFY_BIT) /* * These are the status bits readable (in ASCII form, 64bit value) * from the "status" sysfs file. For binary compatibility, values * must remain as is; removed states can be reused for different * purposes. */ #define HFI1_STATUS_INITTED 0x1 /* basic initialization done */ /* Chip has been found and initialized */ #define HFI1_STATUS_CHIP_PRESENT 0x20 /* IB link is at ACTIVE, usable for data traffic */ #define HFI1_STATUS_IB_READY 0x40 /* link is configured, LID, MTU, etc. have been set */ #define HFI1_STATUS_IB_CONF 0x80 /* A Fatal hardware error has occurred. */ #define HFI1_STATUS_HWERROR 0x200 /* * Number of supported shared contexts. * This is the maximum number of software contexts that can share * a hardware send/receive context. */ #define HFI1_MAX_SHARED_CTXTS 8 /* * Poll types */ #define HFI1_POLL_TYPE_ANYRCV 0x0 #define HFI1_POLL_TYPE_URGENT 0x1 enum hfi1_sdma_comp_state { FREE = 0, QUEUED, COMPLETE, ERROR }; /* * SDMA completion ring entry */ struct hfi1_sdma_comp_entry { __u32 status; __u32 errcode; }; /* * Device status and notifications from driver to user-space. */ struct hfi1_status { __aligned_u64 dev; /* device/hw status bits */ __aligned_u64 port; /* port state and status bits */ char freezemsg[]; }; enum sdma_req_opcode { EXPECTED = 0, EAGER }; #define HFI1_SDMA_REQ_VERSION_MASK 0xF #define HFI1_SDMA_REQ_VERSION_SHIFT 0x0 #define HFI1_SDMA_REQ_OPCODE_MASK 0xF #define HFI1_SDMA_REQ_OPCODE_SHIFT 0x4 #define HFI1_SDMA_REQ_IOVCNT_MASK 0xFF #define HFI1_SDMA_REQ_IOVCNT_SHIFT 0x8 struct sdma_req_info { /* * bits 0-3 - version (currently unused) * bits 4-7 - opcode (enum sdma_req_opcode) * bits 8-15 - io vector count */ __u16 ctrl; /* * Number of fragments contained in this request. * User-space has already computed how many * fragment-sized packet the user buffer will be * split into. */ __u16 npkts; /* * Size of each fragment the user buffer will be * split into. */ __u16 fragsize; /* * Index of the slot in the SDMA completion ring * this request should be using. User-space is * in charge of managing its own ring. */ __u16 comp_idx; } __attribute__((__packed__)); /* * SW KDETH header. * swdata is SW defined portion. */ struct hfi1_kdeth_header { __le32 ver_tid_offset; __le16 jkey; __le16 hcrc; __le32 swdata[7]; } __attribute__((__packed__)); /* * Structure describing the headers that User space uses. The * structure above is a subset of this one. */ struct hfi1_pkt_header { __le16 pbc[4]; __be16 lrh[4]; __be32 bth[3]; struct hfi1_kdeth_header kdeth; } __attribute__((__packed__)); /* * The list of usermode accessible registers. */ enum hfi1_ureg { /* (RO) DMA RcvHdr to be used next. */ ur_rcvhdrtail = 0, /* (RW) RcvHdr entry to be processed next by host. */ ur_rcvhdrhead = 1, /* (RO) Index of next Eager index to use. */ ur_rcvegrindextail = 2, /* (RW) Eager TID to be processed next */ ur_rcvegrindexhead = 3, /* (RO) Receive Eager Offset Tail */ ur_rcvegroffsettail = 4, /* For internal use only; max register number. */ ur_maxreg, /* (RW) Receive TID flow table */ ur_rcvtidflowtable = 256 }; #endif /* _LINIUX__HFI1_USER_H */ mlx5_user_ioctl_verbs.h000064400000006777152526504440011263 0ustar00/* * Copyright (c) 2018, Mellanox Technologies inc. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef MLX5_USER_IOCTL_VERBS_H #define MLX5_USER_IOCTL_VERBS_H #include enum mlx5_ib_uapi_flow_action_flags { MLX5_IB_UAPI_FLOW_ACTION_FLAGS_REQUIRE_METADATA = 1 << 0, }; enum mlx5_ib_uapi_flow_table_type { MLX5_IB_UAPI_FLOW_TABLE_TYPE_NIC_RX = 0x0, MLX5_IB_UAPI_FLOW_TABLE_TYPE_NIC_TX = 0x1, MLX5_IB_UAPI_FLOW_TABLE_TYPE_FDB = 0x2, MLX5_IB_UAPI_FLOW_TABLE_TYPE_RDMA_RX = 0x3, MLX5_IB_UAPI_FLOW_TABLE_TYPE_RDMA_TX = 0x4, }; enum mlx5_ib_uapi_flow_action_packet_reformat_type { MLX5_IB_UAPI_FLOW_ACTION_PACKET_REFORMAT_TYPE_L2_TUNNEL_TO_L2 = 0x0, MLX5_IB_UAPI_FLOW_ACTION_PACKET_REFORMAT_TYPE_L2_TO_L2_TUNNEL = 0x1, MLX5_IB_UAPI_FLOW_ACTION_PACKET_REFORMAT_TYPE_L3_TUNNEL_TO_L2 = 0x2, MLX5_IB_UAPI_FLOW_ACTION_PACKET_REFORMAT_TYPE_L2_TO_L3_TUNNEL = 0x3, }; struct mlx5_ib_uapi_devx_async_cmd_hdr { __aligned_u64 wr_id; __u8 out_data[]; }; enum mlx5_ib_uapi_dm_type { MLX5_IB_UAPI_DM_TYPE_MEMIC, MLX5_IB_UAPI_DM_TYPE_STEERING_SW_ICM, MLX5_IB_UAPI_DM_TYPE_HEADER_MODIFY_SW_ICM, MLX5_IB_UAPI_DM_TYPE_HEADER_MODIFY_PATTERN_SW_ICM, }; enum mlx5_ib_uapi_devx_create_event_channel_flags { MLX5_IB_UAPI_DEVX_CR_EV_CH_FLAGS_OMIT_DATA = 1 << 0, }; struct mlx5_ib_uapi_devx_async_event_hdr { __aligned_u64 cookie; __u8 out_data[]; }; enum mlx5_ib_uapi_pp_alloc_flags { MLX5_IB_UAPI_PP_ALLOC_FLAGS_DEDICATED_INDEX = 1 << 0, }; enum mlx5_ib_uapi_uar_alloc_type { MLX5_IB_UAPI_UAR_ALLOC_TYPE_BF = 0x0, MLX5_IB_UAPI_UAR_ALLOC_TYPE_NC = 0x1, }; enum mlx5_ib_uapi_query_port_flags { MLX5_IB_UAPI_QUERY_PORT_VPORT = 1 << 0, MLX5_IB_UAPI_QUERY_PORT_VPORT_VHCA_ID = 1 << 1, MLX5_IB_UAPI_QUERY_PORT_VPORT_STEERING_ICM_RX = 1 << 2, MLX5_IB_UAPI_QUERY_PORT_VPORT_STEERING_ICM_TX = 1 << 3, MLX5_IB_UAPI_QUERY_PORT_VPORT_REG_C0 = 1 << 4, MLX5_IB_UAPI_QUERY_PORT_ESW_OWNER_VHCA_ID = 1 << 5, }; struct mlx5_ib_uapi_reg { __u32 value; __u32 mask; }; struct mlx5_ib_uapi_query_port { __aligned_u64 flags; __u16 vport; __u16 vport_vhca_id; __u16 esw_owner_vhca_id; __u16 rsvd0; __aligned_u64 vport_steering_icm_rx; __aligned_u64 vport_steering_icm_tx; struct mlx5_ib_uapi_reg reg_c0; }; #endif efa-abi.h000064400000005621152526504440006214 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR BSD-2-Clause) */ /* * Copyright 2018-2023 Amazon.com, Inc. or its affiliates. All rights reserved. */ #ifndef EFA_ABI_USER_H #define EFA_ABI_USER_H #include /* * Increment this value if any changes that break userspace ABI * compatibility are made. */ #define EFA_UVERBS_ABI_VERSION 1 /* * Keep structs aligned to 8 bytes. * Keep reserved fields as arrays of __u8 named reserved_XXX where XXX is the * hex bit offset of the field. */ enum { EFA_ALLOC_UCONTEXT_CMD_COMP_TX_BATCH = 1 << 0, EFA_ALLOC_UCONTEXT_CMD_COMP_MIN_SQ_WR = 1 << 1, }; struct efa_ibv_alloc_ucontext_cmd { __u32 comp_mask; __u8 reserved_20[4]; }; enum efa_ibv_user_cmds_supp_udata { EFA_USER_CMDS_SUPP_UDATA_QUERY_DEVICE = 1 << 0, EFA_USER_CMDS_SUPP_UDATA_CREATE_AH = 1 << 1, }; struct efa_ibv_alloc_ucontext_resp { __u32 comp_mask; __u32 cmds_supp_udata_mask; __u16 sub_cqs_per_cq; __u16 inline_buf_size; __u32 max_llq_size; /* bytes */ __u16 max_tx_batch; /* units of 64 bytes */ __u16 min_sq_wr; __u8 reserved_a0[4]; }; struct efa_ibv_alloc_pd_resp { __u32 comp_mask; __u16 pdn; __u8 reserved_30[2]; }; enum { EFA_CREATE_CQ_WITH_COMPLETION_CHANNEL = 1 << 0, EFA_CREATE_CQ_WITH_SGID = 1 << 1, }; struct efa_ibv_create_cq { __u32 comp_mask; __u32 cq_entry_size; __u16 num_sub_cqs; __u8 flags; __u8 reserved_58[5]; }; enum { EFA_CREATE_CQ_RESP_DB_OFF = 1 << 0, }; struct efa_ibv_create_cq_resp { __u32 comp_mask; __u8 reserved_20[4]; __aligned_u64 q_mmap_key; __aligned_u64 q_mmap_size; __u16 cq_idx; __u8 reserved_d0[2]; __u32 db_off; __aligned_u64 db_mmap_key; }; enum { EFA_QP_DRIVER_TYPE_SRD = 0, }; struct efa_ibv_create_qp { __u32 comp_mask; __u32 rq_ring_size; /* bytes */ __u32 sq_ring_size; /* bytes */ __u32 driver_qp_type; }; struct efa_ibv_create_qp_resp { __u32 comp_mask; /* the offset inside the page of the rq db */ __u32 rq_db_offset; /* the offset inside the page of the sq db */ __u32 sq_db_offset; /* the offset inside the page of descriptors buffer */ __u32 llq_desc_offset; __aligned_u64 rq_mmap_key; __aligned_u64 rq_mmap_size; __aligned_u64 rq_db_mmap_key; __aligned_u64 sq_db_mmap_key; __aligned_u64 llq_desc_mmap_key; __u16 send_sub_cq_idx; __u16 recv_sub_cq_idx; __u8 reserved_1e0[4]; }; struct efa_ibv_create_ah_resp { __u32 comp_mask; __u16 efa_address_handle; __u8 reserved_30[2]; }; enum { EFA_QUERY_DEVICE_CAPS_RDMA_READ = 1 << 0, EFA_QUERY_DEVICE_CAPS_RNR_RETRY = 1 << 1, EFA_QUERY_DEVICE_CAPS_CQ_NOTIFICATIONS = 1 << 2, EFA_QUERY_DEVICE_CAPS_CQ_WITH_SGID = 1 << 3, EFA_QUERY_DEVICE_CAPS_DATA_POLLING_128 = 1 << 4, EFA_QUERY_DEVICE_CAPS_RDMA_WRITE = 1 << 5, }; struct efa_ibv_ex_query_device_resp { __u32 comp_mask; __u32 max_sq_wr; __u32 max_rq_wr; __u16 max_sq_sge; __u16 max_rq_sge; __u32 max_rdma_size; __u32 device_caps; }; #endif /* EFA_ABI_USER_H */ rdma_user_ioctl_cmds.h000064400000005057152526504440011114 0ustar00/* * Copyright (c) 2018, Mellanox Technologies inc. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef RDMA_USER_IOCTL_CMDS_H #define RDMA_USER_IOCTL_CMDS_H #include #include /* Documentation/ioctl/ioctl-number.txt */ #define RDMA_IOCTL_MAGIC 0x1b #define RDMA_VERBS_IOCTL \ _IOWR(RDMA_IOCTL_MAGIC, 1, struct ib_uverbs_ioctl_hdr) enum { /* User input */ UVERBS_ATTR_F_MANDATORY = 1U << 0, /* * Valid output bit should be ignored and considered set in * mandatory fields. This bit is kernel output. */ UVERBS_ATTR_F_VALID_OUTPUT = 1U << 1, }; struct ib_uverbs_attr { __u16 attr_id; /* command specific type attribute */ __u16 len; /* only for pointers and IDRs array */ __u16 flags; /* combination of UVERBS_ATTR_F_XXXX */ union { struct { __u8 elem_id; __u8 reserved; } enum_data; __u16 reserved; } attr_data; union { /* * ptr to command, __inline__ data, idr/fd or * ptr to __u32 array of IDRs */ __aligned_u64 data; /* Used by FD_IN and FD_OUT */ __s64 data_s64; }; }; struct ib_uverbs_ioctl_hdr { __u16 length; __u16 object_id; __u16 method_id; __u16 num_attrs; __aligned_u64 reserved1; __u32 driver_id; __u32 reserved2; struct ib_uverbs_attr attrs[]; }; #endif ib_user_sa.h000064400000004401152526504440007036 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2005 Intel Corporation. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef IB_USER_SA_H #define IB_USER_SA_H #include enum { IB_PATH_GMP = 1, IB_PATH_PRIMARY = (1<<1), IB_PATH_ALTERNATE = (1<<2), IB_PATH_OUTBOUND = (1<<3), IB_PATH_INBOUND = (1<<4), IB_PATH_INBOUND_REVERSE = (1<<5), IB_PATH_BIDIRECTIONAL = IB_PATH_OUTBOUND | IB_PATH_INBOUND_REVERSE }; struct ib_path_rec_data { __u32 flags; __u32 reserved; __u32 path_rec[16]; }; struct ib_user_path_rec { __u8 dgid[16]; __u8 sgid[16]; __be16 dlid; __be16 slid; __u32 raw_traffic; __be32 flow_label; __u32 reversible; __u32 mtu; __be16 pkey; __u8 hop_limit; __u8 traffic_class; __u8 numb_path; __u8 sl; __u8 mtu_selector; __u8 rate_selector; __u8 rate; __u8 packet_life_time_selector; __u8 packet_life_time; __u8 preference; }; #endif /* IB_USER_SA_H */ hns-abi.h000064400000004237152526504440006253 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2016 Hisilicon Limited. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef HNS_ABI_USER_H #define HNS_ABI_USER_H #include struct hns_roce_ib_create_cq { __aligned_u64 buf_addr; __aligned_u64 db_addr; }; struct hns_roce_ib_create_cq_resp { __aligned_u64 cqn; /* Only 32 bits used, 64 for compat */ __aligned_u64 cap_flags; }; struct hns_roce_ib_create_qp { __aligned_u64 buf_addr; __aligned_u64 db_addr; __u8 log_sq_bb_count; __u8 log_sq_stride; __u8 sq_no_prefetch; __u8 reserved[5]; __aligned_u64 sdb_addr; }; struct hns_roce_ib_create_qp_resp { __aligned_u64 cap_flags; }; struct hns_roce_ib_alloc_ucontext_resp { __u32 qp_tab_size; __u32 reserved; }; struct hns_roce_ib_alloc_pd_resp { __u32 pdn; }; #endif /* HNS_ABI_USER_H */ mlx5_user_ioctl_cmds.h000064400000024771152526504440011062 0ustar00/* * Copyright (c) 2018, Mellanox Technologies inc. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef MLX5_USER_IOCTL_CMDS_H #define MLX5_USER_IOCTL_CMDS_H #include #include enum mlx5_ib_create_flow_action_attrs { /* This attribute belong to the driver namespace */ MLX5_IB_ATTR_CREATE_FLOW_ACTION_FLAGS = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_dm_methods { MLX5_IB_METHOD_DM_MAP_OP_ADDR = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_DM_QUERY, }; enum mlx5_ib_dm_map_op_addr_attrs { MLX5_IB_ATTR_DM_MAP_OP_ADDR_REQ_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DM_MAP_OP_ADDR_REQ_OP, MLX5_IB_ATTR_DM_MAP_OP_ADDR_RESP_START_OFFSET, MLX5_IB_ATTR_DM_MAP_OP_ADDR_RESP_PAGE_INDEX, }; enum mlx5_ib_query_dm_attrs { MLX5_IB_ATTR_QUERY_DM_REQ_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_QUERY_DM_RESP_START_OFFSET, MLX5_IB_ATTR_QUERY_DM_RESP_PAGE_INDEX, MLX5_IB_ATTR_QUERY_DM_RESP_LENGTH, }; enum mlx5_ib_alloc_dm_attrs { MLX5_IB_ATTR_ALLOC_DM_RESP_START_OFFSET = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_ALLOC_DM_RESP_PAGE_INDEX, MLX5_IB_ATTR_ALLOC_DM_REQ_TYPE, }; enum mlx5_ib_devx_methods { MLX5_IB_METHOD_DEVX_OTHER = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_DEVX_QUERY_UAR, MLX5_IB_METHOD_DEVX_QUERY_EQN, MLX5_IB_METHOD_DEVX_SUBSCRIBE_EVENT, }; enum mlx5_ib_devx_other_attrs { MLX5_IB_ATTR_DEVX_OTHER_CMD_IN = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_OTHER_CMD_OUT, }; enum mlx5_ib_devx_obj_create_attrs { MLX5_IB_ATTR_DEVX_OBJ_CREATE_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_OBJ_CREATE_CMD_IN, MLX5_IB_ATTR_DEVX_OBJ_CREATE_CMD_OUT, }; enum mlx5_ib_devx_query_uar_attrs { MLX5_IB_ATTR_DEVX_QUERY_UAR_USER_IDX = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_QUERY_UAR_DEV_IDX, }; enum mlx5_ib_devx_obj_destroy_attrs { MLX5_IB_ATTR_DEVX_OBJ_DESTROY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_devx_obj_modify_attrs { MLX5_IB_ATTR_DEVX_OBJ_MODIFY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_OBJ_MODIFY_CMD_IN, MLX5_IB_ATTR_DEVX_OBJ_MODIFY_CMD_OUT, }; enum mlx5_ib_devx_obj_query_attrs { MLX5_IB_ATTR_DEVX_OBJ_QUERY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_OBJ_QUERY_CMD_IN, MLX5_IB_ATTR_DEVX_OBJ_QUERY_CMD_OUT, }; enum mlx5_ib_devx_obj_query_async_attrs { MLX5_IB_ATTR_DEVX_OBJ_QUERY_ASYNC_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_OBJ_QUERY_ASYNC_CMD_IN, MLX5_IB_ATTR_DEVX_OBJ_QUERY_ASYNC_FD, MLX5_IB_ATTR_DEVX_OBJ_QUERY_ASYNC_WR_ID, MLX5_IB_ATTR_DEVX_OBJ_QUERY_ASYNC_OUT_LEN, }; enum mlx5_ib_devx_subscribe_event_attrs { MLX5_IB_ATTR_DEVX_SUBSCRIBE_EVENT_FD_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_SUBSCRIBE_EVENT_OBJ_HANDLE, MLX5_IB_ATTR_DEVX_SUBSCRIBE_EVENT_TYPE_NUM_LIST, MLX5_IB_ATTR_DEVX_SUBSCRIBE_EVENT_FD_NUM, MLX5_IB_ATTR_DEVX_SUBSCRIBE_EVENT_COOKIE, }; enum mlx5_ib_devx_query_eqn_attrs { MLX5_IB_ATTR_DEVX_QUERY_EQN_USER_VEC = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_QUERY_EQN_DEV_EQN, }; enum mlx5_ib_devx_obj_methods { MLX5_IB_METHOD_DEVX_OBJ_CREATE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_DEVX_OBJ_DESTROY, MLX5_IB_METHOD_DEVX_OBJ_MODIFY, MLX5_IB_METHOD_DEVX_OBJ_QUERY, MLX5_IB_METHOD_DEVX_OBJ_ASYNC_QUERY, }; enum mlx5_ib_var_alloc_attrs { MLX5_IB_ATTR_VAR_OBJ_ALLOC_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_VAR_OBJ_ALLOC_MMAP_OFFSET, MLX5_IB_ATTR_VAR_OBJ_ALLOC_MMAP_LENGTH, MLX5_IB_ATTR_VAR_OBJ_ALLOC_PAGE_ID, }; enum mlx5_ib_var_obj_destroy_attrs { MLX5_IB_ATTR_VAR_OBJ_DESTROY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_var_obj_methods { MLX5_IB_METHOD_VAR_OBJ_ALLOC = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_VAR_OBJ_DESTROY, }; enum mlx5_ib_uar_alloc_attrs { MLX5_IB_ATTR_UAR_OBJ_ALLOC_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_UAR_OBJ_ALLOC_TYPE, MLX5_IB_ATTR_UAR_OBJ_ALLOC_MMAP_OFFSET, MLX5_IB_ATTR_UAR_OBJ_ALLOC_MMAP_LENGTH, MLX5_IB_ATTR_UAR_OBJ_ALLOC_PAGE_ID, }; enum mlx5_ib_uar_obj_destroy_attrs { MLX5_IB_ATTR_UAR_OBJ_DESTROY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_uar_obj_methods { MLX5_IB_METHOD_UAR_OBJ_ALLOC = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_UAR_OBJ_DESTROY, }; enum mlx5_ib_devx_umem_reg_attrs { MLX5_IB_ATTR_DEVX_UMEM_REG_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_UMEM_REG_ADDR, MLX5_IB_ATTR_DEVX_UMEM_REG_LEN, MLX5_IB_ATTR_DEVX_UMEM_REG_ACCESS, MLX5_IB_ATTR_DEVX_UMEM_REG_OUT_ID, MLX5_IB_ATTR_DEVX_UMEM_REG_PGSZ_BITMAP, }; enum mlx5_ib_devx_umem_dereg_attrs { MLX5_IB_ATTR_DEVX_UMEM_DEREG_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_pp_obj_methods { MLX5_IB_METHOD_PP_OBJ_ALLOC = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_PP_OBJ_DESTROY, }; enum mlx5_ib_pp_alloc_attrs { MLX5_IB_ATTR_PP_OBJ_ALLOC_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_PP_OBJ_ALLOC_CTX, MLX5_IB_ATTR_PP_OBJ_ALLOC_FLAGS, MLX5_IB_ATTR_PP_OBJ_ALLOC_INDEX, }; enum mlx5_ib_pp_obj_destroy_attrs { MLX5_IB_ATTR_PP_OBJ_DESTROY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_devx_umem_methods { MLX5_IB_METHOD_DEVX_UMEM_REG = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_DEVX_UMEM_DEREG, }; enum mlx5_ib_devx_async_cmd_fd_alloc_attrs { MLX5_IB_ATTR_DEVX_ASYNC_CMD_FD_ALLOC_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_devx_async_event_fd_alloc_attrs { MLX5_IB_ATTR_DEVX_ASYNC_EVENT_FD_ALLOC_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_DEVX_ASYNC_EVENT_FD_ALLOC_FLAGS, }; enum mlx5_ib_devx_async_cmd_fd_methods { MLX5_IB_METHOD_DEVX_ASYNC_CMD_FD_ALLOC = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_devx_async_event_fd_methods { MLX5_IB_METHOD_DEVX_ASYNC_EVENT_FD_ALLOC = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_objects { MLX5_IB_OBJECT_DEVX = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_OBJECT_DEVX_OBJ, MLX5_IB_OBJECT_DEVX_UMEM, MLX5_IB_OBJECT_FLOW_MATCHER, MLX5_IB_OBJECT_DEVX_ASYNC_CMD_FD, MLX5_IB_OBJECT_DEVX_ASYNC_EVENT_FD, MLX5_IB_OBJECT_VAR, MLX5_IB_OBJECT_PP, MLX5_IB_OBJECT_UAR, MLX5_IB_OBJECT_STEERING_ANCHOR, }; enum mlx5_ib_flow_matcher_create_attrs { MLX5_IB_ATTR_FLOW_MATCHER_CREATE_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_FLOW_MATCHER_MATCH_MASK, MLX5_IB_ATTR_FLOW_MATCHER_FLOW_TYPE, MLX5_IB_ATTR_FLOW_MATCHER_MATCH_CRITERIA, MLX5_IB_ATTR_FLOW_MATCHER_FLOW_FLAGS, MLX5_IB_ATTR_FLOW_MATCHER_FT_TYPE, }; enum mlx5_ib_flow_matcher_destroy_attrs { MLX5_IB_ATTR_FLOW_MATCHER_DESTROY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_flow_matcher_methods { MLX5_IB_METHOD_FLOW_MATCHER_CREATE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_FLOW_MATCHER_DESTROY, }; enum mlx5_ib_flow_steering_anchor_create_attrs { MLX5_IB_ATTR_STEERING_ANCHOR_CREATE_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_STEERING_ANCHOR_FT_TYPE, MLX5_IB_ATTR_STEERING_ANCHOR_PRIORITY, MLX5_IB_ATTR_STEERING_ANCHOR_FT_ID, }; enum mlx5_ib_flow_steering_anchor_destroy_attrs { MLX5_IB_ATTR_STEERING_ANCHOR_DESTROY_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_steering_anchor_methods { MLX5_IB_METHOD_STEERING_ANCHOR_CREATE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_STEERING_ANCHOR_DESTROY, }; enum mlx5_ib_device_query_context_attrs { MLX5_IB_ATTR_QUERY_CONTEXT_RESP_UCTX = (1U << UVERBS_ID_NS_SHIFT), }; #define MLX5_IB_DW_MATCH_PARAM 0xA0 struct mlx5_ib_match_params { __u32 match_params[MLX5_IB_DW_MATCH_PARAM]; }; enum mlx5_ib_flow_type { MLX5_IB_FLOW_TYPE_NORMAL, MLX5_IB_FLOW_TYPE_SNIFFER, MLX5_IB_FLOW_TYPE_ALL_DEFAULT, MLX5_IB_FLOW_TYPE_MC_DEFAULT, }; enum mlx5_ib_create_flow_flags { MLX5_IB_ATTR_CREATE_FLOW_FLAGS_DEFAULT_MISS = 1 << 0, MLX5_IB_ATTR_CREATE_FLOW_FLAGS_DROP = 1 << 1, }; enum mlx5_ib_create_flow_attrs { MLX5_IB_ATTR_CREATE_FLOW_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_CREATE_FLOW_MATCH_VALUE, MLX5_IB_ATTR_CREATE_FLOW_DEST_QP, MLX5_IB_ATTR_CREATE_FLOW_DEST_DEVX, MLX5_IB_ATTR_CREATE_FLOW_MATCHER, MLX5_IB_ATTR_CREATE_FLOW_ARR_FLOW_ACTIONS, MLX5_IB_ATTR_CREATE_FLOW_TAG, MLX5_IB_ATTR_CREATE_FLOW_ARR_COUNTERS_DEVX, MLX5_IB_ATTR_CREATE_FLOW_ARR_COUNTERS_DEVX_OFFSET, MLX5_IB_ATTR_CREATE_FLOW_FLAGS, }; enum mlx5_ib_destoy_flow_attrs { MLX5_IB_ATTR_DESTROY_FLOW_HANDLE = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_flow_methods { MLX5_IB_METHOD_CREATE_FLOW = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_DESTROY_FLOW, }; enum mlx5_ib_flow_action_methods { MLX5_IB_METHOD_FLOW_ACTION_CREATE_MODIFY_HEADER = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_METHOD_FLOW_ACTION_CREATE_PACKET_REFORMAT, }; enum mlx5_ib_create_flow_action_create_modify_header_attrs { MLX5_IB_ATTR_CREATE_MODIFY_HEADER_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_CREATE_MODIFY_HEADER_ACTIONS_PRM, MLX5_IB_ATTR_CREATE_MODIFY_HEADER_FT_TYPE, }; enum mlx5_ib_create_flow_action_create_packet_reformat_attrs { MLX5_IB_ATTR_CREATE_PACKET_REFORMAT_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_CREATE_PACKET_REFORMAT_TYPE, MLX5_IB_ATTR_CREATE_PACKET_REFORMAT_FT_TYPE, MLX5_IB_ATTR_CREATE_PACKET_REFORMAT_DATA_BUF, }; enum mlx5_ib_query_pd_attrs { MLX5_IB_ATTR_QUERY_PD_HANDLE = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_QUERY_PD_RESP_PDN, }; enum mlx5_ib_pd_methods { MLX5_IB_METHOD_PD_QUERY = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_device_methods { MLX5_IB_METHOD_QUERY_PORT = (1U << UVERBS_ID_NS_SHIFT), }; enum mlx5_ib_query_port_attrs { MLX5_IB_ATTR_QUERY_PORT_PORT_NUM = (1U << UVERBS_ID_NS_SHIFT), MLX5_IB_ATTR_QUERY_PORT, }; #endif rdma_user_rxe.h000064400000011253152526504440007565 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2016 Mellanox Technologies Ltd. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef RDMA_USER_RXE_H #define RDMA_USER_RXE_H #include #include #include #include enum { RXE_NETWORK_TYPE_IPV4 = 1, RXE_NETWORK_TYPE_IPV6 = 2, }; union rxe_gid { __u8 raw[16]; struct { __be64 subnet_prefix; __be64 interface_id; } global; }; struct rxe_global_route { union rxe_gid dgid; __u32 flow_label; __u8 sgid_index; __u8 hop_limit; __u8 traffic_class; }; struct rxe_av { __u8 port_num; /* From RXE_NETWORK_TYPE_* */ __u8 network_type; __u8 dmac[6]; struct rxe_global_route grh; union { struct sockaddr_in _sockaddr_in; struct sockaddr_in6 _sockaddr_in6; } sgid_addr, dgid_addr; }; struct rxe_send_wr { __aligned_u64 wr_id; __u32 num_sge; __u32 opcode; __u32 send_flags; union { __be32 imm_data; __u32 invalidate_rkey; } ex; union { struct { __aligned_u64 remote_addr; __u32 rkey; __u32 reserved; } rdma; struct { __aligned_u64 remote_addr; __aligned_u64 compare_add; __aligned_u64 swap; __u32 rkey; __u32 reserved; } atomic; struct { __u32 remote_qpn; __u32 remote_qkey; __u16 pkey_index; __u16 reserved; __u32 ah_num; __u32 pad[4]; struct rxe_av av; } ud; struct { __aligned_u64 addr; __aligned_u64 length; __u32 mr_lkey; __u32 mw_rkey; __u32 rkey; __u32 access; } mw; /* reg is only used by the kernel and is not part of the uapi */ } wr; }; struct rxe_sge { __aligned_u64 addr; __u32 length; __u32 lkey; }; struct mminfo { __aligned_u64 offset; __u32 size; __u32 pad; }; struct rxe_dma_info { __u32 length; __u32 resid; __u32 cur_sge; __u32 num_sge; __u32 sge_offset; __u32 reserved; union { __u8 inline_data[0]; struct rxe_sge sge[0]; }; }; struct rxe_send_wqe { struct rxe_send_wr wr; __u32 status; __u32 state; __aligned_u64 iova; __u32 mask; __u32 first_psn; __u32 last_psn; __u32 ack_length; __u32 ssn; __u32 has_rd_atomic; struct rxe_dma_info dma; }; struct rxe_recv_wqe { __aligned_u64 wr_id; __u32 num_sge; __u32 padding; struct rxe_dma_info dma; }; struct rxe_create_ah_resp { __u32 ah_num; __u32 reserved; }; struct rxe_create_cq_resp { struct mminfo mi; }; struct rxe_resize_cq_resp { struct mminfo mi; }; struct rxe_create_qp_resp { struct mminfo rq_mi; struct mminfo sq_mi; }; struct rxe_create_srq_resp { struct mminfo mi; __u32 srq_num; __u32 reserved; }; struct rxe_modify_srq_cmd { __aligned_u64 mmap_info_addr; }; /* This data structure is stored at the base of work and * completion queues shared between user space and kernel space. * It contains the producer and consumer indices. Is also * contains a copy of the queue size parameters for user space * to use but the kernel must use the parameters in the * rxe_queue struct. For performance reasons arrange to have * producer and consumer indices in separate cache lines * the kernel should always mask the indices to avoid accessing * memory outside of the data area */ struct rxe_queue_buf { __u32 log2_elem_size; __u32 index_mask; __u32 pad_1[30]; __u32 producer_index; __u32 pad_2[31]; __u32 consumer_index; __u32 pad_3[31]; __u8 data[]; }; #endif /* RDMA_USER_RXE_H */ irdma-abi.h000064400000004220152526504440006547 0ustar00/* SPDX-License-Identifier: (GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB */ /* * Copyright (c) 2006 - 2021 Intel Corporation. All rights reserved. * Copyright (c) 2005 Topspin Communications. All rights reserved. * Copyright (c) 2005 Cisco Systems. All rights reserved. * Copyright (c) 2005 Open Grid Computing, Inc. All rights reserved. */ #ifndef IRDMA_ABI_H #define IRDMA_ABI_H #include /* irdma must support legacy GEN_1 i40iw kernel * and user-space whose last ABI ver is 5 */ #define IRDMA_ABI_VER 5 enum irdma_memreg_type { IRDMA_MEMREG_TYPE_MEM = 0, IRDMA_MEMREG_TYPE_QP = 1, IRDMA_MEMREG_TYPE_CQ = 2, }; struct irdma_alloc_ucontext_req { __u32 rsvd32; __u8 userspace_ver; __u8 rsvd8[3]; }; struct irdma_alloc_ucontext_resp { __u32 max_pds; __u32 max_qps; __u32 wq_size; /* size of the WQs (SQ+RQ) in the mmaped area */ __u8 kernel_ver; __u8 rsvd[3]; __aligned_u64 feature_flags; __aligned_u64 db_mmap_key; __u32 max_hw_wq_frags; __u32 max_hw_read_sges; __u32 max_hw_inline; __u32 max_hw_rq_quanta; __u32 max_hw_wq_quanta; __u32 min_hw_cq_size; __u32 max_hw_cq_size; __u16 max_hw_sq_chunk; __u8 hw_rev; __u8 rsvd2; }; struct irdma_alloc_pd_resp { __u32 pd_id; __u8 rsvd[4]; }; struct irdma_resize_cq_req { __aligned_u64 user_cq_buffer; }; struct irdma_create_cq_req { __aligned_u64 user_cq_buf; __aligned_u64 user_shadow_area; }; struct irdma_create_qp_req { __aligned_u64 user_wqe_bufs; __aligned_u64 user_compl_ctx; }; struct irdma_mem_reg_req { __u16 reg_type; /* enum irdma_memreg_type */ __u16 cq_pages; __u16 rq_pages; __u16 sq_pages; }; struct irdma_modify_qp_req { __u8 sq_flush; __u8 rq_flush; __u8 rsvd[6]; }; struct irdma_create_cq_resp { __u32 cq_id; __u32 cq_size; }; struct irdma_create_qp_resp { __u32 qp_id; __u32 actual_sq_size; __u32 actual_rq_size; __u32 irdma_drv_opt; __u16 push_idx; __u8 lsmm; __u8 rsvd; __u32 qp_caps; }; struct irdma_modify_qp_resp { __aligned_u64 push_wqe_mmap_key; __aligned_u64 push_db_mmap_key; __u16 push_offset; __u8 push_valid; __u8 rsvd[5]; }; struct irdma_create_ah_resp { __u32 ah_id; __u8 rsvd[4]; }; #endif /* IRDMA_ABI_H */ ib_user_mad.h000064400000020522152526504440007176 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2004 Topspin Communications. All rights reserved. * Copyright (c) 2005 Voltaire, Inc. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef IB_USER_MAD_H #define IB_USER_MAD_H #include #include /* * Increment this value if any changes that break userspace ABI * compatibility are made. */ #define IB_USER_MAD_ABI_VERSION 5 /* * Make sure that all structs defined in this file remain laid out so * that they pack the same way on 32-bit and 64-bit architectures (to * avoid incompatibility between 32-bit userspace and 64-bit kernels). */ /** * ib_user_mad_hdr_old - Old version of MAD packet header without pkey_index * @id - ID of agent MAD received with/to be sent with * @status - 0 on successful receive, ETIMEDOUT if no response * received (transaction ID in data[] will be set to TID of original * request) (ignored on send) * @timeout_ms - Milliseconds to wait for response (unset on receive) * @retries - Number of automatic retries to attempt * @qpn - Remote QP number received from/to be sent to * @qkey - Remote Q_Key to be sent with (unset on receive) * @lid - Remote lid received from/to be sent to * @sl - Service level received with/to be sent with * @path_bits - Local path bits received with/to be sent with * @grh_present - If set, GRH was received/should be sent * @gid_index - Local GID index to send with (unset on receive) * @hop_limit - Hop limit in GRH * @traffic_class - Traffic class in GRH * @gid - Remote GID in GRH * @flow_label - Flow label in GRH */ struct ib_user_mad_hdr_old { __u32 id; __u32 status; __u32 timeout_ms; __u32 retries; __u32 length; __be32 qpn; __be32 qkey; __be16 lid; __u8 sl; __u8 path_bits; __u8 grh_present; __u8 gid_index; __u8 hop_limit; __u8 traffic_class; __u8 gid[16]; __be32 flow_label; }; /** * ib_user_mad_hdr - MAD packet header * This layout allows specifying/receiving the P_Key index. To use * this capability, an application must call the * IB_USER_MAD_ENABLE_PKEY ioctl on the user MAD file handle before * any other actions with the file handle. * @id - ID of agent MAD received with/to be sent with * @status - 0 on successful receive, ETIMEDOUT if no response * received (transaction ID in data[] will be set to TID of original * request) (ignored on send) * @timeout_ms - Milliseconds to wait for response (unset on receive) * @retries - Number of automatic retries to attempt * @qpn - Remote QP number received from/to be sent to * @qkey - Remote Q_Key to be sent with (unset on receive) * @lid - Remote lid received from/to be sent to * @sl - Service level received with/to be sent with * @path_bits - Local path bits received with/to be sent with * @grh_present - If set, GRH was received/should be sent * @gid_index - Local GID index to send with (unset on receive) * @hop_limit - Hop limit in GRH * @traffic_class - Traffic class in GRH * @gid - Remote GID in GRH * @flow_label - Flow label in GRH * @pkey_index - P_Key index */ struct ib_user_mad_hdr { __u32 id; __u32 status; __u32 timeout_ms; __u32 retries; __u32 length; __be32 qpn; __be32 qkey; __be16 lid; __u8 sl; __u8 path_bits; __u8 grh_present; __u8 gid_index; __u8 hop_limit; __u8 traffic_class; __u8 gid[16]; __be32 flow_label; __u16 pkey_index; __u8 reserved[6]; }; /** * ib_user_mad - MAD packet * @hdr - MAD packet header * @data - Contents of MAD * */ struct ib_user_mad { struct ib_user_mad_hdr hdr; __aligned_u64 data[]; }; /* * Earlier versions of this interface definition declared the * method_mask[] member as an array of __u32 but treated it as a * bitmap made up of longs in the kernel. This ambiguity meant that * 32-bit big-endian applications that can run on both 32-bit and * 64-bit kernels had no consistent ABI to rely on, and 64-bit * big-endian applications that treated method_mask as being made up * of 32-bit words would have their bitmap misinterpreted. * * To clear up this confusion, we change the declaration of * method_mask[] to use unsigned long and handle the conversion from * 32-bit userspace to 64-bit kernel for big-endian systems in the * compat_ioctl method. Unfortunately, to keep the structure layout * the same, we need the method_mask[] array to be aligned only to 4 * bytes even when long is 64 bits, which forces us into this ugly * typedef. */ typedef unsigned long __attribute__((aligned(4))) packed_ulong; #define IB_USER_MAD_LONGS_PER_METHOD_MASK (128 / (8 * sizeof (long))) /** * ib_user_mad_reg_req - MAD registration request * @id - Set by the kernel; used to identify agent in future requests. * @qpn - Queue pair number; must be 0 or 1. * @method_mask - The caller will receive unsolicited MADs for any method * where @method_mask = 1. * @mgmt_class - Indicates which management class of MADs should be receive * by the caller. This field is only required if the user wishes to * receive unsolicited MADs, otherwise it should be 0. * @mgmt_class_version - Indicates which version of MADs for the given * management class to receive. * @oui: Indicates IEEE OUI when mgmt_class is a vendor class * in the range from 0x30 to 0x4f. Otherwise not used. * @rmpp_version: If set, indicates the RMPP version used. * */ struct ib_user_mad_reg_req { __u32 id; packed_ulong method_mask[IB_USER_MAD_LONGS_PER_METHOD_MASK]; __u8 qpn; __u8 mgmt_class; __u8 mgmt_class_version; __u8 oui[3]; __u8 rmpp_version; }; /** * ib_user_mad_reg_req2 - MAD registration request * * @id - Set by the _kernel_; used by userspace to identify the * registered agent in future requests. * @qpn - Queue pair number; must be 0 or 1. * @mgmt_class - Indicates which management class of MADs should be * receive by the caller. This field is only required if * the user wishes to receive unsolicited MADs, otherwise * it should be 0. * @mgmt_class_version - Indicates which version of MADs for the given * management class to receive. * @res - Ignored. * @flags - additional registration flags; Must be in the set of * flags defined in IB_USER_MAD_REG_FLAGS_CAP * @method_mask - The caller wishes to receive unsolicited MADs for the * methods whose bit(s) is(are) set. * @oui - Indicates IEEE OUI to use when mgmt_class is a vendor * class in the range from 0x30 to 0x4f. Otherwise not * used. * @rmpp_version - If set, indicates the RMPP version to use. */ enum { IB_USER_MAD_USER_RMPP = (1 << 0), }; #define IB_USER_MAD_REG_FLAGS_CAP (IB_USER_MAD_USER_RMPP) struct ib_user_mad_reg_req2 { __u32 id; __u32 qpn; __u8 mgmt_class; __u8 mgmt_class_version; __u16 res; __u32 flags; __aligned_u64 method_mask[2]; __u32 oui; __u8 rmpp_version; __u8 reserved[3]; }; #endif /* IB_USER_MAD_H */ mlx5-abi.h000064400000033055152526504440006350 0ustar00/* SPDX-License-Identifier: ((GPL-2.0 WITH Linux-syscall-note) OR Linux-OpenIB) */ /* * Copyright (c) 2013-2015, Mellanox Technologies. All rights reserved. * * This software is available to you under a choice of one of two * licenses. You may choose to be licensed under the terms of the GNU * General Public License (GPL) Version 2, available from the file * COPYING in the main directory of this source tree, or the * OpenIB.org BSD license below: * * Redistribution and use in source and binary forms, with or * without modification, are permitted provided that the following * conditions are met: * * - Redistributions of source code must retain the above * copyright notice, this list of conditions and the following * disclaimer. * * - Redistributions in binary form must reproduce the above * copyright notice, this list of conditions and the following * disclaimer in the documentation and/or other materials * provided with the distribution. * * THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, * EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF * MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND * NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS * BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN * ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN * CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE * SOFTWARE. */ #ifndef MLX5_ABI_USER_H #define MLX5_ABI_USER_H #include #include /* For ETH_ALEN. */ #include enum { MLX5_QP_FLAG_SIGNATURE = 1 << 0, MLX5_QP_FLAG_SCATTER_CQE = 1 << 1, MLX5_QP_FLAG_TUNNEL_OFFLOADS = 1 << 2, MLX5_QP_FLAG_BFREG_INDEX = 1 << 3, MLX5_QP_FLAG_TYPE_DCT = 1 << 4, MLX5_QP_FLAG_TYPE_DCI = 1 << 5, MLX5_QP_FLAG_TIR_ALLOW_SELF_LB_UC = 1 << 6, MLX5_QP_FLAG_TIR_ALLOW_SELF_LB_MC = 1 << 7, MLX5_QP_FLAG_ALLOW_SCATTER_CQE = 1 << 8, MLX5_QP_FLAG_PACKET_BASED_CREDIT_MODE = 1 << 9, MLX5_QP_FLAG_UAR_PAGE_INDEX = 1 << 10, MLX5_QP_FLAG_DCI_STREAM = 1 << 11, }; enum { MLX5_SRQ_FLAG_SIGNATURE = 1 << 0, }; enum { MLX5_WQ_FLAG_SIGNATURE = 1 << 0, }; /* Increment this value if any changes that break userspace ABI * compatibility are made. */ #define MLX5_IB_UVERBS_ABI_VERSION 1 /* Make sure that all structs defined in this file remain laid out so * that they pack the same way on 32-bit and 64-bit architectures (to * avoid incompatibility between 32-bit userspace and 64-bit kernels). * In particular do not use pointer types -- pass pointers in __u64 * instead. */ struct mlx5_ib_alloc_ucontext_req { __u32 total_num_bfregs; __u32 num_low_latency_bfregs; }; enum mlx5_lib_caps { MLX5_LIB_CAP_4K_UAR = (__u64)1 << 0, MLX5_LIB_CAP_DYN_UAR = (__u64)1 << 1, }; enum mlx5_ib_alloc_uctx_v2_flags { MLX5_IB_ALLOC_UCTX_DEVX = 1 << 0, }; struct mlx5_ib_alloc_ucontext_req_v2 { __u32 total_num_bfregs; __u32 num_low_latency_bfregs; __u32 flags; __u32 comp_mask; __u8 max_cqe_version; __u8 reserved0; __u16 reserved1; __u32 reserved2; __aligned_u64 lib_caps; }; enum mlx5_ib_alloc_ucontext_resp_mask { MLX5_IB_ALLOC_UCONTEXT_RESP_MASK_CORE_CLOCK_OFFSET = 1UL << 0, MLX5_IB_ALLOC_UCONTEXT_RESP_MASK_DUMP_FILL_MKEY = 1UL << 1, MLX5_IB_ALLOC_UCONTEXT_RESP_MASK_ECE = 1UL << 2, MLX5_IB_ALLOC_UCONTEXT_RESP_MASK_SQD2RTS = 1UL << 3, MLX5_IB_ALLOC_UCONTEXT_RESP_MASK_REAL_TIME_TS = 1UL << 4, MLX5_IB_ALLOC_UCONTEXT_RESP_MASK_MKEY_UPDATE_TAG = 1UL << 5, }; enum mlx5_user_cmds_supp_uhw { MLX5_USER_CMDS_SUPP_UHW_QUERY_DEVICE = 1 << 0, MLX5_USER_CMDS_SUPP_UHW_CREATE_AH = 1 << 1, }; /* The eth_min_inline response value is set to off-by-one vs the FW * returned value to allow user-space to deal with older kernels. */ enum mlx5_user_inline_mode { MLX5_USER_INLINE_MODE_NA, MLX5_USER_INLINE_MODE_NONE, MLX5_USER_INLINE_MODE_L2, MLX5_USER_INLINE_MODE_IP, MLX5_USER_INLINE_MODE_TCP_UDP, }; enum { MLX5_USER_ALLOC_UCONTEXT_FLOW_ACTION_FLAGS_ESP_AES_GCM = 1 << 0, MLX5_USER_ALLOC_UCONTEXT_FLOW_ACTION_FLAGS_ESP_AES_GCM_REQ_METADATA = 1 << 1, MLX5_USER_ALLOC_UCONTEXT_FLOW_ACTION_FLAGS_ESP_AES_GCM_SPI_STEERING = 1 << 2, MLX5_USER_ALLOC_UCONTEXT_FLOW_ACTION_FLAGS_ESP_AES_GCM_FULL_OFFLOAD = 1 << 3, MLX5_USER_ALLOC_UCONTEXT_FLOW_ACTION_FLAGS_ESP_AES_GCM_TX_IV_IS_ESN = 1 << 4, }; struct mlx5_ib_alloc_ucontext_resp { __u32 qp_tab_size; __u32 bf_reg_size; __u32 tot_bfregs; __u32 cache_line_size; __u16 max_sq_desc_sz; __u16 max_rq_desc_sz; __u32 max_send_wqebb; __u32 max_recv_wr; __u32 max_srq_recv_wr; __u16 num_ports; __u16 flow_action_flags; __u32 comp_mask; __u32 response_length; __u8 cqe_version; __u8 cmds_supp_uhw; __u8 eth_min_inline; __u8 clock_info_versions; __aligned_u64 hca_core_clock_offset; __u32 log_uar_size; __u32 num_uars_per_page; __u32 num_dyn_bfregs; __u32 dump_fill_mkey; }; struct mlx5_ib_alloc_pd_resp { __u32 pdn; }; struct mlx5_ib_tso_caps { __u32 max_tso; /* Maximum tso payload size in bytes */ /* Corresponding bit will be set if qp type from * 'enum ib_qp_type' is supported, e.g. * supported_qpts |= 1 << IB_QPT_UD */ __u32 supported_qpts; }; struct mlx5_ib_rss_caps { __aligned_u64 rx_hash_fields_mask; /* enum mlx5_rx_hash_fields */ __u8 rx_hash_function; /* enum mlx5_rx_hash_function_flags */ __u8 reserved[7]; }; enum mlx5_ib_cqe_comp_res_format { MLX5_IB_CQE_RES_FORMAT_HASH = 1 << 0, MLX5_IB_CQE_RES_FORMAT_CSUM = 1 << 1, MLX5_IB_CQE_RES_FORMAT_CSUM_STRIDX = 1 << 2, }; struct mlx5_ib_cqe_comp_caps { __u32 max_num; __u32 supported_format; /* enum mlx5_ib_cqe_comp_res_format */ }; enum mlx5_ib_packet_pacing_cap_flags { MLX5_IB_PP_SUPPORT_BURST = 1 << 0, }; struct mlx5_packet_pacing_caps { __u32 qp_rate_limit_min; __u32 qp_rate_limit_max; /* In kpbs */ /* Corresponding bit will be set if qp type from * 'enum ib_qp_type' is supported, e.g. * supported_qpts |= 1 << IB_QPT_RAW_PACKET */ __u32 supported_qpts; __u8 cap_flags; /* enum mlx5_ib_packet_pacing_cap_flags */ __u8 reserved[3]; }; enum mlx5_ib_mpw_caps { MPW_RESERVED = 1 << 0, MLX5_IB_ALLOW_MPW = 1 << 1, MLX5_IB_SUPPORT_EMPW = 1 << 2, }; enum mlx5_ib_sw_parsing_offloads { MLX5_IB_SW_PARSING = 1 << 0, MLX5_IB_SW_PARSING_CSUM = 1 << 1, MLX5_IB_SW_PARSING_LSO = 1 << 2, }; struct mlx5_ib_sw_parsing_caps { __u32 sw_parsing_offloads; /* enum mlx5_ib_sw_parsing_offloads */ /* Corresponding bit will be set if qp type from * 'enum ib_qp_type' is supported, e.g. * supported_qpts |= 1 << IB_QPT_RAW_PACKET */ __u32 supported_qpts; }; struct mlx5_ib_striding_rq_caps { __u32 min_single_stride_log_num_of_bytes; __u32 max_single_stride_log_num_of_bytes; __u32 min_single_wqe_log_num_of_strides; __u32 max_single_wqe_log_num_of_strides; /* Corresponding bit will be set if qp type from * 'enum ib_qp_type' is supported, e.g. * supported_qpts |= 1 << IB_QPT_RAW_PACKET */ __u32 supported_qpts; __u32 reserved; }; struct mlx5_ib_dci_streams_caps { __u8 max_log_num_concurent; __u8 max_log_num_errored; }; enum mlx5_ib_query_dev_resp_flags { /* Support 128B CQE compression */ MLX5_IB_QUERY_DEV_RESP_FLAGS_CQE_128B_COMP = 1 << 0, MLX5_IB_QUERY_DEV_RESP_FLAGS_CQE_128B_PAD = 1 << 1, MLX5_IB_QUERY_DEV_RESP_PACKET_BASED_CREDIT_MODE = 1 << 2, MLX5_IB_QUERY_DEV_RESP_FLAGS_SCAT2CQE_DCT = 1 << 3, }; enum mlx5_ib_tunnel_offloads { MLX5_IB_TUNNELED_OFFLOADS_VXLAN = 1 << 0, MLX5_IB_TUNNELED_OFFLOADS_GRE = 1 << 1, MLX5_IB_TUNNELED_OFFLOADS_GENEVE = 1 << 2, MLX5_IB_TUNNELED_OFFLOADS_MPLS_GRE = 1 << 3, MLX5_IB_TUNNELED_OFFLOADS_MPLS_UDP = 1 << 4, }; struct mlx5_ib_query_device_resp { __u32 comp_mask; __u32 response_length; struct mlx5_ib_tso_caps tso_caps; struct mlx5_ib_rss_caps rss_caps; struct mlx5_ib_cqe_comp_caps cqe_comp_caps; struct mlx5_packet_pacing_caps packet_pacing_caps; __u32 mlx5_ib_support_multi_pkt_send_wqes; __u32 flags; /* Use enum mlx5_ib_query_dev_resp_flags */ struct mlx5_ib_sw_parsing_caps sw_parsing_caps; struct mlx5_ib_striding_rq_caps striding_rq_caps; __u32 tunnel_offloads_caps; /* enum mlx5_ib_tunnel_offloads */ struct mlx5_ib_dci_streams_caps dci_streams_caps; __u16 reserved; }; enum mlx5_ib_create_cq_flags { MLX5_IB_CREATE_CQ_FLAGS_CQE_128B_PAD = 1 << 0, MLX5_IB_CREATE_CQ_FLAGS_UAR_PAGE_INDEX = 1 << 1, MLX5_IB_CREATE_CQ_FLAGS_REAL_TIME_TS = 1 << 2, }; struct mlx5_ib_create_cq { __aligned_u64 buf_addr; __aligned_u64 db_addr; __u32 cqe_size; __u8 cqe_comp_en; __u8 cqe_comp_res_format; __u16 flags; __u16 uar_page_index; __u16 reserved0; __u32 reserved1; }; struct mlx5_ib_create_cq_resp { __u32 cqn; __u32 reserved; }; struct mlx5_ib_resize_cq { __aligned_u64 buf_addr; __u16 cqe_size; __u16 reserved0; __u32 reserved1; }; struct mlx5_ib_create_srq { __aligned_u64 buf_addr; __aligned_u64 db_addr; __u32 flags; __u32 reserved0; /* explicit padding (optional on i386) */ __u32 uidx; __u32 reserved1; }; struct mlx5_ib_create_srq_resp { __u32 srqn; __u32 reserved; }; struct mlx5_ib_create_qp_dci_streams { __u8 log_num_concurent; __u8 log_num_errored; }; struct mlx5_ib_create_qp { __aligned_u64 buf_addr; __aligned_u64 db_addr; __u32 sq_wqe_count; __u32 rq_wqe_count; __u32 rq_wqe_shift; __u32 flags; __u32 uidx; __u32 bfreg_index; union { __aligned_u64 sq_buf_addr; __aligned_u64 access_key; }; __u32 ece_options; struct mlx5_ib_create_qp_dci_streams dci_streams; __u16 reserved; }; /* RX Hash function flags */ enum mlx5_rx_hash_function_flags { MLX5_RX_HASH_FUNC_TOEPLITZ = 1 << 0, }; /* * RX Hash flags, these flags allows to set which incoming packet's field should * participates in RX Hash. Each flag represent certain packet's field, * when the flag is set the field that is represented by the flag will * participate in RX Hash calculation. * Note: *IPV4 and *IPV6 flags can't be enabled together on the same QP * and *TCP and *UDP flags can't be enabled together on the same QP. */ enum mlx5_rx_hash_fields { MLX5_RX_HASH_SRC_IPV4 = 1 << 0, MLX5_RX_HASH_DST_IPV4 = 1 << 1, MLX5_RX_HASH_SRC_IPV6 = 1 << 2, MLX5_RX_HASH_DST_IPV6 = 1 << 3, MLX5_RX_HASH_SRC_PORT_TCP = 1 << 4, MLX5_RX_HASH_DST_PORT_TCP = 1 << 5, MLX5_RX_HASH_SRC_PORT_UDP = 1 << 6, MLX5_RX_HASH_DST_PORT_UDP = 1 << 7, MLX5_RX_HASH_IPSEC_SPI = 1 << 8, /* Save bits for future fields */ MLX5_RX_HASH_INNER = (1UL << 31), }; struct mlx5_ib_create_qp_rss { __aligned_u64 rx_hash_fields_mask; /* enum mlx5_rx_hash_fields */ __u8 rx_hash_function; /* enum mlx5_rx_hash_function_flags */ __u8 rx_key_len; /* valid only for Toeplitz */ __u8 reserved[6]; __u8 rx_hash_key[128]; /* valid only for Toeplitz */ __u32 comp_mask; __u32 flags; }; enum mlx5_ib_create_qp_resp_mask { MLX5_IB_CREATE_QP_RESP_MASK_TIRN = 1UL << 0, MLX5_IB_CREATE_QP_RESP_MASK_TISN = 1UL << 1, MLX5_IB_CREATE_QP_RESP_MASK_RQN = 1UL << 2, MLX5_IB_CREATE_QP_RESP_MASK_SQN = 1UL << 3, MLX5_IB_CREATE_QP_RESP_MASK_TIR_ICM_ADDR = 1UL << 4, }; struct mlx5_ib_create_qp_resp { __u32 bfreg_index; __u32 ece_options; __u32 comp_mask; __u32 tirn; __u32 tisn; __u32 rqn; __u32 sqn; __u32 reserved1; __u64 tir_icm_addr; }; struct mlx5_ib_alloc_mw { __u32 comp_mask; __u8 num_klms; __u8 reserved1; __u16 reserved2; }; enum mlx5_ib_create_wq_mask { MLX5_IB_CREATE_WQ_STRIDING_RQ = (1 << 0), }; struct mlx5_ib_create_wq { __aligned_u64 buf_addr; __aligned_u64 db_addr; __u32 rq_wqe_count; __u32 rq_wqe_shift; __u32 user_index; __u32 flags; __u32 comp_mask; __u32 single_stride_log_num_of_bytes; __u32 single_wqe_log_num_of_strides; __u32 two_byte_shift_en; }; struct mlx5_ib_create_ah_resp { __u32 response_length; __u8 dmac[ETH_ALEN]; __u8 reserved[6]; }; struct mlx5_ib_burst_info { __u32 max_burst_sz; __u16 typical_pkt_sz; __u16 reserved; }; struct mlx5_ib_modify_qp { __u32 comp_mask; struct mlx5_ib_burst_info burst_info; __u32 ece_options; }; struct mlx5_ib_modify_qp_resp { __u32 response_length; __u32 dctn; __u32 ece_options; __u32 reserved; }; struct mlx5_ib_create_wq_resp { __u32 response_length; __u32 reserved; }; struct mlx5_ib_create_rwq_ind_tbl_resp { __u32 response_length; __u32 reserved; }; struct mlx5_ib_modify_wq { __u32 comp_mask; __u32 reserved; }; struct mlx5_ib_clock_info { __u32 sign; __u32 resv; __aligned_u64 nsec; __aligned_u64 cycles; __aligned_u64 frac; __u32 mult; __u32 shift; __aligned_u64 mask; __aligned_u64 overflow_period; }; enum mlx5_ib_mmap_cmd { MLX5_IB_MMAP_REGULAR_PAGE = 0, MLX5_IB_MMAP_GET_CONTIGUOUS_PAGES = 1, MLX5_IB_MMAP_WC_PAGE = 2, MLX5_IB_MMAP_NC_PAGE = 3, /* 5 is chosen in order to be compatible with old versions of libmlx5 */ MLX5_IB_MMAP_CORE_CLOCK = 5, MLX5_IB_MMAP_ALLOC_WC = 6, MLX5_IB_MMAP_CLOCK_INFO = 7, MLX5_IB_MMAP_DEVICE_MEM = 8, }; enum { MLX5_IB_CLOCK_INFO_KERNEL_UPDATING = 1, }; /* Bit indexes for the mlx5_alloc_ucontext_resp.clock_info_versions bitmap */ enum { MLX5_IB_CLOCK_INFO_V1 = 0, }; struct mlx5_ib_flow_counters_desc { __u32 description; __u32 index; }; struct mlx5_ib_flow_counters_data { RDMA_UAPI_PTR(struct mlx5_ib_flow_counters_desc *, counters_data); __u32 ncounters; __u32 reserved; }; struct mlx5_ib_create_flow { __u32 ncounters_data; __u32 reserved; /* * Following are counters data based on ncounters_data, each * entry in the data[] should match a corresponding counter object * that was pointed by a counters spec upon the flow creation */ struct mlx5_ib_flow_counters_data data[]; }; #endif /* MLX5_ABI_USER_H */ siw-abi.h000064400000006514152526504440006265 0ustar00/* SPDX-License-Identifier: GPL-2.0 or BSD-3-Clause */ /* Authors: Bernard Metzler */ /* Copyright (c) 2008-2019, IBM Corporation */ #ifndef _SIW_USER_H #define _SIW_USER_H #include #define SIW_NODE_DESC_COMMON "Software iWARP stack" #define SIW_ABI_VERSION 1 #define SIW_MAX_SGE 6 #define SIW_UOBJ_MAX_KEY 0x08FFFF #define SIW_INVAL_UOBJ_KEY (SIW_UOBJ_MAX_KEY + 1) struct siw_uresp_create_cq { __u32 cq_id; __u32 num_cqe; __aligned_u64 cq_key; }; struct siw_uresp_create_qp { __u32 qp_id; __u32 num_sqe; __u32 num_rqe; __u32 pad; __aligned_u64 sq_key; __aligned_u64 rq_key; }; struct siw_ureq_reg_mr { __u8 stag_key; __u8 reserved[3]; __u32 pad; }; struct siw_uresp_reg_mr { __u32 stag; __u32 pad; }; struct siw_uresp_create_srq { __u32 num_rqe; __u32 pad; __aligned_u64 srq_key; }; struct siw_uresp_alloc_ctx { __u32 dev_id; __u32 pad; }; enum siw_opcode { SIW_OP_WRITE, SIW_OP_READ, SIW_OP_READ_LOCAL_INV, SIW_OP_SEND, SIW_OP_SEND_WITH_IMM, SIW_OP_SEND_REMOTE_INV, /* Unsupported */ SIW_OP_FETCH_AND_ADD, SIW_OP_COMP_AND_SWAP, SIW_OP_RECEIVE, /* provider internal SQE */ SIW_OP_READ_RESPONSE, /* * below opcodes valid for * in-kernel clients only */ SIW_OP_INVAL_STAG, SIW_OP_REG_MR, SIW_NUM_OPCODES }; /* Keep it same as ibv_sge to allow for memcpy */ struct siw_sge { __aligned_u64 laddr; __u32 length; __u32 lkey; }; /* * Inline data are kept within the work request itself occupying * the space of sge[1] .. sge[n]. Therefore, __inline__ data cannot be * supported if SIW_MAX_SGE is below 2 elements. */ #define SIW_MAX_INLINE (sizeof(struct siw_sge) * (SIW_MAX_SGE - 1)) #if SIW_MAX_SGE < 2 #error "SIW_MAX_SGE must be at least 2" #endif enum siw_wqe_flags { SIW_WQE_VALID = 1, SIW_WQE_INLINE = (1 << 1), SIW_WQE_SIGNALLED = (1 << 2), SIW_WQE_SOLICITED = (1 << 3), SIW_WQE_READ_FENCE = (1 << 4), SIW_WQE_REM_INVAL = (1 << 5), SIW_WQE_COMPLETED = (1 << 6) }; /* Send Queue Element */ struct siw_sqe { __aligned_u64 id; __u16 flags; __u8 num_sge; /* Contains enum siw_opcode values */ __u8 opcode; __u32 rkey; union { __aligned_u64 raddr; __aligned_u64 base_mr; }; union { struct siw_sge sge[SIW_MAX_SGE]; __aligned_u64 access; }; }; /* Receive Queue Element */ struct siw_rqe { __aligned_u64 id; __u16 flags; __u8 num_sge; /* * only used by kernel driver, * ignored if set by user */ __u8 opcode; __u32 unused; struct siw_sge sge[SIW_MAX_SGE]; }; enum siw_notify_flags { SIW_NOTIFY_NOT = (0), SIW_NOTIFY_SOLICITED = (1 << 0), SIW_NOTIFY_NEXT_COMPLETION = (1 << 1), SIW_NOTIFY_MISSED_EVENTS = (1 << 2), SIW_NOTIFY_ALL = SIW_NOTIFY_SOLICITED | SIW_NOTIFY_NEXT_COMPLETION | SIW_NOTIFY_MISSED_EVENTS }; enum siw_wc_status { SIW_WC_SUCCESS, SIW_WC_LOC_LEN_ERR, SIW_WC_LOC_PROT_ERR, SIW_WC_LOC_QP_OP_ERR, SIW_WC_WR_FLUSH_ERR, SIW_WC_BAD_RESP_ERR, SIW_WC_LOC_ACCESS_ERR, SIW_WC_REM_ACCESS_ERR, SIW_WC_REM_INV_REQ_ERR, SIW_WC_GENERAL_ERR, SIW_NUM_WC_STATUS }; struct siw_cqe { __aligned_u64 id; __u8 flags; __u8 opcode; __u16 status; __u32 bytes; union { __aligned_u64 imm_data; __u32 inval_stag; }; /* QP number or QP pointer */ union { struct ib_qp *base_qp; __aligned_u64 qp_id; }; }; /* * Shared structure between user and kernel * to control CQ arming. */ struct siw_cq_ctrl { __u32 flags; __u32 pad; }; #endif